WorldWideScience

Sample records for boophilus microplus repletas

  1. Failure of Boophilus microplus to transmit irradiated Babesia bovis

    Energy Technology Data Exchange (ETDEWEB)

    Wright, I.G.; Mirre, G.B.; Mahoney, D.F.; Goodger, B.V. (Commonwealth Scientific and Industrial Research Organization, Indooroopilly (Australia). Long Pocket Labs.)

    1983-01-01

    Babesia bovis parasites which had either been freshly irradiated or had been reisolated from cattle infected 12 months previously with irradiated organisms were not transmitted transovarially by cattle ticks (Boophilus microplus). The parent unirradiated strain of B bovis was readily transmitted in this manner after being in host cattle for 12 months.

  2. Failure of Boophilus microplus to transmit irradiated Babesia bovis

    International Nuclear Information System (INIS)

    Babesia bovis parasites which had either been freshly irradiated or had been reisolated from cattle infected 12 months previously with irradiated organisms were not transmitted transovarially by cattle ticks (Boophilus microplus). The parent unirradiated strain of B bovis was readily transmitted in this manner after being in host cattle for 12 months. (author)

  3. Resistencia de la garrapata Boophilus microplus a los ixodicidas

    OpenAIRE

    M. A. Alonso-Díaz; R I Rodríguez-Vivas; H Fragoso-Sánchez; R Rosario-Cruz

    2006-01-01

    La resistencia de las garrapatas a los ixodicidas es uno de los principales problemas que afectan a los productores bovinos en el subtrópico y trópico, donde las garrapatas, especialmente Boophilus microplus y los agentes que transmiten, tienen un efecto costo-beneficio en la producción. El objetivo de la presente revisión es dar a conocer los principales hallazgos de la resistencia de B. microplus. Se presenta la definición, desarrollo, evolución y el diagnóstico de la resistencia. Asimismo,...

  4. Resistencia de la garrapata Boophilus microplus a los ixodicidas Ixodicide resistance of the the Boophilus microplus tick to ixodicides

    OpenAIRE

    M. A. Alonso-Díaz; R I Rodríguez-Vivas; H Fragoso-Sánchez; R Rosario-Cruz

    2006-01-01

    La resistencia de las garrapatas a los ixodicidas es uno de los principales problemas que afectan a los productores bovinos en el subtrópico y trópico, donde las garrapatas, especialmente Boophilus microplus y los agentes que transmiten, tienen un efecto costo-beneficio en la producción. El objetivo de la presente revisión es dar a conocer los principales hallazgos de la resistencia de B. microplus. Se presenta la definición, desarrollo, evolución y el diagnóstico de la resistencia. Asimismo,...

  5. Resistencia de la garrapata Boophilus microplus a los ixodicidas Ixodicide resistance of the the Boophilus microplus tick to ixodicides

    Directory of Open Access Journals (Sweden)

    M A Alonso-Díaz

    2006-01-01

    Full Text Available La resistencia de las garrapatas a los ixodicidas es uno de los principales problemas que afectan a los productores bovinos en el subtrópico y trópico, donde las garrapatas, especialmente Boophilus microplus y los agentes que transmiten, tienen un efecto costo-beneficio en la producción. El objetivo de la presente revisión es dar a conocer los principales hallazgos de la resistencia de B. microplus. Se presenta la definición, desarrollo, evolución y el diagnóstico de la resistencia. Asimismo, se presenta la distribución mundial de la resistencia de las garrapatas, especialmente en México. Se concluye que la resistencia de las garrapatas a los ixodicidas es un problema importante en la producción bovina y se necesitan implementar medidas estratégicas para reducir o retardar el impacto en la ganadería bovina.The tick is a major problem for cattle producers in subtropical and tropical areas where ticks, especially Boophilus microplus, and the disease agents that they transmit, are a constraint to cost-effective production. The aim of the present review is to present the most important findings of acaricide resistance in the B. microplus tick. The definition, development, evolution and diagnosis of tick resistance are presented. The distribution of tick resistance in the world, especially in Mexico is also presented. It is concluded that tick resistance is an important problem for cattle production and strategies need to be developed to reduce the impact on cattle.

  6. Commercialisation of a recombinant vaccine against Boophilus microplus.

    Science.gov (United States)

    Willadsen, P; Bird, P; Cobon, G S; Hungerford, J

    1995-01-01

    Increasingly, there is need for methods to control cattle tick (Boophilus microplus) infestations by the use of non-chemical technology. This need is brought about by a mixture of market forces and the failure or inadequacy of existing technology. A recombinant vaccine has now been developed against the tick. This vaccine relies on the uptake with the blood meal of antibody directed against a critical protein in the tick gut. The isolation of the vaccine antigen, Bm86, and its production as a recombinant protein is briefly described. The vaccine has been tested in the field, has been taken through the full registration process and is now in commercial use in Australia. A related development has occurred in Cuba. The potential for improvement of the current vaccine and for the development of similar vaccines against other haematophagous parasites is discussed. PMID:7784128

  7. Assessment of bacterial diversity in the cattle tick Rhipicephalus (Boophilus) microplus through tag-encoded pyrosequencing

    OpenAIRE

    Bendele Kylie G; Guerrero Felix D; Dowd Scot E; Pérez de León Adalberto A; Andreotti Renato; Scoles Glen A

    2011-01-01

    Abstract Background Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The cattle tick, Rhipicephalus (Boophilus) microplus, hinders livestock production in tropical and subtropical parts of the world where it is endemic. Tick microbiomes remain largely unexplored. The objective of this study was to explore the R. microplus microbiome by applying the bacterial 16S tag-encoded FLX-titanium amplicon pyrosequencing (bTEFAP) technique to cha...

  8. Competição intraespecífica em Boophilus microplus Intra-specific competition in Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Andreia Passos dos Santos

    2002-12-01

    Full Text Available O presente trabalho foi desenvolvido no Campo Experimental da Embrapa Gado de Leite, Coronel Pacheco, Minas Gerais, Brasil, tendo como objetivo a verificação da ocorrência de competição intra-específica durante a fase parasitária do carrapato bovino Boophilus microplus e a confirmação da correlação positiva entre o peso da fêmea ingurgitada e o peso da massa de ovos. Foram feitas observações em bovinos infestados naturalmente e experimentalmente, com cargas parasitárias e intervalos diferenciados. Os animais infestados permaneceram em baias individuais durante todo o período de queda das fêmeas ingurgitadas, para que estas pudessem ser coletadas diariamente. As diferenças observadas entre as médias de peso das fêmeas ingurgitadas, no decorrer dos dias de queda, sugeriram a ocorrência de competição durante a fase de alimentação. Observou-se também que o potencial de oviposição está diretamente relacionado a sua capacidade de alimentação.This study was developed in the Experimental Station of Embrapa Dairy Cattle, Coronel Pacheco, Minas Gerais, Brazil, and had the aim of verifying the occurrence of intra-specific competition in the cattle tick Boophilus microplus during its parasite life and to confirm the relation between the weight of engorged females and the egg mass laid. Observations were done with cattle naturally and experimentally infested with different quantities of larvae during different intervals of time. The infested animals remained in individual stalls for the whole period of engorged females drop-off, in order to collect them daily. The observed differences among weight of engorged females during drop-off days suggested the competition occurrence during the feeding phase. It was also seen that the oviposition potential of an engorged female is directly related to its feeding capacity.

  9. Control de Rhipicephalus (Boophilus microplus (Acari: Ixodidae con extractos vegetales Control of Rhipicephalus (Boophilus microplus (Acari: Ixodidae with vegetable extracts

    Directory of Open Access Journals (Sweden)

    SÔNIA MARIA FORTI BROGLIO MICHELETTI

    2009-12-01

    Full Text Available Se evaluó la eficiencia de varios extractos vegetales como controladores de la garrapata Rhipicephalus (Boophilus microplus en condiciones de laboratorio. Hembras ingurgitadas se recolectaron de bovinos y se aislaron en cajas de petri. Se emplearon extractos orgánicos alcohólicos al 1% (p/v de semillas de Annona muricata (Annonaceae, flores de Syzygium malaccensis (Myrtaceae, hojas de Cymbopogon citratus (Poaceae, hojas de Azadirachta indica (Meliaceae y extracto hexánico de semillas de A. indica. El testigo consistió en hembras sin tratar y tratadas con agua destilada y esterilizada y dimetilsulfóxido (DMSO a una concentración de 1%. El extracto de semillas de A. muricata mostró tener mayor poder acaricida, con 100% de eficiencia, seguido de los extractos de flores de S. malaccensis (75% y 57,25% y semillas de A. indica (65% y 38,50%. Hubo 100% en la reducción de la eclosión de las larvas nacidas a partir de hembras tratadas con extracto de semillas de A. muricata.The efficacy of various plant extracts in the control of Rhipicephalus (Boophilus microplus was evaluated in the laboratory. Engorged females were collected from cattle and were isolated in Petri dishes. Organic alcoholic extracts at 1% (weight/volume were used from seeds of Annona muricata (Annonaceae, flowers of Syzygium malaccensis (Myrtaceae, leaves of Cymbopogon citratus (Poaceae, leaves of Azadirachta indica (Meliaceae and hexane extract 1% (weight/volume of A. indica seeds. The control groups consisted of females either untreated or treated with distilled and sterile water and dimethylsulfoxide (DMSO at a concentration of 1%. The extract of A. muricata seeds showed the highest acaricide power, with 100% efficacy, followed by flower extracts of S. malaccensis (75% and 57.25% and seeds of A. indica (65% and 38.50%. There was a 100% reduction in the eclosion of larvae from eggs of females treated with the seed extract of A. muricata.

  10. Tripanosomatídeos similares a Trypanosoma theileri no carrapato dos bovinos Boophilus microplus Tripanosomatides like Trypanosoma theileri in the cattle tick Boophilus microplus

    Directory of Open Access Journals (Sweden)

    João Ricardo Martins

    2008-06-01

    Full Text Available Descreve-se a ocorrência de formas epimastigotas de um tripanosomatideo na hemolinfa do carrapato do bovino Boophilus microplus no Estado do Rio Grande do Sul. Evidências morfológicas sugerem tratar-se de Trypanosoma theileri , espécie descrita como não patogênica aos bovinos e que usualmente é transmitida por tabanídeos.Findings of epimastigotes forms of a tripanosomatide is reported in the hemolymph of the cattle tick Boophilus microplus in the state of Rio Grande do Sul, southern Brazil. Morphological evidences suggest they are similar to Trypanosoma theileri, a species described as non pathogenic to cattle, and usually transmitted by tabanids.

  11. Control de garrapatas Riphicephalus (Boophilus microplus en bovinos con el inmunógeno Herber biogar - Control of Riphicephalus (Boophilus microplus ticks in bovine with the Herber biogar inmunógeno

    Directory of Open Access Journals (Sweden)

    Botello A.R.

    2011-05-01

    Full Text Available ResumenLa presente investigación se realizó con el objetivo de controlar la garrapata Riphicephalus (Boophilus microplus por medio del inmunógeno Herber biogar en bovinos en el municipio de Guanare, Portuguesa, Venezuela.SummaryThis research was conducted with the aim of controlling the tickRiphicephalus (Boophilus microplus through Herber biogar immunogen incattle in the town of Guanare, Portuguesa, Venezuela.

  12. Control de garrapatas Riphicephalus (Boophilus) microplus en bovinos con el inmunógeno Herber biogar - Control of Riphicephalus (Boophilus) microplus ticks in bovine with the Herber biogar inmunógeno

    OpenAIRE

    Botello A.R.; Botello A.L.; Fajardo H.; Pérez Kirenia C.; Gómez I.A.; Borroto C.N.; Marisela Suárez; Pérez Dunia A.; Linares Belkis R.; Colicchia Maribel R.; Peraza Paula S.; Rodríguez Y.V.; González A.O.; Rodríguez A.N.; Gort A.M.

    2011-01-01

    ResumenLa presente investigación se realizó con el objetivo de controlar la garrapata Riphicephalus (Boophilus) microplus por medio del inmunógeno Herber biogar en bovinos en el municipio de Guanare, Portuguesa, Venezuela.SummaryThis research was conducted with the aim of controlling the tickRiphicephalus (Boophilus) microplus through Herber biogar immunogen incattle in the town of Guanare, Portuguesa, Venezuela.

  13. Identificación de un polimorfismo del gen Est9 relacionado con resistencia a piretroides en Rhipicephalus (Boophilus) microplus

    OpenAIRE

    Edgar Diaz R.; Gustavo Vallejo

    2013-01-01

    RESUMENObjetivo. Mediante procedimientos de PCR-RFLP, detectar un polimorfismo en el gen Est9 de garrapatas Rhipicephalus (Boophilus) microplus resistentes a piretroides en Ibagué, Colombia, determinando el grado de asociación entre los fenotipos y los genotipos resultantes. Materiales y métodos. El ADN de 30 teleoginas R. (Boophilus) microplus fenotípicamente susceptibles, resistentes o medianamente resistentes a piretroides en una prueba de Drummond modificada, fue amplificado por PCR con c...

  14. Bovine immunoprotection against Rhipicephalus (Boophilus) microplus with recombinant Bm86-Campo Grande antigen Imunoproteção de bovinos contra Rhipicephalus (Boophilus) microplus com antígeno recombinante Bm86-Campo Grande

    OpenAIRE

    Rodrigo Casquero Cunha; Adalberto Angel Pérez de León; Fábio Pereira Leivas Leite; Luciano da Silva Pinto; Alceu Gonçalves dos Santos Júnior; Renato Andreotti

    2012-01-01

    The southern cattle fever tick, Rhipicephalus (Boophilus) microplus, is no doubt the most economically important ectoparasite of cattle globally. The inappropriate use of chemical acaricides has driven the evolution of resistance in populations of R. (B.) microplus. Anti-tick vaccines represent a technology that can be combined with acaricides in integrated control programs to mitigate the impact of R. (B.) microplus. The recombinant form of Bm86 antigen from the Campo Grande (rBm86-CG) strai...

  15. A Novel Carbamate Insecticide with Superior Selectivity for Cattle Tick (Boophilus microplus) and Sand Fly (Phlebotomus papatasi) Control

    Science.gov (United States)

    The cattle tick, Boophilus microplus, and the sand fly, Phlebotomus papatasi (Pp), are vectors of infectious agents affecting cattle and humans, respectively. The purpose of this study was to characterize the inhibitor profile of acetylcholinesterases from R. microplus(BmAChE1) and Pp (PpAchE) for c...

  16. AVALIAÇÃO IN VITRO DE FITOTERÁPICOS NO CONTROLE DE RHIPICEPHALUS BOOPHILUS MICROPLUS

    OpenAIRE

    Carlos Augusto Nicolino; Rafael Mendonça Paranhos; Willian Maciel

    2013-01-01

    The use of herbal medicines is considered an important alternative to control pests, and can reduce economic and environmental impacts the use of synthetic pesticides. The present study aimed at comparing the in vitro action of essential oils against engorged females of Rhipicephalus (Boophilus) microplus. Essential oil was used Azadiracta indica (Neem), Cymbopogom nardus L. Rendle (Citronella) and Cymbopogon citratus (lemon-grass) in the following concentrations: 12.5%, 6%, 3% and 1%. Maximu...

  17. Susceptibility of Boophilus microplus (Canestrini, 1887) (Acari: Ixodidae) to seven ixodicides in Nuevo Leon, Mexico

    OpenAIRE

    Jesús A. Esparza Rentería; Emily Lizett Esparza Sevilla

    2015-01-01

    This article reports the results of research only. Mention of a proprietary product does not constitute an endorsement or a recommendation by the FAUANL for its use Animal husbandry and meat industry in Mexico are one of the principal activities of the agricultural sector of the country, which are threatened by factors that affect the production of meat, skin and milk; among these, the damages caused by Boophilus microplus (Canestrini), the common tick of cattle, and the diseases it transm...

  18. In vitro effects of Pilocarpus microphyllus extracts and pilocarpine hydrochloride on Rhipicephalus (Boophilus) microplus

    OpenAIRE

    Karina Neoob de Carvalho Castro; David Fernandes Lima; Dolores Wolschick; Ivanilza Moreira de Andrade; Raimunda Cardoso dos Santos; Francisco José de Seixas dos Santos; Leiz Maria Costa Veras; Lívio Martins Costa-Júnior

    2016-01-01

    Abstract The aim of this study was to assess the activity of aqueous (AE) and ethanolic extracts (EE) and pilocarpine hydrochloride, which were extracted and isolated from Pilocarpus microphyllus (Jaborandi), respectively, on Rhipicephalus (Boophilus) microplus. High performance liquid chromatography (HPLC) was performed to quantify these compounds. Larval packet and adult immersion tests were conducted with different concentrations. Five AE and EE concentrations, ranging from 6.2 to 100.0 mg...

  19. Boophiline, an Antimicrobial Sterol Amide from the Cattle Tick Boophilus microplus

    OpenAIRE

    Potterat, Olivier; Hostettmann, Kurt; Höltzel, Alexandra; Jung, Günther; Diehl, Peter A.; Petrini, Orlando

    2008-01-01

    Boophiline (1), a new sterol amide was isolated from the cattle tick Boophilus microplus (Ixodidae). The structure was assigned as N-[3-(sulfooxy)-25ξ-cholest-5-en-26-oyl]-L-isoleucine by detailed 2D NMR investigations in conjunction with FAB mass spectrometry and acidic hydrolyses. Complete assignment of the diastereotopic methylene protons of the ring system could be deduced from the NMR data. In agar dilution assays, 1 exhibited antifungal properties against Cladosporium cucumerinum and an...

  20. Bovine immunoprotection against Rhipicephalus (Boophilus) microplus with recombinant Bm86-Campo Grande antigen.

    Science.gov (United States)

    Cunha, Rodrigo Casquero; Pérez de León, Adalberto Angel; Leite, Fábio Pereira Leivas; Pinto, Luciano da Silva; Dos Santos Júnior, Alceu Gonçalves; Andreotti, Renato

    2012-01-01

    The southern cattle fever tick, Rhipicephalus (Boophilus) microplus, is no doubt the most economically important ectoparasite of cattle globally. The inappropriate use of chemical acaricides has driven the evolution of resistance in populations of R. (B.) microplus. Anti-tick vaccines represent a technology that can be combined with acaricides in integrated control programs to mitigate the impact of R. (B.) microplus. The recombinant form of Bm86 antigen from the Campo Grande (rBm86-CG) strain of R. (B.) microplus was produced using the Pichiapastoris expression system to test its ability to immunoprotect cattle against tick infestation. Secretion of rBm86-CG by P. pastoris through the bioprocess reported here simplified purification of the antigen. A specific humoral immune response was detected by ELISA in vaccinated cattle. Immunoblot results revealed that polyclonal antibodies from vaccinated cattle recognized a protein in larval extracts with a molecular weight corresponding to Bm86. The rBm86-CG antigen showed 31% efficacy against the Campo Grande strain of R. (B.) microplus infesting vaccinated cattle. The rBm86-CG is an antigen that could be used in a polyvalent vaccine as part of an integrated program for the control of R. (B.) microplus in the region that includes Mato Grosso do Sul. PMID:23070436

  1. Esterase mediated resistance in deltamethrin resistant reference tick colony of Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Gupta, Snehil; Ajith Kumar, K G; Sharma, Anil Kumar; Nagar, Gaurav; Kumar, Sachin; Saravanan, B C; Ravikumar, Gandham; Ghosh, Srikant

    2016-06-01

    Monitoring of acaricide resistance is considered as one of the important facets of integrated tick management. In an attempt of development of resistance monitoring indicators, in the present study two reference tick lines of Rhipicephalus (Boophilus) microplus maintained in the Entomology laboratory, Indian Veterinary Research Institute (IVRI), Izatnagar, India, were studied to determine the possible contributing factors involved in development of resistance to deltamethrin. Electrophoretic profiling of esterase enzymes detected high activities of EST-1 in reference resistant tick colony designated as IVRI-IV whereas it was not detectable in reference susceptible IVRI-I line of R. (B.) microplus. Esterases were further characterized as carboxylesterase or acetylcholinesterase based on inhibitor study using PMSF, eserine sulphate, malathion, TPP and copper sulphate. It was concluded that an acetylcholinesterase, EST-1, possibly plays an important role for development of deltamethrin resistance in IVRI-IV colony of R. (B.) microplus. PMID:26979585

  2. Primer caso de resistencia al amitraz en la garrapata del ganado Boophilus microplus en México

    OpenAIRE

    Noé Soberanes Céspedes; Minerva Santamaría Vargas; Hugo Fragoso Sánchez; Zeferino García Vázquez

    2002-01-01

    El objetivo de este estudio fue documentar el primer caso de la resistencia de la garrapata B. microplus al Amitraz, en México. Se obtuvo una muestra de garrapatas B. microplus del municipio de Emiliano Zapata, Tabasco, con reportes de fallas de control con este acaricida. La cepa de garrapatas fue denominada “San Alfonso” y se utilizaron larvas (F1) provenientes de la generación parental de hembras repletas, éstas se probaron con dosis discriminate de Amitraz 0.0002 %, (Taktic®) en formulaci...

  3. Immunological control of ticks through vaccination with Boophilus microplus gut antigens.

    Science.gov (United States)

    De La Fuente, J; Rodríguez, M; García-García, J C

    2000-01-01

    The control of tick infestations and the transmission of tick-borne diseases remain a challenge for the scientific community. Traditional control methods have been only partially successful. Recently, vaccination with recombinant Boophilus microplus gut antigens has been shown to control tick infestations. Our Bm86-containing vaccine formulation (Gavac) has been effective for the control of artificial infestations of B. annulatus, B. decoloratus, and chemically sensitive and resistant B. microplus strains from Australia, Africa, America, and Iran. Preliminary results with Hyalomma spp. and Rhipicephalus spp. suggest partial cross protection. In field trials, vaccination with Gavac controlled B. microplus and B. annulatus infestations and reduced the transmission of babesiosis, resulting in important savings for the cattle industry. Different degrees of susceptibility to the vaccination with Bm86 and sequence variations in the Bm86 locus have been reported. The Bm95 antigen was isolated from the Argentinean Bm86-resistant B. microplus strain A. A Bm95-based vaccine was used to protect cattle against tick infestations under production conditions with similar results to that obtained with Gavac. The Bm95 antigen from strain A was able to protect against infestations with Bm86-sensitive and Bm86-resistant tick strains, thus suggesting that Bm95 could be a more universal antigen in protecting cattle against infestations by B. microplus strains from different geographical areas. These results clearly demonstrate the advantage and possibilities for the immunological control of ticks. PMID:11193686

  4. Susceptibility of Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae to seven ixodicides in Nuevo Leon, Mexico

    Directory of Open Access Journals (Sweden)

    Jesús A. Esparza Rentería

    2015-07-01

    Full Text Available This article reports the results of research only. Mention of a proprietary product does not constitute an endorsement or a recommendation by the FAUANL for its use Animal husbandry and meat industry in Mexico are one of the principal activities of the agricultural sector of the country, which are threatened by factors that affect the production of meat, skin and milk; among these, the damages caused by Boophilus microplus (Canestrini, the common tick of cattle, and the diseases it transmits, such as anaplasmosis and babesiosis (Xianxun and Wenshun, 1997; Yeruhan et al., 1998, are of special interest. The objective of this study was to determine the susceptibility of the larvae of Boophilus microplus to seven tick-killing agents commonly used in the state of Nuevo Leon. The methodology used for the diagnosis of the susceptibility of B. microplus tick to Organochlorine, Organophosphorate and Pyrethroid compounds was the one applied by Rodriguez-Vivas et al., (2007; in which it was used a discriminant dose (table 1, using the larvae package test technique (Stone & Haydock, 1962. The results of the CL50 to the ticks of cattle in the state of Nuevo Leon, Mexico showed a greater susceptibility to Deltamethrine, followed by Chlorfenvinphos; in third place Diazinon, then Flumethrin; after that Cypermethrin, in sixth place Lindane and a less toxicological action for the Coumaphos (Asuntol. The result was already expected due to the fact that it is the most commonly used product in the control of ticks through the larval immersion technique.

  5. Expression of recombinant Rhipicephalus (Boophilus) microplus, R. annulatus and R. decoloratus Bm86 orthologs as secreted proteins in Pichia pastoris

    OpenAIRE

    Jongejan Frans; Hope Michelle; Nijhof Ard M; Naranjo Victoria; de la Lastra José; Canales Mario; de la Fuente José

    2008-01-01

    Abstract Background Rhipicephalus (Boophilus) spp. ticks economically impact on cattle production in Africa and other tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The R. microplus Bm86 protective antigen has been produced by recombinant DNA technology and shown to protect cattle against tick infestations. Results In this study, the genes for Bm86 (R. microplus), Ba86 (R. annulatus) and Bd86 (...

  6. Partial sequencing of Bm86 gene for studying the phylogeny of an Indian isolate of Rhipicephalus(Boophilus) microplus tick

    OpenAIRE

    Anbarasi, P.; Latha, B. R.; Dhinakar Raj, G.; Sreekumar, C.; Senthuran, S.

    2013-01-01

    Tick gut glycoprotein, designated as Bm86, found on the luminal surface of the plasma membrane of gut epithelial cells of Boophilus microplus, which is a concealed antigen, has been used as vaccine candidate molecule for immunization against ticks. To better understand the molecular diversity of Bm86 gene in ticks, a portion of the cDNA was sequenced from an Indian isolate of B. microplus. Comparison of nucleotide sequence revealed that Indian isolate had 97 % homology (18 polymorphisms) with...

  7. Infectividad de Metarhizium anisopliae en contra de cepas de garrapata Boophilus microplus sensible y resistente a los organofosforados

    OpenAIRE

    Manuel Fernández-Ruvalcaba; Elyes Zhioua; Zeferino García-Vázquez

    2005-01-01

    La infectividad del hongo entomopatogénico Metarhizium anisopliae (Metschnikoff) fue probada en contra de una cepa de Boophilus microplus (Canestrini) sensible, y otra resistente a los organofosforados, por medio de un ensayo in vitro con hembras ingurgitadas de B. microplus recién desprendidas del bovino, utilizando la cepa ECS1 de M. anisopliae. El micromiceto M. anisopliae demostró ser altamente infectivo, tanto para la cepa sensible como para la resistente a los organofosforados a la conc...

  8. Immunization of cattle with synthetic peptides derived from the Boophilus microplus gut protein (Bm86).

    Science.gov (United States)

    Patarroyo, J H; Portela, R W; De Castro, R O; Pimentel, J Couto; Guzman, F; Patarroyo, M E; Vargas, M I; Prates, A A; Mendes, M A Dias

    2002-09-25

    Three synthetic peptides (SBm4912, SBm7462 and SBm19733), derived from the Bm86 glycoprotein from Boophilus microplus gut, were constructed and used to immunize cattle from a tick-free area. The immunized animals received three subcutaneous doses of the peptides, with saponin as adjuvant, at 30-day intervals. The immune response was evaluated by IgG elicited against the peptides by the detection of anti-Bm86 specific antibodies in situ and by Western blotting analysis. After tick challenge, reduction in the number, weight and oviposition capacity of engorged females was observed in the tick population that had fed on immunized animals. The results pointed a high efficacy (81.05%) for the SBm7462 synthetic peptide in relation to the others (p<0.01), demonstrating the efficiency of the immune response elicited by synthetic peptides to control the cattle tick B. microplus. PMID:12127414

  9. Global comparative analysis of ESTs from the southern cattle tick, Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Pertea Geo

    2007-10-01

    Full Text Available Abstract Background The southern cattle tick, Rhipicephalus (Boophilus microplus, is an economically important parasite of cattle and can transmit several pathogenic microorganisms to its cattle host during the feeding process. Understanding the biology and genomics of R. microplus is critical to developing novel methods for controlling these ticks. Results We present a global comparative genomic analysis of a gene index of R. microplus comprised of 13,643 unique transcripts assembled from 42,512 expressed sequence tags (ESTs, a significant fraction of the complement of R. microplus genes. The source material for these ESTs consisted of polyA RNA from various tissues, lifestages, and strains of R. microplus, including larvae exposed to heat, cold, host odor, and acaricide. Functional annotation using RPS-Blast analysis identified conserved protein domains in the conceptually translated gene index and assigned GO terms to those database transcripts which had informative BlastX hits. Blast Score Ratio and SimiTri analysis compared the conceptual transcriptome of the R. microplus database to other eukaryotic proteomes and EST databases, including those from 3 ticks. The most abundant protein domains in BmiGI were also analyzed by SimiTri methodology. Conclusion These results indicate that a large fraction of BmiGI entries have no homologs in other sequenced genomes. Analysis with the PartiGene annotation pipeline showed 64% of the members of BmiGI could not be assigned GO annotation, thus minimal information is available about a significant fraction of the tick genome. This highlights the important insights in tick biology which are likely to result from a tick genome sequencing project. Global comparative analysis identified some tick genes with unexpected phylogenetic relationships which detailed analysis attributed to gene losses in some members of the animal kingdom. Some tick genes were identified which had close orthologues to mammalian genes

  10. First Molecular Characterization of Anaplasma marginale in Cattle and Rhipicephalus (Boophilus) microplus Ticks in Cebu, Philippines

    OpenAIRE

    YBAÑEZ, Adrian Patalinghug; Sivakumar, Thillaiampalam; YBAÑEZ, Rochelle Haidee Daclan; RATILLA, Jowarren Catingan; PEREZ, Zandro Obligado; GABOTERO, Shirleny Reyes; Hakimi, Hassan; KAWAZU, Shin-Ichiro; MATSUMOTO, Kotaro; Yokoyama, Naoaki; INOKUMA, Hisashi; 河津, 信一郎; 松本, 高太郎; 横山, 直明; 猪熊,壽

    2013-01-01

    Anaplasma marginale has been detected in the Philippines only by peripheral blood smear examination and serological methods. This study generally aimed to molecularly detect and characterize A. marginale in cattle and ticks in Cebu, Philippines. A total of 12 bovine blood samples and 60 Rhipicephalus (Boophilus) microplus ticks were collected on the Cebu Island in 2011. 16S rRNA-based screening-PCR and DNA sequencing revealed 8 cattle (66.7%) and 8 ticks (13.3%) to be positive for A. marginal...

  11. Biochemical characterization of the recombinant Boophilus microplus Bm86 antigen expressed by transformed Pichia pastoris cells.

    Science.gov (United States)

    Montesino, R; Cremata, J; Rodríguez, M; Besada, V; Falcón, V; de la Fuente, J

    1996-02-01

    In the present paper we report the biochemical characteristics of the recombinant tick (Boophilus microplus) gut antigen Bm86 that previously has been cloned, expressed and recovered at high levels in the methylotrophic yeast Pichia pastoris. The results demonstrate that rBm86 had a modification at position 92 (Thr replaced by Ile) and aggregated, forming particles ranging between 17 and 40 nm. The rBm86 was N-glycosylated, having at least two non-glycosylated sequons (Asn-329 and Asn-363) and a ratio of only 0.4/65 (free Cys/total Cys)/mol of protein. PMID:8867893

  12. [Evaluation of the biological control potential of Metarhizium anisopliae toward Boophilus microplus in pen trials].

    Science.gov (United States)

    Bahiense, Thiago C; Fernandes, Everton K K; Angelo, Isabele da C; Perinotto, Wendell M de S; Bittencourt, Vãnia R E P

    2007-01-01

    The aim of the present study was to evaluate the capacity of the fungus Metarhizium anisopliae to control Boophilus microplus tick in pen trials. Infested calves were held in individual pen and treated with fungus suspension through aspersion bath. The results were evaluated based on ticks' mortality rate for 28 days after treatment, and on the analysis of biology of tick's samples which were transferred to an incubation chamber. It was reported 33% of mortality during the total period analyzed, and the production of eggs and nutritional rates were decreased only for a short period after treatment. PMID:18373901

  13. AVALIAÇÃO IN VITRO DE FITOTERÁPICOS NO CONTROLE DE RHIPICEPHALUS BOOPHILUS MICROPLUS

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Nicolino

    2013-06-01

    Full Text Available The use of herbal medicines is considered an important alternative to control pests, and can reduce economic and environmental impacts the use of synthetic pesticides. The present study aimed at comparing the in vitro action of essential oils against engorged females of Rhipicephalus (Boophilus microplus. Essential oil was used Azadiracta indica (Neem, Cymbopogom nardus L. Rendle (Citronella and Cymbopogon citratus (lemon-grass in the following concentrations: 12.5%, 6%, 3% and 1%. Maximum efficiency (100% was observed for all plants at concentrations of 12.5%. At the concentration of 6% only the essential oils of neem and citronella apresntaram 100% efficiency. Citronella still showed maximum efficiency at a concentration of 3% and still got 95.30% in the lowest concentration (1%. It is concluded that the use of essential oils can be an important alternative in the control of Rhipicephalus (Boophilus microplus.O uso de fitoterápicos é considerado uma alternativa importante no controle de parasitas, e podem reduzir impactos econômicos e ambientais ao uso de pesticidas sintéticos. O presente estudo teve por objetivo avaliar comparativamente a ação in vitro de óleos essenciais contra fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus. Foi utilizado óleo essencial de Azadiracta indica (Neem, Cymbopogom nardus L. Rendle (Citronela e Cymbopogon citratus (Capim-cidreira nas seguintes concentrações: 12,5%, 6%, 3% e 1%. Eficácia máxima (100% foi observada por todas as plantas nas concentrações de 12,5%. Na concentração de 6% somente os óleos essenciais de neem e citronela apresentaram eficácia de 100%. A citronela ainda apresentou eficácia máxima na concentração de 3% e ainda obteve 95,30% na menor concentração (1%. Conclui-se que a utilização de óleos essenciais pode ser uma alternativa importante no controle de Rhipicephalus (Boophilus microplus.

  14. Emergence of oriental theileriosis in cattle and its transmission through Rhipicephalus (Boophilus microplus in Assam, India

    Directory of Open Access Journals (Sweden)

    Parikshit Kakati

    2015-09-01

    Full Text Available Aim: The aim of the present study was to investigate the presence of Theileria in blood samples of crossbred and indigenous adult cows raised under unorganized small scale farming system in a Babesia and Anaplasma endemic geographical area from Assam, India and to see its transmission through Rhipicephalus (Boophilus microplus ticks. Materials and Methods: For the present study, 57 clinical cases of cattle suspected to be of hemoparasitic infections were taken into consideration. The parasites were identified based on morphology in giemsa stained blood smear followed by polymerase chain reaction (PCR. Sera samples were tested for T. annulata antibodies in plate and Dot-ELISA. PCR was also conducted in eggs of Rhipicephalus (Boophilus microplus tick collected from a Theileria orientalis positive animal. Results: PCR amplified 1124, 776, and 160 bp DNA fragments of B. bigemina (64.91%,T. orientalis(21.05% and A. marginale (14.03%, respectively. This assay further conducted in 12 T. orientalis positive blood samples with primers of Buffeli, Chitose, and Ikeda variants of T. orientalis showed 3 samples positive to Ikeda type and none for Buffeli and Chitose. Babesia bovis and Theileria annulata specific primers also did not amplify any fragment during the PCR assay of the blood samples. Further, all sera samples tested negative to T. annulata antibodies in Plate and Dot-ELISA. PCR conducted in eggs of R (B.microplus tick collected from a T. orientalis positive animal revealed presence of the parasite DNA. Gradual improvement in physical condition leading to complete recovery in 10 out of 12 T. orientalis infected clinical cases treated with buparvaquone(at 2.5mg/kg.b.wt I/M was the feedback obtained from field veterinarians and the cattle owners. Conclusion: The present investigation represents the first report of occurrence of T. orientalis in cattle of Assam with involvement of pathogenic Ikeda strain in clinical outbreaks and its possible natural

  15. In vitro activity of Artemisia annua L (Asteraceae extracts against Rhipicephalus (Boophilus microplus Atividade in vitro de extratos de Artemisia annua L (Asteraceae sobre Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Ana Carolina de Souza Chagas

    2011-03-01

    Full Text Available The activity of plant extracts on parasites may indicate groups of substances that are potentially useful for controlling Rhipicephalus (Boophilus microplus. The aim of the present study was to investigate the in vitro action of Artemisia annua extracts on this tick. The concentrations of the sesquiterpene lactones artemisinin and deoxyartemisinin present in plant extracts were quantified via high-performance liquid chromatography. Four extracts produced from the concentrated crude extract (CCE were evaluated on larvae using the impregnated paper method, with readings after 24 hours of incubation. The engorged females were immersed in the CCE and in its four derived extracts for five minutes, with incubation for subsequent analysis of biological parameters. The extracts were not effective on the larvae at the concentrations tested (3.1 to 50 mg.mL-1. The CCE showed greater efficacy on engorged females (EC50 of 130.6 mg.mL-1 and EC90 of 302.9 mg.mL-1 than did the derived extracts. These results tend to confirm that the action of artemisinin on engorged females of R.(B. microplus is conditional to their blood intake. In this case, in vitro methods would be inadequate for effective evaluation of the action of A. annua on R. (B. microplus.A atividade de extratos vegetais sobre parasitas pode indicar grupos de substâncias de uso potencial no controle de Rhipicephalus (Boophilus microplus. O objetivo do presente estudo foi investigar a ação in vitro de extratos de Artemisia annua sobre esta espécie. A concentração das lactonas sesquiterpênicas artemisinina e deoxiartemisinina presentes nos extratos vegetais, foi quantificada via cromatografia líquida de alta eficiência. Quatro extratos produzidos a partir do extrato bruto concentrado (EBC foram avaliados sobre larvas pela metodologia do papel impregnado, com leitura após 24 horas de incubação. As fêmeas ingurgitadas foram imersas por cinco minutos no EBC e nos seus quatro extratos

  16. Differential protein expression in ovaries of uninfected and Babesia-infected southern cattle ticks, Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    We used gel electrophoresis and mass spectrometry to investigate differences in protein expression in ovarian tissues from Babesia bovis-infected and uninfected southern cattle tick, Rhipicephalus (Boophilus) microplus. Soluble and membrane proteins were extracted from ovaries of adult female ticks,...

  17. Assessment of bacterial diversity in the cattle tick Rhipicephalus (Boophilus microplus through tag-encoded pyrosequencing

    Directory of Open Access Journals (Sweden)

    Bendele Kylie G

    2011-01-01

    Full Text Available Abstract Background Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The cattle tick, Rhipicephalus (Boophilus microplus, hinders livestock production in tropical and subtropical parts of the world where it is endemic. Tick microbiomes remain largely unexplored. The objective of this study was to explore the R. microplus microbiome by applying the bacterial 16S tag-encoded FLX-titanium amplicon pyrosequencing (bTEFAP technique to characterize its bacterial diversity. Pyrosequencing was performed on adult males and females, eggs, and gut and ovary tissues from adult females derived from samples of R. microplus collected during outbreaks in southern Texas. Results Raw data from bTEFAP were screened and trimmed based upon quality scores and binned into individual sample collections. Bacteria identified to the species level include Staphylococcus aureus, Staphylococcus chromogenes, Streptococcus dysgalactiae, Staphylococcus sciuri, Serratia marcescens, Corynebacterium glutamicum, and Finegoldia magna. One hundred twenty-one bacterial genera were detected in all the life stages and tissues sampled. The total number of genera identified by tick sample comprised: 53 in adult males, 61 in adult females, 11 in gut tissue, 7 in ovarian tissue, and 54 in the eggs. Notable genera detected in the cattle tick include Wolbachia, Coxiella, and Borrelia. The molecular approach applied in this study allowed us to assess the relative abundance of the microbiota associated with R. microplus. Conclusions This report represents the first survey of the bacteriome in the cattle tick using non-culture based molecular approaches. Comparisons of our results with previous bacterial surveys provide an indication of geographic variation in the assemblages of bacteria associated with R. microplus. Additional reports on the identification of new bacterial species maintained in nature by R. microplus that may be

  18. Allopatric speciation in ticks: genetic and reproductive divergence between geographic strains of Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Jongejan Frans

    2009-02-01

    Full Text Available Abstract Background The cattle tick, Rhipicephalus (Boophilus microplus, economically impact cattle industry in tropical and subtropical regions of the world. The morphological and genetic differences among R. microplus strains have been documented in the literature, suggesting that biogeographical and ecological separation may have resulted in boophilid ticks from America/Africa and those from Australia being different species. To test the hypothesis of the presence of different boophilid species, herein we performed a series of experiments to characterize the reproductive performance of crosses between R. microplus from Australia, Africa and America and the genetic diversity of strains from Australia, Asia, Africa and America. Results The results showed that the crosses between Australian and Argentinean or Mozambican strains of boophilid ticks are infertile while crosses between Argentinean and Mozambican strains are fertile. These results showed that tick strains from Africa (Mozambique and America (Argentina are the same species, while ticks from Australia may actually represent a separate species. The genetic analysis of mitochondrial 12S and 16S rDNA and microsatellite loci were not conclusive when taken separately, but provided evidence that Australian tick strains were genetically different from Asian, African and American strains. Conclusion The results reported herein support the hypothesis that at least two different species share the name R. microplus. These species could be redefined as R. microplus (Canestrini, 1887 (for American and African strains and probably the old R. australis Fuller, 1899 (for Australian strains, which needs to be redescribed. However, experiments with a larger number of tick strains from different geographic locations are needed to corroborate these results.

  19. Identification of a synthetic peptide inducing cross-reactive antibodies binding to Rhipicephalus (Boophilus) decoloratus, Rhipicephalus (Boophilus) microplus, Hyalomma anatolicum anatolicum and Rhipicephalus appendiculatus BM86 homologues.

    Science.gov (United States)

    Kopp, Nadja; Diaz, Diana; Amacker, Mario; Odongo, David O; Beier, Konstantin; Nitsch, Cordula; Bishop, Richard P; Daubenberger, Claudia A

    2009-12-10

    The BM86 antigen, originally identified in Rhipicephalus (Boophilus) microplus, is the basis of the only commercialized anti-tick vaccine. The long-term goal of our study is to improve BM86 based vaccines by induction of high levels of tick gut binding antibodies that are also cross-reactive with a range of BM86 homologues expressed in other important tick species. Here we have used a BD86 derived synthetic peptide, BD86-3, to raise a series of mouse monoclonal antibodies. One of these mAbs, named 12.1, recognized BM86 homologues in immuno-histochemical analyses in four out of five tick species including R. (B.) microplus, Rhipicephalus (Boophilus) decoloratus, Hyalomma anatolicum anatolicum and Rhipicephalus appendiculatus. Our results indicate that broadly cross-reactive tick gut binding antibodies can be induced after immunization with a synthetic peptide derived from the protein BD86. PMID:19808026

  20. Control of Boophilus microplus populations in grazing cattle vaccinated with a recombinant Bm86 antigen preparation.

    Science.gov (United States)

    Rodríguez, M; Penichet, M L; Mouris, A E; Labarta, V; Luaces, L L; Rubiera, R; Cordovés, C; Sánchez, P A; Ramos, E; Soto, A

    1995-04-01

    Current methods for the control of cattle tick Boophilus microplus infestations are not effective and the parasite remains a serious problem for the cattle industry in tropical and subtropical areas. Recently, we developed a vaccine against B. microplus employing a recombinant Bm86 (rBm86) antigen preparation (Gavac, Heber Biotec) and it was shown to induce a protective response in vaccinated animals under controlled conditions. Here we show that, under field conditions in grazing cattle, the vaccine is able to control B. microplus populations. Two parasite-free farms were employed for the study. In the first farm, animals were vaccinated with the recombinant vaccine, while, in the second, animals received a saline injection in adjuvant. After immunization, animals were artificially infected and the infestation rate was recorded. Over the 33 weeks of the experiment, the infestation rate was lower in the vaccinated group compared with the control group. At the end of the experiment it was necessary to use chemicals in the control farm after serious losses in production and animals. PMID:7660571

  1. Resistance to cypermethrin and amitraz in Rhipicephalus (Boophilus) microplus on the Santa Catarina Plateau, Brazil.

    Science.gov (United States)

    Veiga, Luana Paula Haubold Neis; Souza, Antonio Pereira de; Bellato, Valdomiro; Sartor, Amélia Aparecida; Nunes, Ana Paula de Oliveira; Cardoso, Helena Mondardo

    2012-01-01

    With the objective of evaluating Rhipicephalus (Boophilus) microplus resistance to cipermetrina and amitraz, were collected engorged tick females from cattle on 20 farms on the Santa Catarina Plateau, in southern Brazil, between January of 2004 and May of 2006. Were also received 20 groups of engorged R. (B.) microplus females, collected by cattle farmers requesting acaricidal efficacy (AE) testing. Were performed in vitro tests, which consisted of immersing engorged females in cypermethrin (0.015%) and in amitraz (0.025%). An AE >95% was considered indicative of effectiveness. Of the 20 collected groups, 18 (90%) showed cypermethrin resistance and 1 (5%) showed amitraz resistance. Of the 20 received groups, 19 (95%) showed cypermethrin resistance and 2 (10%) showed amitraz resistance. The AE of cypermethrin was found to be >95%, 85-94%, and 55-64%, respectively, in 4 (57.1%), 2 (28.6%), and 1 (14.3%) of 7 reference groups, collected in the 1997-2001 period. The AE of amitraz was >95% in all of those groups. Among the groups of specimens received for analysis in that period, the AE of amitraz was >95% in 6 (85.71%) and 75-84% in 1 (14.28%). R. (B.) microplus resistance to acaricides is increasing on the Santa Catarina Plateau. PMID:22832753

  2. Distribution Patterns of Three Sodium Channel Mutations Associated with Pyrethroid Resistance in Rhipicephalus (Boophilus) Microplus Populations from North and South America, South Africa and Australia

    Science.gov (United States)

    Resistance to synthetic pyrethroids (SP) in the cattle tick Rhipicephalus (Boophilus) microplus is widespread throughout its distribution area. Three single nucleotide substitutions identified in the Domains II and III of the sodium channel gene of R. (B.) microplus are known to be associated with t...

  3. The Rhipicephalus (Boophilus) microplus Bm86 gene plays a critical role in the fitness of ticks fed on cattle during acute Babesia bovis infection

    Science.gov (United States)

    Background: Rhipicephalus (Boophilus) microplus is an economically important tick of cattle involved in the transmission of Babesia bovis, the etiological agent of bovine babesiosis. Commercial anti-tick vaccines based on the R. microplus Bm86 glycoprotein have shown some effect in controlling tick ...

  4. Protection against Boophilus annulatus infestations in cattle vaccinated with the B. microplus Bm86-containing vaccine Gavac. off.

    Science.gov (United States)

    Fragoso, H; Rad, P H; Ortiz, M; Rodríguez, M; Redondo, M; Herrera, L; de la Fuente, J

    1998-12-01

    Tick infestations by Boophilus spp. constitute a major problem for the cattle industry in tropical and subtropical areas of the world. The use of traditional control methods has been only partially successful and tick infestations remain a serious problem. Recently, the gut antigen Bm86 was isolated from B. microplus. Recombinant preparations of this antigen have been used in vaccines for the control of B. microplus infestations. However, in several regions of the world, B. microplus coexists with other Boophilus species, mainly B. annulatus and B. decoloratus. Therefore, there is a need for the simultaneous control of infestations by different Boophilus species. To test the capacity of the P. pastoris-derived Bm86 antigen preparation (Gavac, Heber Biotec S.A., Havana) to control B. annulatus infestations, controlled experiments were conducted in Mexico and Iran. Cattle were vaccinated with Gavac or not vaccinated and then artificially infested with B. annulatus larvae. The results showed for the first time a high protection efficacy (> 99.9%) of Gavac in the control of B. annulatus infestations. These results support the application of Bm86-containing vaccines for the control of Boophilus spp. infestations. PMID:9796055

  5. Resistencia a los acaricidas en Rhipicephalus (Boophilus) microplus: situación actual y mecanismos de resistencia

    OpenAIRE

    Roger Iván Rodríguez-Vivas; Hodgkinson, Jane E; Trees, Alexander J.

    2012-01-01

    Rhipicephalus (Boophilus) microplus es una plaga endémica de ganado en las regiones tropicales y subtropicales del mundo, causando grandes pérdidas económicas a los productores de ganado. Acaricidas químicos han desempeñado un papel fundamental en el control de R. (B). microplus; sin embargo, como consecuencia de su uso extensivo, esta especie ha desarrollado resistencia a todas las clases principales de acaricidas en todo el mundo. Resistencia a organofosforados, piretroides sintéticos y ami...

  6. Rhipicephalus (Boophilus) microplus: expression and characterization of Bm86-CG in Pichia pastoris Rhipicephalus (Boophilus) microplus: expressão e caracterização da Bm86-CG em Pichia pastoris

    OpenAIRE

    Rodrigo Casquero Cunha; Renato Andreotti; Fábio Pereira Leivas Leite

    2011-01-01

    The cattle tick Rhipicephalus (Boophilus) microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (GavacTM and TickGardPLUS) that have been developed against cattle ticks. The ...

  7. The male genital accessory gland complex of the cattle tick Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    GARCIA-FERNANDEZ CASIMIRO

    1998-01-01

    Full Text Available A topographical and histological study of the male genital accessory gland complex of Boophilus microplus was undertaken. Ten lobes were found, the most prominent of which is the single dorso-median lobe, subdivided into antero-dorsal and postero-dorsal lobes. The other lobes are: a pair of postero-ventral lobes, a pair of lateral lobes (subdivided into dorso-lateral and postero-lateral lobes, a pair of antero-ventral lobes, a single medio-ventral lobe and a pair of latero-ventral lobes. These lobes were observed to present individual topographical and histological characteristics, with independent openings, hence the conclusion is that they form a gland complex. The secretory nature of the dorso-median lobe duct was also analysed.

  8. Alterations in the oxidative metabolism of Rhipicephalus (Boophilus) microplus ticks in response to exposure to the insect growth regulator fluazuron

    OpenAIRE

    Fabrício Nascimento Gaudêncio; Vinícius Menezes Tunholi-Alves; Mariana Gomes Lima; Patrícia Silva Gôlo; Isabele da Costa Angelo; Rosane Nora Castro; Adivaldo Henrique da Fonseca; Fabio Barbour Scott; Jairo Pinheiro

    2016-01-01

    Abstract Aiming to characterize the potential off-target effects of fluazuron on ticks, biochemical analyses were conducted to evaluate changes in the carbohydrate metabolism of Rhipicephalus (Boophilus) microplus ticks after exposure to fluazuron. Hemolymph and fat body were collected from female ticks before and after (4, 8 and 15 days) exposure to fluazuron. Spectrophotometric analyses were done to quantify glucose concentration and lactate dehydrogenase (LDH) activity in the hemolymph and...

  9. Vaccination with recombinant Boophilus annulatus Bm86 ortholog protein, Ba86, protects cattle against B. annulatus and B. microplus infestations

    OpenAIRE

    Jongejan Frans; Naranjo Victoria; Almazán Consuelo; Canales Mario; de la Fuente José

    2009-01-01

    Abstract Background The cattle ticks, Boophilus spp., affect cattle production in tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The recombinant B. microplus Bm86 protective antigen has been shown to protect cattle against tick infestations. Recently, the gene coding for B. annulatus Bm86 ortholog, Ba86, was cloned and the recombinant protein was secreted and purified from the yeast Pichia past...

  10. Identification and characterization of Rhipicephalus (Boophilus) microplus candidate protective antigens for the control of cattle tick infestations

    OpenAIRE

    Almazan, C.; Lagunes, R.; Villar, M.; Canales, M.; R Rosario-Cruz; Jongejan, F; de la Fuente, J.

    2009-01-01

    The cattle ticks, Rhipicephalus (Boophilus) spp., affect cattle production in tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The recombinant Rhipicephalus microplus Bm86 antigen has been shown to protect cattle against tick infestations. However, variable efficacy of Bm86-based vaccines against geographic tick strains has encouraged the research for additional tick-protective antigens. Herein, ...

  11. Binding and storage of heme by vitellin from the cattle tick, Boophilus microplus.

    Science.gov (United States)

    Logullo, C; Moraes, J; Dansa-Petretski, M; Vaz, I S; Masuda, A; Sorgine, M H F; Braz, G R; Masuda, H; Oliveira, P L

    2002-12-01

    We have previously shown (, Curr. Biol. 9, 703-706) that the cattle tick Boophilus microplus does not synthesize heme, relying solely on the recovery of the heme from the diet to make all its hemeproteins. Here we present evidence that Vitellin (VN(1)), the main tick yolk protein, is a reservoir of heme for embryo development. VN was isolated from eggs at different days throughout embryogenesis. Immediately after oviposition, Boophilus VN contains approximately one mol of heme/mol of protein. During embryo development about one third of egg VN is degraded. The remaining VN molecules bind part of the heme released. These results suggest that VN functions as a heme reservoir, binding any free heme that exceeds the amount needed for development. In vitro measurement of the binding of heme to VN showed that each VN molecule binds up to 31 heme molecules. The association of heme with VN strongly inhibits heme-induced lipid peroxidation, suggesting that binding of heme is an important antioxidant mechanism to protect embryo cells from oxidative damage. This mechanism allows this hematophagous arthropod to safely store heme obtained from a blood meal inside their eggs for future use. Taken together our data suggest that, besides its known roles, VN also plays additional functions as a heme deposit and an antioxidant protective molecule. PMID:12429132

  12. The complexity of Rhipicephalus (Boophilus microplus genome characterised through detailed analysis of two BAC clones

    Directory of Open Access Journals (Sweden)

    Valle Manuel

    2011-07-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus (Rmi a major cattle ectoparasite and tick borne disease vector, impacts on animal welfare and industry productivity. In arthropod research there is an absence of a complete Chelicerate genome, which includes ticks, mites, spiders, scorpions and crustaceans. Model arthropod genomes such as Drosophila and Anopheles are too taxonomically distant for a reference in tick genomic sequence analysis. This study focuses on the de-novo assembly of two R. microplus BAC sequences from the understudied R microplus genome. Based on available R. microplus sequenced resources and comparative analysis, tick genomic structure and functional predictions identify complex gene structures and genomic targets expressed during tick-cattle interaction. Results In our BAC analyses we have assembled, using the correct positioning of BAC end sequences and transcript sequences, two challenging genomic regions. Cot DNA fractions compared to the BAC sequences confirmed a highly repetitive BAC sequence BM-012-E08 and a low repetitive BAC sequence BM-005-G14 which was gene rich and contained short interspersed elements (SINEs. Based directly on the BAC and Cot data comparisons, the genome wide frequency of the SINE Ruka element was estimated. Using a conservative approach to the assembly of the highly repetitive BM-012-E08, the sequence was de-convoluted into three repeat units, each unit containing an 18S, 5.8S and 28S ribosomal RNA (rRNA encoding gene sequence (rDNA, related internal transcribed spacer and complex intergenic region. In the low repetitive BM-005-G14, a novel gene complex was found between to 2 genes on the same strand. Nested in the second intron of a large 9 Kb papilin gene was a helicase gene. This helicase overlapped in two exonic regions with the papilin. Both these genes were shown expressed in different tick life stage important in ectoparasite interaction with the host. Tick specific sequence

  13. Acaricidal activity of Amburana cearensis on the cattle tick Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Anne Caroline dos Santos Dantas

    2015-01-01

    Full Text Available ABSTRACT: This experiment was carried out to study the bioacaricidal activity of Amburana cearensis against engorged females of Rhipicephalus ( Boophilus microplus . The crude ethanolic extract from the leaves of A. cearensis was submitted to partition with organic solvents (hexane, chloroform and ethyl acetate in order of increasing polarity; and evaluated using three treatments at concentrations of 5, 10 and 25mg ml-1. To evaluate the acaricidal activity, engorged females were submitted to the adult immersion test. Parameters analyzed were the weight of females; weight of egg mass; percentage of hatch; reproductive efficiency; expected rate of reproduction; and efficacy. For each extract and concentrating fraction, tests were performed in triplicate. Among all fractions, the hexane (2.5% achieved the best results in all parameters analyzed: 52.7% of inhibition of oviposition; 39% of hatching rate; 3,271 index of reproductive efficiency; and 67.0% effectiveness. The extract obtained gradual dose response with increasing concentration; and could be used as an aid in the control of R. ( B. microplus therapy.

  14. Fenvalerate resistance status in Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) from Punjab, India.

    Science.gov (United States)

    Jyoti; Nandi, Abhijit; Singh, Harkirat; Singh, N K; Rath, S S

    2016-09-01

    Larval packet test was used for evaluating the resistance levels in Rhipicephalus (Boophilus) microplus collected from different districts of central plain zone of Punjab state, India against fenvalerate. The regression graphs of probit mortality of larvae plotted against log values of progressively increasing concentrations of fenvalerate were utilized for the estimation of lethal concentration for 50 % (LC50) and 95 % (LC95) values against various field isolates of R. (B.) microplus. The slope of mortality (95 % confidence levels) varied from 0.730 ± 0.097 (0.419-1.043) to 1.455 ± 0.281 (0.558-2.352) and the value of R(2) varied from 0.881 to 0.997. From the regression equation the values of LC50 and LC95 were recorded in range of 184.39-1,338.01 and 3,253.33-112,706.26 ppm, respectively. Among the various tick isolates resistance factors in range of 1.56-54.34 were determined and all field isolates studied were found resistant against fenvalerate. Two field isolates (Jalandhar and Ludhiana) showed level I resistance; three (Patiala, Fatehgarh Sahib and Amritsar) showed level II and Kapurthala isolate showed level IV resistance. The data generated on fenvalerate resistant status will help in judicious use of the drug and formulation of effective tick control strategy for the region. PMID:27605769

  15. [Prokaryotic expression of Bm86 gene of Boophilus microplus and optimization of the expression condition].

    Science.gov (United States)

    Ma, Mi-Ling; Guan, Gui-Quan; Li, You-Quan; Liu, Ai-Hong; Ren, Qiao-Yun; Niu, Qing-Li; Yin, Hong; Luo, Jian-Xun

    2009-12-01

    A pair of specific primers was designed based on the reported Bm86 gene of Boophilus microplus,the Bm86 gene was cloned by PCR using the plasmid pMD18-T-Bm86 as templates, and subcloned into the prokaryotic plasmid pGEX-4T-1. The recombined plasmid was transformed into E. coli BL21(DE3) and followed by expression of the protein induced by different concentration of IPTG for different time. SDS-PAGE showed that the recombinant plasmid pGEX-4T-1/Bm86 expressed a fusion protein Bm86-GST (Mr 94 000) after being induced with IPTG. High level expression of Bm86-GST was found at 1 mmol/L IPTG condition a fter incubation for 8 h at 37 degree C, and the expression level of the recombinant Bm86-GST reached up to 29% of total E coli proteins Western-blotting analysis showed that the recombinant Bm86-GST was recognized by the rabbit anti-B. microplus positive serum. PMID:20232640

  16. In vitro effects of Pilocarpus microphyllus extracts and pilocarpine hydrochloride on Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Castro, Karina Neoob de Carvalho; Lima, David Fernandes; Wolschick, Dolores; Andrade, Ivanilza Moreira de; Santos, Raimunda Cardoso Dos; Santos, Francisco José de Seixas Dos; Veras, Leiz Maria Costa; Costa-Júnior, Lívio Martins

    2016-06-01

    The aim of this study was to assess the activity of aqueous (AE) and ethanolic extracts (EE) and pilocarpine hydrochloride, which were extracted and isolated from Pilocarpus microphyllus (Jaborandi), respectively, on Rhipicephalus (Boophilus) microplus. High performance liquid chromatography (HPLC) was performed to quantify these compounds. Larval packet and adult immersion tests were conducted with different concentrations. Five AE and EE concentrations, ranging from 6.2 to 100.0 mg mL-1, and six concentrations of pilocarpine hydrochloride, ranging from 0.7 to 24.0 mg mL-1, were tested. The lethal concentration (LC50) of each extract for larvae and engorged females was calculated through Probit analysis. The concentration of pilocarpine hydrochloride obtained from the EE and the AE was 1.3 and 0.3% (m/m), respectively. Pilocarpine hydrochloride presented the highest acaricidal activity on larvae (LC50 2.6 mg mL-1) and engorged females (LC50 11.8 mg mL-1) of R.(B.) microplus, followed by the EE which presented LC50 of 56.4 and 15.9 mg mL-1, for larvae and engorged females, respectively. Such results indicate that pilocarpine hydrochloride has acaricidal activity, and may be the primary compound responsible for this activity by P. microphyllus EE. PMID:27334829

  17. In vitro effects of Pilocarpus microphyllus extracts and pilocarpine hydrochloride on Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Karina Neoob de Carvalho Castro

    2016-01-01

    Full Text Available Abstract The aim of this study was to assess the activity of aqueous (AE and ethanolic extracts (EE and pilocarpine hydrochloride, which were extracted and isolated from Pilocarpus microphyllus (Jaborandi, respectively, on Rhipicephalus (Boophilus microplus. High performance liquid chromatography (HPLC was performed to quantify these compounds. Larval packet and adult immersion tests were conducted with different concentrations. Five AE and EE concentrations, ranging from 6.2 to 100.0 mg mL–1, and six concentrations of pilocarpine hydrochloride, ranging from 0.7 to 24.0 mg mL–1, were tested. The lethal concentration (LC50 of each extract for larvae and engorged females was calculated through Probit analysis. The concentration of pilocarpine hydrochloride obtained from the EE and the AE was 1.3 and 0.3% (m/m, respectively. Pilocarpine hydrochloride presented the highest acaricidal activity on larvae (LC50 2.6 mg mL–1 and engorged females (LC50 11.8 mg mL–1 of R.(B. microplus, followed by the EE which presented LC50 of 56.4 and 15.9 mg mL–1, for larvae and engorged females, respectively. Such results indicate that pilocarpine hydrochloride has acaricidal activity, and may be the primary compound responsible for this activity by P. microphyllus EE.

  18. Controle de larvas de Boophilus microplus por Metarhizium anisopliae em pastagens infestadas artificialmente Control of Boophilus microplus larvae by Metarhizium anisopliae in artificially infested pastures

    Directory of Open Access Journals (Sweden)

    Lúcia Mara de Souza Basso

    2005-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência do controle exercido por Metarhizium anisopliae na população de Boophilus microplus, em pastagens de Brachiaria brizantha, e do híbrido Tifton 85 (Cynodon spp., artificialmente infestadas com fêmeas ingurgitadas do carrapato. Trinta canteiros com 1 m² de área cada foram distribuídos aleatoriamente. Quinze foram pulverizados com esporos do fungo e quinze controles em cada forrageira, constituindo cinco repetições de cada tratamento, foram infestados com número e peso padronizados de fêmeas ingurgitadas do ácaro. Aplicou-se o fungo, na concentração de 1,8x10(8 conídios mL-1, em três situações: pulverização antes da infestação com o carrapato, após a infestação e posterioriormente à emergência das primeiras larvas nos capins. A ação do fungo foi avaliada no 35º, 38º, 41º, 48º, 55º e 61º dia pós-infestação, por meio da contagem de larvas recuperadas. Obteve-se controle de larvas do ácaro, que, nas avaliações realizadas entre o 35º e o 48º dia pós-infestação, variou entre 87% e 94%. As médias das contagens de estágios larvares do carrapato foram menores em todas as amostragens realizadas no capim-Tifton 85, indicando que houve efeito da pastagem na ação do fungo. A situação de aplicação influencia a atividade do fungo, com melhor resultado nas coletas realizadas entre o 41º e 55º dia após infestação em B. brizantha, e aplicação dos conídios logo após a emergência das primeiras larvas.The objective of this work was to evaluate the efficiency of Metarhizium anisopliae fungus against Boophilus microplus population in Brachiaria brizantha and Tifton 85 (Cynodon pastures, artificially infested with tick engorged females. Thirty plots of 1 m² each were randomly distributed in fifteen treated and fifteen control groups per type of grass, establishing five repetitions for each treatment. Pastures were infested with engorged tick females

  19. Vaccination with recombinant Boophilus annulatus Bm86 ortholog protein, Ba86, protects cattle against B. annulatus and B. microplus infestations

    Directory of Open Access Journals (Sweden)

    Jongejan Frans

    2009-03-01

    Full Text Available Abstract Background The cattle ticks, Boophilus spp., affect cattle production in tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The recombinant B. microplus Bm86 protective antigen has been shown to protect cattle against tick infestations. Recently, the gene coding for B. annulatus Bm86 ortholog, Ba86, was cloned and the recombinant protein was secreted and purified from the yeast Pichia pastoris. Results Recombinant Ba86 (Israel strain was used to immunize cattle to test its efficacy for the control of B. annulatus (Mercedes, Texas, USA strain and B. microplus (Susceptible, Mexico strain infestations. Bm86 (Gavac and Mozambique strain and adjuvant/saline were used as positive and negative controls, respectively. Vaccination with Ba86 reduced tick infestations (71% and 40%, weight (8% and 15%, oviposition (22% and 5% and egg fertility (25% and 50% for B. annulatus and B. microplus, respectively. The efficacy of both Ba86 and Bm86 was higher for B. annulatus than for B. microplus. The efficacy of Ba86 was higher for B. annulatus (83.0% than for B. microplus (71.5%. The efficacy of Bm86 (Gavac; 85.2% but not Bm86 (Mozambique strain; 70.4% was higher than that of Ba86 (71.5% on B. microplus. However, the efficacy of Bm86 (both Gavac and Mozambique strain; 99.6% was higher than that of Ba86 (83.0% on B. annulatus. Conclusion These experiments showed the efficacy of recombinant Ba86 for the control of B. annulatus and B. microplus infestations in cattle and suggested that physiological differences between B. microplus and B. annulatus and those encoded in the sequence of Bm86 orthologs may be responsible for the differences in susceptibility of these tick species to Bm86 vaccines.

  20. Borrelia theileri: observação em carrapatos do gênero Boophilus microplus no município de Guaíba, RS, Brasil Borrelia theileri: observation on Boophilus microplus ticks in Guaiba, RS, Brazil

    Directory of Open Access Journals (Sweden)

    João Ricardo Martins

    1996-12-01

    Full Text Available Espiroquetas da espécie Borrelia theileri identificadas em uma estirpe de carrapatos Boophilus microplus provenientes do município de Guaíba, RS. A observação ocorreu no exame de hemolinfa de fêmeas adultas com 10 dias pós-repleçâo, corada por Giemsa. Não foram observadas espiroquetas em ovos provenientes de teleóginas infectadas. A detecção da estirpe infectada sugere a presença de borreliose em rebanhos bovinos, fato que eventualmente pode interferir em resultados de diagnóstico ou tornar-se motivo de preocupação em produtos derivados de sangue bovino tais como vacinas vivas contra anaplasmose e babesiose bovina.Spirochetes of species Borrelia theileri were identifica in afield-strain of the caule tick Boophilus microplus, in Guaíba, RS, Brazil. Hemolymph smears from females 10 days post-repletion were collected by gentty section of the tarsal-metatarsaijoint, and dropped onto a microscope slide, and stained by Giemsa. No spirochetes were observed in eggs squashed and stained by Giemsa from the same infected strain. The detection of B. microplus adult females infected with Borrelia theileri suggesfs the likely presence of borreliosis in bovine heras what might eventually interfere with the interpretation of diagnosis results or become cause for concern in blood products such as anaplasmosis and babesiosis live vaccines.

  1. Bmcystatin, a cysteine proteinase inhibitor characterized from the tick Boophilus microplus

    International Nuclear Information System (INIS)

    The bovine tick Rhipicephalus (Boophilus) microplus is a blood-sucking animal, which is responsible for Babesia spp and Anaplasma marginale transmission for cattle. From a B. microplus fat body cDNA library, 465 selected clones were sequenced randomly and resulted in 60 Contigs. An open reading frame (ORF) contains 98 amino acids named Bmcystatin, due to 70% amino acid identity to a classical type 1 cystatin from Ixodes scapularis tick (GenBank Accession No. DQ066227). The Bmcystatin amino acid sequence analysis showed two cysteine residues, theoretical pI of 5.92 and Mr of 11kDa. Bmcystatin gene was cloned in pET 26b vector and the protein expressed using bacteria Escherichia coli BL21 SI. Recombinant Bmcystatin (rBmcystatin) purified by affinity chromatography on Ni-NTA-agarose column and ionic exchange chromatography on HiTrap Q column presented molecular mass of 11kDa, by SDS-PAGE and the N-terminal amino acid sequenced revealed unprocessed N-terminal containing part of pelB signal sequence. Purified rBmcystatin showed to be a C1 cysteine peptidase inhibitor with Ki value of 0.1 and 0.6nM for human cathepsin L and VTDCE (vitellin degrading cysteine endopeptidase), respectively. The rBmcystatin expression analyzed by semi-quantitative RT-PCR confirmed the amplification of a specific DNA sequence (294bp) in the fat body and ovary cDNA preparation. On the other hand, a protein band was detected in the fat body, ovary, and the salivary gland extracts using anti-Bmcystatin antibody by Western blot. The present results suggest a possible role of Bmcystatin in the ovary, even though the gene was cloned from the fat body, which could be another site of this protein synthesis

  2. Variation among Bm86 sequences in Rhipicephalus (Boophilus) microplus ticks collected from cattle across Thailand.

    Science.gov (United States)

    Kaewmongkol, S; Kaewmongkol, G; Inthong, N; Lakkitjaroen, N; Sirinarumitr, T; Berry, C M; Jonsson, N N; Stich, R W; Jittapalapong, S

    2015-06-01

    Anti-tick vaccines based on recombinant homologues Bm86 and Bm95 have become a more cost-effective and sustainable alternative to chemical pesticides commonly used to control the cattle tick, Rhipicephalus (Boophilus) microplus. However, Bm86 polymorphism among geographically separate ticks is reportedly associated with reduced effectiveness of these vaccines. The purpose of this study was to investigate the variation of Bm86 among cattle ticks collected from Northern, Northeastern, Central and Southern areas across Thailand. Bm86 cDNA and deduced amino acid sequences representing 29 female tick midgut samples were 95.6-97.0 and 91.5-93.5 % identical to the nucleotide and amino acid reference sequences, respectively, of the Australian Yeerongpilly vaccine strain. Multiple sequence analyses of these Bm86 variants indicated geographical relationships and polymorphism among Thai cattle ticks. Two larger groups of cattle tick strains were discernable based on this phylogenetic analysis of Bm86, a Thai group and a Latin American group. Thai female and male cattle ticks (50 pairs) were also subjected to detailed morphological characterization to confirm their identity. The majority of female ticks had morphological features consistent with those described for R. (B.) microplus, whereas, curiously, the majority of male ticks were more consistent with the recently re-instated R. (B.) australis. A number of these ticks had features consistent with both species. Further investigations are warranted to test the efficacies of rBm86-based vaccines to homologous and heterologous challenge infestations with Thai tick strains and for in-depth study of the phylogeny of Thai cattle ticks. PMID:25777941

  3. Comportamento de queda de fêmeas ingurgitadas do carrapato Boophilus microplus The drop-off behaviour of engorged females of the cattle tick, Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Paula Hocayen de Paula

    2002-08-01

    Full Text Available A dinâmica de queda de fêmeas ingurgitadas do carrapato Boophilus microplus foi avaliada na Estação Experimental da Embrapa Gado de Leite, em Coronel Pacheco- MG, Brasil. O objetivo foi avaliar as vantagens da modificação do horário de ordenha dos bovinos, considerando a higienização do pasto, em relação ao carrapato. O experimento constou de uma fase de verão/outono e uma de inverno, para testar diferenças no ritmo de queda dos carrapatos entre as duas estações. Os resultados mostraram diferenças significativas entre as fases. No verão/outono, as fêmeas ingurgitadas apresentaram maior porcentagem de queda entre 7 e 10 horas (35,3% e no inverno entre 6 e 9 horas (19,69% e entre 14 e 17 horas (21,79%. A porcentagem de queda de fêmeas ingurgitadas no período foi de 35,15% para o sistema de ordenha de 5-8h e 13-16h e de 45,48% para o sistema de ordenha de 8-11h e 16-19h, durante os meses de verão/outono. Nos meses de inverno, o porcentual de queda foi de 40,51% e de 32,71% para os dois horários de ordenha respectivamente. Considerando o tempo que os animais permanecem estabulados para a suplementação no cocho durante o período entre as ordenhas na época seca do ano na região (maio a setembro, a porcentagem de queda de fêmeas ingurgitadas foi de 55,83% para o sistema de ordenha de 5 a 16h e de 52,36% para o sistema de ordenha de 8 a 19h.A description of the drop-off behaviour of engorged females of the tick Boophilus microplus was carried out as a result of an experiment at the Experimental Station, Embrapa Gado de Leite, Coronel Pacheco, MG, Brazil. Its objective was to evaluate any repercussions of changing the time of milking of cattle in terms of reduced recontamination of the pastures with the tick. Such possible changes in this daily cattle management routine have recently become a reality since the advent of refrigerated on-farm storage of the milk and non-daily collection by tanker truck. The field experiment

  4. The Rhipicephalus (Boophilus) microplus Bm86 gene plays a critical role in the fitness of ticks fed on cattle during acute Babesia bovis infection

    OpenAIRE

    Knowles Donald P; Ueti Massaro W; Bastos Reginaldo G; Scoles Glen A

    2010-01-01

    Abstract Background Rhipicephalus (Boophilus) microplus is an economically important tick of cattle involved in the transmission of Babesia bovis, the etiological agent of bovine babesiosis. Commercial anti-tick vaccines based on the R. microplus Bm86 glycoprotein have shown some effect in controlling tick infestation; however their efficacy as a stand-alone solution for tick control has been questioned. Understanding the role of the Bm86 gene product in tick biology is critical to identifyin...

  5. Two initial vaccinations with the Bm86-based Gavacplus vaccine against Rhipicephalus (Boophilus) microplus induce similar reproductive suppression to three initial vaccinations under production conditions

    OpenAIRE

    Fernández Erlinda; Suárez Marisela; Lleonart Ricardo; Méndez Luis; Rodríguez Elsa; Machado Héctor; Joglar Marisdania; Alfonso Aymé; Valdés Mario; Pérez Danny; Sánchez Dunia; Montero Carlos; Vargas Milagros; Estrada Mario P; Rodríguez-Mallón Alina

    2010-01-01

    Abstract Background The cattle tick, Rhipicephalus (Boophilus) microplus, affects livestock production in many regions of the world. Up to now, the widespread use of chemical acaricides has led to the selection of acaricide-resistant ticks and to environmental contamination. Gavacplus is a subunit vaccine based on the recombinant Bm86 tick antigen expressed in yeast, capable to control infestations of R. microplus under controlled and production conditions. The vaccine constitutes the core el...

  6. Bovine immunoprotection against Rhipicephalus (Boophilus microplus with recombinant Bm86-Campo Grande antigen Imunoproteção de bovinos contra Rhipicephalus (Boophilus microplus com antígeno recombinante Bm86-Campo Grande

    Directory of Open Access Journals (Sweden)

    Rodrigo Casquero Cunha

    2012-09-01

    Full Text Available The southern cattle fever tick, Rhipicephalus (Boophilus microplus, is no doubt the most economically important ectoparasite of cattle globally. The inappropriate use of chemical acaricides has driven the evolution of resistance in populations of R. (B. microplus. Anti-tick vaccines represent a technology that can be combined with acaricides in integrated control programs to mitigate the impact of R. (B. microplus. The recombinant form of Bm86 antigen from the Campo Grande (rBm86-CG strain of R. (B. microplus was produced using the Pichiapastoris expression system to test its ability to immunoprotect cattle against tick infestation. Secretion of rBm86-CG by P. pastoris through the bioprocess reported here simplified purification of the antigen. A specific humoral immune response was detected by ELISA in vaccinated cattle. Immunoblot results revealed that polyclonal antibodies from vaccinated cattle recognized a protein in larval extracts with a molecular weight corresponding to Bm86. The rBm86-CG antigen showed 31% efficacy against the Campo Grande strain of R. (B. microplus infesting vaccinated cattle. The rBm86-CG is an antigen that could be used in a polyvalent vaccine as part of an integrated program for the control of R. (B. microplus in the region that includes Mato Grosso do Sul.O carrapato Rhipicephalus (Boophilus microplus é, sem dúvidas, o ectoparasito economicamente mais importante para o gado a nível mundial. A utilização inadequada de acaricidas tem impulsionado a evolução da resistência em populações de R. (B. microplus. Vacinas contra o carrapato representam uma tecnologia que pode ser combinada com acaricidas em programas de controle integrado para diminuir o impacto de R. (B. microplus. A forma recombinante da Bm86 da cepa Campo Grande (rBm86-CG de R. (B. microplus foi produzido utilizando o sistema de expressão em Pichia pastoris para testar sua capacidade de imunoproteção ao gado contra a infestação de

  7. Possible risk factors on Queensland dairy farms for acaricide resistance in cattle tick (Boophilus microplus).

    Science.gov (United States)

    Jonsson, N N; Mayer, D G; Green, P E

    2000-02-29

    A case control study was carried out within a cross-sectional survey designed to investigate the management by Queensland dairy farmers of the cattle tick Boophilus microplus. Although 199 farmers were surveyed, data on acaricide resistance were only obtained from 66 farms. Multiple models were used to predict the probability of acaricide resistance associated with 30 putative risk factors. The region of the state in which the farm was located and the frequency of acaricide application were consistently associated with acaricide resistance. The risk of resistance to all synthetic pyrethroids (Parkhurst strain) was highest in Central Queensland and increased when more than five applications of acaricide were made in the previous year, when spray races were used and when buffalo fly treatments with a synthetic pyrethroid were applied frequently. The probability of resistance to amitraz (Ulam strain) was highest in Central Queensland, increased when more than five applications of acaricide were made in the previous year, and decreased on farms when a hand-spray apparatus was used to apply acaricides to cattle. The probability of resistance to flumethrin (Lamington strain) was highest in the Wide Bay-Burnett region. PMID:10681025

  8. Seroepidemiological study of Babesia bovis in support of the Uruguayan Boophilus microplus control programme

    International Nuclear Information System (INIS)

    Bovine blood samples were collected from a region endemic for Boophilus microplus and consisting of 125 ranches with a cattle population of 76,918. A total of 1,728 cattle were bled (1,485 adults and 243 calves less from 1 year of age) from 27 ranches. This sample size was determined to provide incidence and prevalence values with a precision of ±10% at a confidence level of 95%. The FAO/IAEA ELISA kit was used to detect antibody to Babesia bovis. Dispersion (proportion of ranches with babesia infection) was estimated to be 70.5% ± 8.8 (SD). A positive ranch was defined as having one or more test-positive animals. Apparent prevalence (proportion of cattle with a positive test result) within the region was estimated to be 3.5% ± 0.3, with a range from 0 to 18.5%. Incidence based on apparent prevalence in calves less than 1 year of age was estimated to be 2.8%. The dispersion, apparent prevalence, and incidence data for this region of Uruguay will be compared through a repeated sampling of cattle in this area during a three-year period to assess the effectiveness of the eradication/control campaign. (author)

  9. Pharmacological characterization of a tyramine receptor from the southern cattle tick, Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Gross, Aaron D; Temeyer, Kevin B; Day, Tim A; Pérez de León, Adalberto A; Kimber, Michael J; Coats, Joel R

    2015-08-01

    The southern cattle tick (Rhipicephalus (Boophilus) microplus) is a hematophagous external parasite that vectors the causative agents of bovine babesiosis or cattle tick fever, Babesia bovis and B. bigemina, and anaplasmosis, Anaplasma marginale. The southern cattle tick is a threat to the livestock industry in many locations throughout the world. Control methods include the use of chemical acaricides including amitraz, a formamidine insecticide, which is proposed to activate octopamine receptors. Previous studies have identified a putative octopamine receptor from the southern cattle tick in Australia and the Americas. Furthermore, this putative octopamine receptor could play a role in acaricide resistance to amitraz. Recently, sequence data indicated that this putative octopamine receptor is probably a type-1 tyramine receptor (TAR1). In this study, the putative TAR1 was heterologously expressed in Chinese hamster ovary (CHO-K1) cells, and the expressed receptor resulted in a 39-fold higher potency for tyramine compared to octopamine. Furthermore, the expressed receptor was strongly antagonized by yohimbine and cyproheptadine, and mildly antagonized by mianserin and phentolamine. Tolazoline and naphazoline had agonistic or modulatory activity against the expressed receptor, as did the amitraz metabolite, BTS-27271; however, this was only observed in the presence of tyramine. The southern cattle tick's tyramine receptor may serve as a target for the development of anti-parasitic compounds, in addition to being a likely target of formamidine insecticides. PMID:25958152

  10. Rhipicephalus (Boophilus) microplus: expression and characterization of Bm86-CG in Pichia pastoris.

    Science.gov (United States)

    Cunha, Rodrigo Casquero; Andreotti, Renato; Leite, Fábio Pereira Leivas

    2011-01-01

    The cattle tick Rhipicephalus (Boophilus) microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (Gavac(TM) and TickGard(PLUS)) that have been developed against cattle ticks. The subcloning was done in the pPIC9 expression vector, for transformation in the yeast Pichia pastoris. This protein was characterized by expression of the recombinant Mut+ strain, which expressed greater quantities of protein. The expressed protein (rBm86-CG) was recognized in the Western-blot assay using anti-Gavac, anti-TickGard, anti-larval extract and anti-rBm86-CG polyclonal sera. The serum produced in cattle vaccinated with the antigen CG rBm86 presented high antibody titers and recognized the native protein. The rBm86-GC has potential relevance as an immunogen for vaccine formulation against cattle ticks. PMID:21722483

  11. Polymorphism of the bm86 gene in South American strains of the cattle tick Boophilus microplus.

    Science.gov (United States)

    Sossai, Sidimar; Peconick, Ana P; Sales-Junior, Policarpo A; Marcelino, Francismar C; Vargas, Marlene I; Neves, Elisangela S; Patarroyo, Joaquín H

    2005-01-01

    Thirty Boophilus microplus strains from various geographic regions of Brazil, Argentina, Uruguay, Venezuela and Colombia were analyzed for the bm86 and bm95 gene. A fragment of cDNA of 794 base pairs of the parasite larvae, included between nucleotides 278-1071s, was amplified and cloned on the pGEM-T vector. Two random clones were sequenced for each population and the nucleotides 278-1071 and predicted amino acid sequences compared with the bm86 and bm95 genes. Variations from 1.76 to 3.65% were detected in the nucleotides sequence when compared with the homologous sequence of the bm86 gene and a 3.4-6.08% in the homologous amino acid sequence of the Bm86 protein. When the sequences obtained were compared with the bm95 gene, variations from 0.50 to 3.15% were detected. Variations from 1.14 to 4.56% were detected for the Bm95 protein homologous sequences in the deduced amino acid sequence. Only five of the 30 strains analyzed presented two different types of alleles expressed and the two alleles of the Alegre population and allele 1 of the Betim population were the most divergent of all those analyzed. PMID:16323051

  12. Vaccination of cattle against the Boophilus microplus using a mucin-like membrane glycoprotein.

    Science.gov (United States)

    McKenna, R V; Riding, G A; Jarmey, J M; Pearson, R D; Willadsen, P

    1998-07-01

    An antigen, BMA7, which induced partial immunity against tick infestation has been isolated from Boophilus microplus using two different protein fractionation protocols, accompanied by vaccination and parasite challenge trails. The antigen is a 63 kDa glycoprotein isolated from semi-engorged adult female ticks. Though significant, the induced immunity is less striking than that previously reported for antigen Bm86 from the same parasite. However, co-vaccination with Bm86 and BMA7 can enhance immunity over that seen with a commercial vaccine based on Bm86 alone. Limited peptide sequence information shows significant variation in the BMA7 protein occurs. The antigen has approximately 36 kDa of glycosylation, in both N-linked and O-linked oligosaccharides. There is evidence that both polypeptide and oligosaccharide are antigenic, but the chemical nature of the protective antigenic sites is not clear. There is little or no immunological response to the antigen during natural infestation with parasites, suggesting the antigen is 'concealed' and protective immunity dependent on artificial vaccination. The antigen has some similarities with the vertebrate mucins. It is widely distributed in tick tissues and membrane bound but its function is currently unknown. PMID:9717194

  13. Identificación de un polimorfismo del gen Est9 relacionado con resistencia a piretroides en Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Edgar Diaz R.

    2013-10-01

    Full Text Available Objetivo. Mediante procedimientos de PCR-RFLP, detectar un polimorfismo en el gen Est9 de garrapatas Rhipicephalus (Boophilus microplus resistentes a piretroides en Ibagué, Colombia, determinando el grado de asociación entre los fenotipos y los genotipos resultantes. Materiales y métodos. El ADN de 30 teleoginas R. (Boophilus microplus fenotípicamente susceptibles, resistentes o medianamente resistentes a piretroides en una prueba de Drummond modificada, fue amplificado por PCR con cebadores específicos para obtener un fragmento de 372 pb del gen Est9, que fue sometido a digestión con la enzima EcoRI para estudiar los RFLPs generados y poder diferenciar los respectivos genotipos. El grado de asociación entre los fenotipos y los genotipos resultantes se determinó mediante la prueba exacta de Fisher. Resultados. Luego de digerir el fragmento con la endonucleasa, se generaron dos segmentos en teleoginas con algún nivel de resistencia, mientras en las teleoginas susceptibles no hubo división del fragmento de 372 pb, demostrándose así la presencia de una mutación puntual y los genotipos homocigoto natural, homocigoto mutante y heterocigoto. Las diferencias altamente significativas (p<0.01 entre teleoginas susceptibles y aquellas con algún nivel de resistencia, mostraron una relación directa entre el genotipo y el fenotipo con un nivel de confianza de p=0.0009852. Conclusiones. Se comprobó, por primera vez en Colombia, la presencia de una mutación puntual en el gen Est9 de garrapatas R. (Boophilus microplus resistentes a piretroides, sugiriendo la necesidad de realizar estudios para detectar alteraciones moleculares en otros genes relacionados con quimioresistencia.

  14. Acaricidal activity of Palicourea marcgravii, a species from the Amazon forest, on cattle tick Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Silva, Wilson Castro; Martins, João Ricardo de Souza; Cesio, Maria Veronica; Azevedo, João Lúcio; Heinzen, Horacio; de Barros, Neiva Monteiro

    2011-06-30

    Leaves of Palicourea marcgravii were extracted successively with hexane, ethyl acetate and ethanol in order to evaluate their acaricidal activity on larvae and adult stages of the cattle tick Rhipicephalus (Boophilus) microplus. The ethyl acetate extract showed the highest bioactivity of the tested extracts, which contained 0.12% monofluoroacetic acid. On engorged female, the ethyl acetate extract showed a lethal concentration 50% - LC(50)=30.08 mg ml(-1), inhibitory concentration 50% - IC(50)=5.79 mg ml(-1) and lethal time 50% - LT(50)=4.72 days; 100% reproduction was controlled at concentrations of 50 mg ml(-1) and on larvae the ethyl acetate extract showed a LC(50)=2.46 mg ml(-1). No alkaloids were detected in any of the extracts. This is the first report on the acaricidal activity of P. marcgravii extracts against R. microplus as well as the acaricidal properties of a plant species containing monofluoroacetic acid. PMID:21411227

  15. Partial sequencing of Bm86 gene for studying the phylogeny of an Indian isolate of Rhipicephalus (Boophilus) microplus tick.

    Science.gov (United States)

    Anbarasi, P; Latha, B R; Dhinakar Raj, G; Sreekumar, C; Senthuran, S

    2014-09-01

    Tick gut glycoprotein, designated as Bm86, found on the luminal surface of the plasma membrane of gut epithelial cells of Boophilus microplus, which is a concealed antigen, has been used as vaccine candidate molecule for immunization against ticks. To better understand the molecular diversity of Bm86 gene in ticks, a portion of the cDNA was sequenced from an Indian isolate of B. microplus. Comparison of nucleotide sequence revealed that Indian isolate had 97 % homology (18 polymorphisms) with that of the Australian isolate and 96 % homology (20 polymorphisms) with that of the Cuban vaccine strain. Further, the Indian isolate differed from the Cuban vaccine isolate at 7 amino acid loci, including 5 substitutions (at residues 88, 94, 175, 176 and 177) and 2 deletions (at 183 and 184). However, protein prediction studies did not show any difference in the putative antigenic epitopes of the protein expressed. PMID:25035581

  16. Suscetibilidade de Rhipicephalus (Boophilus microplus a carrapaticidas em Mato Grosso do Sul, Brasil Susceptibility of Rhipicephalus (Boophilus microplus to acaricides in Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Alberto Gomes

    2011-08-01

    Full Text Available O carrapato bovino, Rhipicephalus (Boophilus microplus, destaca-se dentre os ectoparasitas de importância econômica à pecuária nacional, tornando-se necessária a adoção de medidas de controle, particularmente em rebanhos Bos taurus e seus cruzamentos. O controle do carrapato tem sido cada vez mais difícil devido à constatação de populações resistentes aos diversos produtos em uso. Neste estudo, teve-se por objetivo conhecer a suscetibilidade desse carrapato a acaricidas em Mato Grosso do Sul. De outubro de 2003 a outubro de 2006, testes carrapaticidogramas foram realizados em onze das principais regiões pecuárias do estado. Nos testes de suscetibilidade, foi utilizada a técnica de imersão de adultos, com posterior avaliação de parâmetros biológicos. Foram testados doze acaricidas comerciais, abrangendo sete princípios ativos (isoladamente ou em associação, pertencentes a três grupos químicos: amidinas (amitraz, piretróides sintéticos (cipermetrina e organofosforados (clorfenvinfós, clorpirifós, diazinon, diclorvós e etion. Baixa suscetibilidade foi detectada em todas as propriedades, evidenciando uma reduzida eficácia de todos os grupos químicos testados. Apesar da grande variação de suscetibilidade demonstrada pelas distintas populações a cada acaricida testado, foi possível observar um gradiente de eficácia desses produtos. Independente da classe, a eficácia média dos produtos com um único princípio ativo (19,94%-64,27% foi, de modo geral, menor que a das associações, tanto entre piretróide e organofosforados (46,38%-82,68%, como exclusivamente entre organofosforados (85,28%-97,68%. A associação contendo piretróide, organofosforados, sinergista e repelente (cipermetrina + clorpirifós + butóxido de piperonila + citronelal apresentou 100% de eficácia, embora testada em menor número de populações. Embora comparações com cepas suscetíveis não tenham sido efetuadas, a baixa suscetibilidade

  17. Efecto ixodicida de los extractos etanólicos de algunas plantas sobre garrapatas Rhipicephalus (Boophilus) microplus

    OpenAIRE

    Ángela Rodríguez S.; Carlos Rodríguez M.; Anastasia Cruz C.

    2010-01-01

    Objetivo. Evaluar in vitro, el efecto ixodicida del extracto etanólico de cinco plantas; Brugmasia arborea, Sambucus nigra, Nicotiana tabacum, Bidens pilosa y Ambrosia cumanenses sobre garrapatas adultas de la especie Rhipicephalus (Boophilus) microplus. Materiales y métodos. El extracto de cada planta fue obtenido mediante la técnica de lixiviación. Para las pruebas, se utilizaron garrapatas adultas de dos tamaños (pequeñas y medianas), que fueron expuestas a los extractos de cada planta, ut...

  18. Evidence for the utility of the Bm86 antigen from Boophilus microplus in vaccination against other tick species.

    Science.gov (United States)

    de Vos, S; Zeinstra, L; Taoufik, O; Willadsen, P; Jongejan, F

    2001-01-01

    The Bm86 antigen, as originally identified in Boophilus microplus, is the basis of commercial tick vaccines against this tick species. The potential for using this antigen or homologues of the antigen in vaccination against other tick species has been assessed. We have conducted vaccine trials in cattle using the B. microplus-derived recombinant Bm86 vaccine (TickGARD) using pairs of vaccinated calves and control calves. These were infested with B. microplus and Boophilus decoloratus larvae simultaneously. For both species, the numbers of engorged female adult ticks, their weight and egg-laying capacity were all reduced, leading to a reduction in reproductive capacity of 74% for B. microplus and 70% for B. decoloratus. Hyalomma anatolicum anatolicum ticks were fed both as immatures as well as adults on vaccinated calves and non-vaccinated controls. There was an overall 50% reduction in the total weight of nymphs engorging on vaccinated calves, and a suggestion of a subsequent effect on feeding adults. For Hyalomma dromedarii there was a 95% reduction in the number of nymphs engorging and a further 55% reduction in weight of those ticks surviving. Rhipicephalus appendiculatus and Amblyomma variegatum ticks were fed simultaneously both as immatures and subsequently as adults. There was no evidence for a significant vaccination effect. Finally, the amino acid sequence of a Bm86 homologue found in H. a. anatolicum unequivocally demonstrated the conservation of this molecule in this species. Our strategy for the development of multivalent anti-tick vaccines is discussed in relation to these findings. PMID:11523920

  19. Silencing of a putative immunophilin gene in the cattle tick Rhipicephalus (Boophilus) microplus increases the infection rate of Babesia bovis in larval progeny

    Science.gov (United States)

    The cattle tick Rhipicephalus (Boophilus) microplus is involved in the transmission of the protozoan Babesia bovis, the etiological agent of bovine babesiosis. Interactions between ticks and protozoa are poorly understood and the investigation of tick genes that affect tick fitness and protozoan inf...

  20. Molecular characterization of Rhipicephalus (Boophilus) microplus Bm86 homologue from Haemaphysalis longicornis ticks.

    Science.gov (United States)

    Liao, Min; Zhou, Jinlin; Hatta, Takeshi; Umemiya, Rika; Miyoshi, Takeharu; Tsuji, Naotoshi; Xuan, Xuenan; Fujisaki, Kozo

    2007-05-15

    One sequence in the EST database of a midgut cDNA library prepared from semi-engorged female Haemaphysalis longicornis ticks has been found to be a homologue of the Bm86 gene of Rhipicephalus (Boophilus) microplus ticks. The full-length sequence containing a 1785 bp open reading fragment (ORF) was obtained and designated as the Hl86 gene. The predicted amino acid sequence of the Hl86 gene shows a 37% identity to the Bm86 gene. Hl86 is predicted to be a GPI-anchored membrane-bound glycoprotein with a 19-amino acid signal sequence and a 22-amino acid hydrophobic region adjacent to the carboxyl terminus. The most important feature that Hl86 has in common with Bm86 is the repeated pattern of 6 cysteine residues forming epidermal growth factor (EGF)-like domains. RT-PCR analysis showed that Hl86 mRNA transcripts are expressed in all the life cycles of H. longicornis, and the expression was found in the midgut of the adult tick. The Hl86 was expressed in Escherichia coli as a gene10 fusion protein. Mouse anti-recombinant Hl86 serum recognized an 86 kDa protein band in the midgut lysate of semi-engorged ticks in Western blot analysis and showed a strong reaction on the luminal surface of midgut cells in an indirect immunofluorescent antibody test (IFAT). Silencing of the Hl86 gene by RNAi led to a significant reduction in the engorged tick body weight. This is the first report of cloning and characterization of the Bm86 homologue in different genera and species of ixodid and argasid ticks since Bm86 was first reported in 1989. PMID:17363170

  1. In vitro acaricidal activity of ethanolic and aqueous floral extracts of Calendula officinalis against synthetic pyrethroid resistant Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Godara, R; Katoch, R; Yadav, A; Ahanger, R R; Bhutyal, A D S; Verma, P K; Katoch, M; Dutta, S; Nisa, F; Singh, N K

    2015-09-01

    Detection of resistance levels against deltamethrin and cypermethrin in Rhipicephalus (Boophilus) microplus collected from Jammu (India) was carried out using larval packet test (LPT). The results showed the presence of resistance level II and I against deltamethrin and cypermethrin, respectively. Adult immersion test (AIT) and LPT were used to evaluate the in vitro efficacy of ethanolic and aqueous floral extracts of Calendula officinalis against synthetic pyrethroid resistant adults and larvae of R. (B.) microplus. Four concentrations (1.25, 2.5, 5 and 10 %) of each extract with four replications for each concentration were used in both the bioassays. A concentration dependent mortality was observed and it was more marked with ethanolic extract. In AIT, the LC50 values for ethanolic and aqueous extracts were calculated as 9.9 and 12.9 %, respectively. The egg weight of the live ticks treated with different concentrations of the ethanolic and aqueous extracts was significantly lower than that of control ticks; consequently, the reproductive index and the percent inhibition of oviposition values of the treated ticks were reduced. The complete inhibition of hatching was recorded at 10 % of ethanolic extract. The 10 % extracts caused 100 % mortality of larvae after 24 h. In LPT, the LC50 values for ethanolic and aqueous extracts were determined to be 2.6 and 3.2 %, respectively. It can be concluded that the ethanolic extract of C. officinalis had better acaricidal properties against adults and larvae of R. (B.) microplus than the aqueous extract. PMID:26071101

  2. Toxicity of Piper aduncum L. (Piperales: Piperaceae) from the Amazon forest for the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Silva, Wilson Castro; Martins, João Ricardo de Souza; de Souza, Hellen Emília Menezes; Heinzen, Horacio; Cesio, Maria Verônica; Mato, Mauricio; Albrecht, Francine; de Azevedo, João Lúcio; de Barros, Neiva Monteiro

    2009-10-14

    The mortality of 14-21-day-old Rhipicephalus (Boophilus) microplus larvae, and the mortality and fertility of groups of engorged adult females exposed to different concentrations of hexane, ethyl acetate and ethanol extracts of spiked pepper (Piper aduncum) were evaluated, using a completely randomized design with five treatment groups, two control groups, and two replicates for the larvae and five replicates for the adult females. Similar methodology was used to investigate the toxicity of the essential oil hydro-distillate (94.84% dillapiole) obtained from the P. aduncum crude hexane extract. The LC(50) of the hexane extract was 9.30 mg ml(-1) for larvae and the reproduction reduction ranged from 12.48% to 54.22%, while 0.1mg/ml(-1) of the essential oil induced 100% mortality in larvae. Literature reports on natural products active against R. microplus were listed and compared with the results presented here. These results indicate that P. aduncum extracts, and particularly its essential oil, are potential alternative control agents for R. microplus. PMID:19573994

  3. Efficacy of Rhipicephalus (Boophilus) microplus Bm86 against Hyalomma dromedarii and Amblyomma cajennense tick infestations in camels and cattle.

    Science.gov (United States)

    Rodríguez-Valle, Manuel; Taoufik, Amar; Valdés, Mario; Montero, Carlos; Ibrahin, Hassan; Hassan, Shawgi Mohammed; Jongejan, Frans; de la Fuente, Jose

    2012-05-14

    The recombinant Bm86-based tick vaccines have shown their efficacy for the control of cattle ticks, Rhipicephalus (Boophilus) microplus and R. annulatus infestations. However, cattle ticks often co-exist with multi-host ticks such as Hyalomma and Amblyomma species, thus requiring the control of multiple tick infestations for cattle and other hosts. Vaccination trials using a R. microplus recombinant Bm86-based vaccine were conducted in cattle and camels against Hyalomma dromedarii and in cattle against Amblyomma cajennense immature and adult ticks. The results showed an 89% reduction in the number of H. dromedarii nymphs engorging on vaccinated cattle, and a further 32% reduction in the weight of the surviving adult ticks. In vaccinated camels, a reduction of 27% and 31% of tick engorgement and egg mass weight, respectively was shown, while egg hatching was reduced by 39%. However, cattle vaccination with Bm86 did not have an effect on A. cajennense tick infestations. These results showed that Bm86 vaccines are effective against R. microplus and other tick species but improved vaccines containing new antigens are required to control multiple tick infestations. PMID:22446633

  4. Integrated control of Boophilus microplus ticks in Cuba based on vaccination with the anti-tick vaccine Gavac.

    Science.gov (United States)

    Valle, Manuel Rodriguez; Mèndez, Luis; Valdez, Mario; Redondo, Miguel; Espinosa, Carlos Montero; Vargas, Milagro; Cruz, Ricardo Lleonart; Barrios, Humberto Perez; Seoane, Guillermo; Ramirez, Emerio Serrano; Boue, Oscar; Vigil, Jorge Lodos; Machado, Héctor; Nordelo, Carlos Borroto; Piñeiro, Marisdania Joglar

    2004-01-01

    Boophilus microplus has developed resistance against a range of chemical acaricides which has stimulated the development of alternative methods such as vaccination against ticks. In Cuba, the Bm86-based recombinant vaccine Gavac has been successfully used in a number of controlled laboratory and field trials in cattle against B. microplus. In this paper, we have evaluated Gavac in a large scale field trial wherein 588,573 dairy cattle were vaccinated with the aim to reduce the number of acaricidal treatments. It was found that the number of acaricidal treatments could be reduced by 87% over a period of 8 years (1995--2003). Prior to the introduction of the vaccine, 54 clinical cases of babesiosis and six fatal cases were reported per 1000 animals. Six years later, the incidence of babesiosis was reduced to 1.9 cases per 1000 cattle and mortality reduced to 0.18 per 1000. The national consumption of acaricides in Cuba could be reduced by 82% after the implementation of the integrated anti-B. microplus control program. PMID:15651533

  5. Ação larvicida de derivados arilsulfonílicos da (+- cânfora e da (+- isopinocanfona sobre o carrapato Boophilus microplus Larvicidal action of (+-camphor and (+- isopinocamphone arilsulphonyl derivatives on Boophilus microplus cattle tick

    Directory of Open Access Journals (Sweden)

    A.C.S. Chagas

    2002-10-01

    Full Text Available Testou-se a atividade larvicida de 33 derivados arilsulfonílicos da (+-cânfora e da (+-isopinocanfona no carrapato B. microplus, na busca de princípios ativos menos tóxicos para o seu controle. Os produtos foram obtidos por clorossulfonação da (+-cânfora e da (+-isopinocanfona. Eles foram submetidos à solubilização e testados separadamente e em conjunto contra larvas de carrapato encerradas em envelopes contendo papéis impregnados e acondicionadas em estufa climatizada. A mortalidade média não atingiu 5% em todos os testes realizados, indicando que a clorossulfonação não é a rota de síntese mais adequada para a obtenção de derivados sintéticos com efeito larvicida sobre B. microplus. Os 33 produtos testados sob a forma de triagem biológica não podem ser considerados como potenciais acaricidas.It was investigated the acaricidal activity of (+- camphor and (+- isopinocamphone arilsulphonyl derivatives against Boophilus microplus cattle tick. The products were obtained through the camphor and isopinocamphone clorosulfonation. Thirty-three products were submitted to solubilization and tested alone and together, against tick larvae. Ticks were caught in filter paper envelopes impregnated with products, which were incubated under controlled conditions. The average mortality did not reach 5% in all trials, indicating that clorosulfonation is not an appropiate procedure to obtain derivatives with larvicidal effect against B. microplus. The 33 products tested in the biological screening could not be considered as potential acaricides.

  6. Transmissão transovariana de Babesia bovis em Boophilus microplus: obtenção de cepa de carrapato livre de Babesia spp. Babesia bovis transovarian transmission in Boophilus microplus: obtention of a Babesia free tick strain

    Directory of Open Access Journals (Sweden)

    Tânia Regina Bettin dos Santos

    2000-06-01

    Full Text Available O presente trabalho objetivou o estudo de parte do ciclo da Babesia bovis no seu hospedeiro invertebrado, o carrapato Boophilus microplus. Analisou-se a capacidade de infeccção e transmissão transovariana de B. bovis em partenóginas de B. microplus, alimentadas em bovinos portadores e enfermos por esse protozoário. No 18º dia após a infestação, coletaram-se partenóginas diretamente do corpo dos bovinos e teleóginas após o desprendimento natural, a partir do 21º dia. Todos os grupos foram incubados a 27ºC e umidade relativa superior a 70%. No 5º dia após o início da postura, realizou-se o exame de hemolinfa a fim de diagnosticar a infecção dos ínstares por B. bovis. A ausência de infecção detectada no exame de hemolinfa foi confirmada posteriormente com o teste biológico, revelando que partenóginas não transmitem B. bovis transovarianamente. Esses resultados oferecem uma técnica simplificada para a obtenção de cepas de carrapatos livres de B. bovis.In this experiment part of the life cycle of Babesia bovis in its invertebrate host, the tick Boophilus microplus was studied. In order to evaluate the capacity of infection and transmission of B. bovis were collected semi-engorged females of B. microplus fed on carrier and ill bovines. In the 18th day after infestation, semi-engorged females were collected directly from bovine bodies and after 21st day engorged females dropped on the ground. All the collected groups were incubated at 27°C and relative humidity greater than 70%. At the 5th day of oviposition the diagnosis was made by direct examination of haemolymph smears. The biological test reveled that B. bovis transovarial transmission doesn't happer in semi-engorged females. The results offer a simple techique to obtain strains of ticks free of B. bovis.

  7. Perspectives for the use of plant extracts to control the cattle tick Rhipicephalus (Boophilus microplus Perspectivas para o uso de extratos de plantas para o controle do carrapato de bovinos Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Lígia Miranda Ferreira Borges

    2011-06-01

    Full Text Available The evolution of resistance of Rhipicephalus (Boophilus microplus to synthetic acaricides has given rise to the need for new scientific investigations on alternative ways to control this tick. In this regard, various studies on plants have been developed in an attempt to find extracts with acaricidal properties. Evaluations on plant extracts for controlling R. (B. microplus have grown intensely over the last decade. There are many advantages from using plant extracts: for example, they can be used in organic cattle farming or even replace synthetic acaricides and they are associated with lower environmental and food contamination, slower development of resistance and lower toxicity to animals and humans. In vitro studies on plant extracts have shown promising results, but most of these extracts have not been tested on animals to validate their use. Difficulties in preparing proper formulations, differences in the chemical composition of plants of the same species due to extrinsic and intrinsic factors and sparse information on active acaricide compounds are hindrances that need to be addressed in order to enable progress within this scientific field.A evolução da resistência do Rhipicephalus (Boophilus microplus aos acaricidas sintéticos tem impulsionado novas investigações científicas sobre métodos alternativos para controlar este carrapato. Considerando isso, vários estudos com plantas têm sido desenvolvidos numa tentativa de encontrar extratos com propriedades acaricidas. Avalições de extratos de plantas para o controle de R. (B. microplus tem sido intensificadas nesta última década. Existem muitas vantagens com o uso de extratos de plantas no controle deste carrapato, como: eles podem ser utilizados na produção orgânica de bovinos, ou mesmo substituir os acaricidas sintéticos, além do mais, estão associados com baixa contaminação ambiental e dos alimentos, desenvolvimento mais lento de resistência e baixa toxicidade

  8. Identification and characterization of Rhipicephalus (Boophilus) microplus candidate protective antigens for the control of cattle tick infestations.

    Science.gov (United States)

    Almazán, Consuelo; Lagunes, Rodolfo; Villar, Margarita; Canales, Mario; Rosario-Cruz, Rodrigo; Jongejan, Frans; de la Fuente, José

    2010-01-01

    The cattle ticks, Rhipicephalus (Boophilus) spp., affect cattle production in tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The recombinant Rhipicephalus microplus Bm86 antigen has been shown to protect cattle against tick infestations. However, variable efficacy of Bm86-based vaccines against geographic tick strains has encouraged the research for additional tick-protective antigens. Herein, we describe the analysis of R. microplus glutathione-S transferase, ubiquitin (UBQ), selenoprotein W, elongation factor-1 alpha, and subolesin (SUB) complementary DNAs (cDNAs) by RNA interference (RNAi) in R. microplus and Rhipicephalus annulatus. Candidate protective antigens were selected for vaccination experiments based on the effect of gene knockdown on tick mortality, feeding, and fertility. Two cDNA clones encoding for UBQ and SUB were used for cattle vaccination and infestation with R. microplus and R. annulatus. Control groups were immunized with recombinant Bm86 or adjuvant/saline. The highest vaccine efficacy for the control of tick infestations was obtained for Bm86. Although with low immunogenic response, the results with the SUB vaccine encourage further investigations on the use of recombinant subolesin alone or in combination with other antigens for the control of cattle tick infestations. The UBQ peptide showed low immunogenicity, and the results of the vaccination trial were inconclusive to assess the protective efficacy of this antigen. These experiments showed that RNAi could be used for the selection of candidate tick-protective antigens. However, vaccination trials are necessary to evaluate the effect of recombinant antigens in the control of tick infestations, a process that requires efficient recombinant protein production and formulation systems. PMID:19943063

  9. Efficacy of 11 Brazilian essential oils on lethality of the cattle tick Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Chagas, Ana Carolina de Souza; Oliveira, Márcia Cristina de Sena; Giglioti, Rodrigo; Santana, Raul Costa Mascarenhas; Bizzo, Humberto Ribeiro; Gama, Paola Ervatti; Chaves, Francisco Celio Maia

    2016-04-01

    Herbal extracts have been investigated as an alternative for parasite control, aiming to slow the development of resistance and to obtain low-cost biodegradable parasiticides. The goal of this study was to evaluate the efficacy, in vitro, of 11 essential oils from Brazil on reproductive efficiency and lethality of the cattle tick Rhipicephalus (Boophilus) microplus. The effects of oils extracted from Curcuma longa, Zingiber officinale, Lippia alba, Lippia gracilis, Lippia origanoides, Lippia sidoides, Mentha arvensis, Mentha piperita, Croton cajucara (white and red), and Croton sacaquinha on ticks were investigated by the Immersion Test with Engorged Females (ITEF) and the modified Larval Packet Test (LPT). Distilled water and 2% Tween 80 were used as control treatments. Chemical analysis of the oils was done with gas chromatography coupled with mass spectrometry. Analysis of the in vitro tests using Probit (SAS program) allowed the calculation of lethal concentrations (LCs). Lower reproductive efficiency indexes and higher efficacy percentages in the ITEF were obtained with the oils extracted from C. longa (24 and 71%, respectively) and M. arvensis oils (27 and 73%, respectively). Lower LC50 was reached with C. longa (10.24 mg/mL), L. alba (10.78 mg/mL), M. arvensis (22.31 mg/mL), L. sidoides (27.67 mg/mL), and C. sacaquinha (29.88 mg/mL) oils. In the LPT, species from Zingiberaceae and Verbenaceae families caused 100% lethality at 25 mg/mL, except for L. sidoides. The most effective oils were from C. longa, L. gracilis, L. origanoides, L. alba, and Z. officinale. The LC50 and LC90 were, respectively: 0.54 and 1.80 mg/mL, 3.21 and 7.03 mg/mL, 3.10 and 8.44 mg/mL, 5.85 and 11.14 mg/mL, and 7.75 and 13.62 mg/mL. The efficacy was directly related to the major components in each essential oil, and the oils derived from Croton genus presented the worst performance, suggesting the absence of synergistic effect among its compounds. Since C. longa, containing 62

  10. Gene silencing of the tick protective antigens, Bm86, Bm91 and subolesin, in the one-host tick Boophilus microplus by RNA interference

    OpenAIRE

    Nijhof, A. M.; Taoufik, A.; de la Fuente, M.R.; Kocan, K M; de Vries, E; Jongejan, F

    2007-01-01

    The use of RNA interference (RNAi) to assess gene function has been demonstrated in several three-host tick species but adaptation of RNAi to the one-host tick, Boophilus microplus, has not been reported. We evaluated the application of RNAi in B. microplus and the effect of gene silencing on three tick-protective antigens: Bm86, Bm91 and subolesin. Gene-specific double-stranded (dsRNA) was injected into two tick stages, freshly molted unfed and engorged females, and specific gene silencing w...

  11. Prevalencia de lecherías con Boophilus microplus resistentes a piretroides y factores de riesgo asociados a su presencia en el Departamento de Santa Cruz, Bolivia

    OpenAIRE

    Marbel Villarroel-Alvarez; Roger Iván Rodríguez-Vivas; Fidel Villegas-Anze; Hugo Fragoso-Sánchez; Alejandrina Ortiz-Nájera; Salvador Neri-Orantes

    2006-01-01

    Se realizó un estudio de sección cruzada para determinar la prevalencia de ranchos con garrapatas Boophilus microplus resistentes a piretroides sintéticos (PS), así como posibles factores de riesgo en la Zona Integrada del Departamento de Santa Cruz, Bolivia. Se muestrearon 83 ranchos, donde se colectaron al menos 10 teleoginas de B. microplus para evaluar en su progenie la respuesta a los PS. Se utilizó la prueba de paquete de larvas, con la dosis discriminante para diagnosticar resistencia ...

  12. Use of biodegradable PLGA microspheres as a slow release delivery system for the Boophilus microplus synthetic vaccine SBm7462.

    Science.gov (United States)

    Sales-Junior, P A; Guzman, F; Vargas, M I; Sossai, S; Patarroyo V, A M; González, C Z L; Patarroyo, J H

    2005-09-15

    The synthetic anti-Boophilus microplus vaccine SBm7462 derived from the tick intestinal protein, Bm86, induced a protective immune response when emulsified in saponin and used in cattle. Using a mice model, and with the objective of improving the vaccine by continual peptide release, it was encapsulated in PLGA 50:50 microspheres and inoculated in BALB/c mice to assess the immunological response by detection of anti-peptide IgGs. Comparative studies were made with the peptide emulsified in saponin and with another synthetic vaccine, and the microsphere/peptide was characterized for efficiency of encapsulation, in vitro release profile, morphology, size, peptide integrity after encapsulation and stability in different pHs. The findings showed that saponin enhances a better immune response from SBm7462 and that the PLGA 50:50 microspheres are suitable for use with this peptide. PMID:16002149

  13. Comparative vaccination of cattle against Boophilus microplus with recombinant antigen Bm86 alone or in combination with recombinant Bm91.

    Science.gov (United States)

    Willadsen, P; Smith, D; Cobon, G; McKenna, R V

    1996-05-01

    Cattle were vaccinated either with a single recombinant tick antigen, Bm86 or with a combination of two recombinant antigens, Bm86 and Bm91 from the tick Boophilus microplus. In three experiments, the responses of cattle to subsequent challenge with the tick were assessed. The addition of the Bm91 antigen enhanced the efficacy of the vaccination over that with Bm86 alone to a statistically significant degree. Moreover, co-vaccination with two antigens did not impair the response of cattle to the Bm86 antigen. Finally, responses of individual cattle to the two antigens were independent. All of these results may be relevant to the increase in efficacy expected from a dual antigen vaccine. PMID:9229376

  14. Rhipicephalus (Boophilus microplus (Acari: Ixodidae as a parasite of pampas deer (Ozoctoceros bezoarticus and cattle in Brazil's Central Pantanal Rhipicephalus (Boophilus microplus como parasita de veado-campeiro (Ozoctoceros bezoarticus e do gado bovino no Pantanal Central do Brasil

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Duarte Cançado

    2009-03-01

    Full Text Available In the Pantanal, domestic and wild animals share the same habitats; their parasites and environment interact in a complex and dynamic way. The Rhipicephalus (Boophilus microplus is the most important cattle tick in Brazil. In the past two decades, some traditional management practices are being replaced with the aim of intensifying cattle production. Forested areas are being replaced by exotic pasture and ranch owners are replacing Nelore for European breeds. The pampas deer (Ozoctoceros bezoarticus is a medium-sized cervid that occurs in grasslands of South America. Between December 2005 and January 2007, we captured and collected ticks from 15 pampas deer and 172 bovines. The abundance, intensity, and prevalence of ticks found in cattle were lower than those in pampas deer (p No Pantanal Brasileiro, onde animais domésticos e selvagens compartilham os mesmos habitats; hospedeiros, parasitas e ambientes encontram-se em interação complexa e dinâmica. Rhipicephalus (Boophilus microplus é o carrapato bovino mais importante no Brasil. Nas últimas duas décadas práticas de manejo vem sendo substituídas com objetivo de aumentar a produtividade. Áreas de florestas estão sendo substituídas por pastagens exóticas e os produtores começam a utilizar raças européias no lugar do Nelore. O veado-campeiro é um cervídeo que ocorre em áreas de campo na América do sul. Entre dezembro de 2005 e janeiro de 2007, foram coletados carrapatos de 20 veados-campeiros e 172 bovinos. Os valores de abundância, intensidade parasitária e prevalência de carrapatos no gado foram menores que os valores encontrados no veado-campeiro (p < 0,05, indicando que o veado-campeiro é mais susceptível que o bovino. O elevado número de fêmeas ingurgitadas coletadas, sua capacidade de ovipor e o percentual de eclosão indicam que a população veado-campeiro na região de estudo é suficiente para manter o R. (B. microplus, desta maneira participando na

  15. Immune response in mice and cattle after immunization with a Boophilus microplus DNA vaccine containing bm86 gene.

    Science.gov (United States)

    Ruiz, Lina María; Orduz, Sergio; López, Elkin D; Guzmán, Fanny; Patarroyo, Manuel E; Armengol, Gemma

    2007-03-15

    Plasmid pBMC2 encoding antigen Bm86 from a Colombian strain of cattle tick Boophilus microplus, was used for DNA-mediated immunization of BALB/c mice, employing doses of 10 and 50microg, delivered by intradermic and intramuscular routes. Anti-Bm86 antibody levels were significantly higher compared to control mice treated with PBS. In the evaluation of immunoglobulin isotypes, significant levels of IgG2a and IgG2b were observed in mice immunized with 50microg of pBMC2. Measurement of interleukine (IL) levels (IL-4, IL-5, IL-12(p40)) and interferon-gamma (IFN-gamma) in the sera of mice immunized with pBMC2 indicated high levels of IL-4 and IL-5, although there were also significant levels of IFN-gamma. Mice immunized with pBMC2 showed antigen-specific stimulation of splenocytes according to the incorporation of bromodeoxyuridine and IFN-gamma secretion. In all trials, mice injected intramuscularly with 50microg of pBMC2 presented the highest immune response. Moreover, cattle immunized with this DNA vaccine showed antibody production significantly different to the negative control. In conclusion, these results suggest the potential of DNA immunization with pBMC2 to induce humoral and cellular immune responses against B. microplus. PMID:17055651

  16. Expression of recombinant Rhipicephalus (Boophilus microplus, R. annulatus and R. decoloratus Bm86 orthologs as secreted proteins in Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Jongejan Frans

    2008-02-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus spp. ticks economically impact on cattle production in Africa and other tropical and subtropical regions of the world. Tick vaccines constitute a cost-effective and environmentally friendly alternative to tick control. The R. microplus Bm86 protective antigen has been produced by recombinant DNA technology and shown to protect cattle against tick infestations. Results In this study, the genes for Bm86 (R. microplus, Ba86 (R. annulatus and Bd86 (R. decoloratus were cloned and characterized from African or Asian tick strains and the recombinant proteins were secreted and purified from P. pastoris. The secretion of recombinant Bm86 ortholog proteins in P. pastoris allowed for a simple purification process rendering a final product with high recovery (35–42% and purity (80–85% and likely to result in a more reproducible conformation closely resembling the native protein. Rabbit immunization experiments with recombinant proteins showed immune cross-reactivity between Bm86 ortholog proteins. Conclusion These experiments support the development and testing of vaccines containing recombinant Bm86, Ba86 and Bd86 secreted in P. pastoris for the control of tick infestations in Africa.

  17. Sequence variations in the Boophilus microplus Bm86 locus and implications for immunoprotection in cattle vaccinated with this antigen.

    Science.gov (United States)

    García-García, J C; Gonzalez, I L; González, D M; Valdés, M; Méndez, L; Lamberti, J; D'Agostino, B; Citroni, D; Fragoso, H; Ortiz, M; Rodríguez, M; de la Fuente, J

    1999-11-01

    Cattle tick infestations constitute a major problem for the cattle industry in tropical and subtropical regions of the world. Traditional control methods have been only partially successful, hampered by the selection of chemical-resistant tick populations. The Boophilus microplus Bm86 protein was isolated from tick gut epithelial cells and shown to induce a protective response against tick infestations in vaccinated cattle. Vaccine preparations including the recombinant Bm86 are used to control cattle tick infestations in the field as an alternative measure to reduce the losses produced by this ectoparasite. The principle for the immunological control of tick infestations relies on a polyclonal antibody response against the target antigen and, therefore, should be difficult to select for tick-resistant populations. However, sequence variations in the Bm86 locus, among other factors, could affect the effectiveness of Bm86-containing vaccines. In the present study we have addressed this issue, employing data obtained with B. microplus strains from Australia, Mexico, Cuba, Argentina and Venezuela. The results showed a tendency in the inverse correlation between the efficacy of the vaccination with Bm86 and the sequence variations in the Bm86 locus (R2 = 0.7). The mutation fixation index in the Bm86 locus was calculated and shown to be between 0.02 and 0.1 amino acids per year. Possible implications of these findings for the immunoprotection of cattle against tick infestations employing the Bm86 antigen are discussed. PMID:10668863

  18. Avaliação in vitro de uma cepa de campo de Boophilus microplus (Acari : Ixodidae resistente à amitraz

    Directory of Open Access Journals (Sweden)

    Santamaría Vargas Minerva

    2003-01-01

    Full Text Available O uso dos acaricidas químicos ainda se constitui no principal instrumento de controle do carrapato bovino Boophilus microplus. No sul do Brasil, o amitraz aplicado por imersão e aspersão é o ingrediente ativo mais utilizado, nos últimos anos, contra as cepas de carrapatos resistentes aos organofosforados (OF e piretróides sintéticos (PS. Em conseqüência, torna-se importante a realização de investigações que possam contribuir para prolongar a vida útil desse ixodicida. No presente estudo, foi analisado o comportamento toxicológico de uma cepa de B. microplus colhida na localidade de Alegrete, Rio Grande do Sul, usando-se químicos da família dos OF, PS, misturas OF/PS, além do amitraz. Os resultados indicaram que a cepa denominada "Santa Luiza" apresentou fatores de resistência (FR que variaram entre 2,3 e 3,95 para OF, 23,3 e 147,56 para PS e de 3,76 a 21.57 para amitraz em testes realizados com larvas de carrapatos. A caracterização e purificação de uma cepa de B. microplus resistente ao amitraz permitem seu uso como cepa de referência para a avaliação biológica de ixodicidas alternativos, além de padronizar e validar métodos de diagnósticos toxicológicos que possam detectar resistência frente a esse acaricida.

  19. Integrated control of acaricide-resistant Boophilus microplus populations on grazing cattle in Mexico using vaccination with Gavac and amidine treatments.

    Science.gov (United States)

    Redondo, M; Fragoso, H; Ortíz, M; Montero, C; Lona, J; Medellín, J A; Fría, R; Hernández, V; Franco, R; Machado, H; Rodríguez, M; de la Fuente, J

    1999-10-01

    Throughout most of the twentieth century, tick infestations on cattle have been controlled with chemical acaricides, typically administered by dipping or spraying. This approach can cause environmental and residue problems and has created a high incidence of acaricide resistance within tick populations in the field. Recently we developed a vaccine against Boophilus microplus employing a recombinant Bm86 antigen preparation (Gavac), (Heber Biotec S.A., Havana, Cuba) which has been shown to induce a protective response in vaccinated animals. Here we show for the first time under field conditions a near 100% control of B. microplus populations resistant to pyrethroids and organophosphates, by an integrated system employing vaccination with Gavac and amidine treatments. This method effectively controls tick infestations while reducing the number of chemical acaricide treatments and consequently the rise of B. microplus populations resistant to chemical acaricides. PMID:10581714

  20. Invitro acaricidal activity of ethnoveterinary plants and green synthesis of zinc oxide nanoparticles against Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Banumathi, Balan; Malaikozhundan, Balasubramanian; Vaseeharan, Baskaralingam

    2016-01-30

    The present study was designed to investigate the invitro acaricidal effects of seven ethnoveterinary plants, zinc acetate and green synthesized zinc oxide nanoparticles against the Southern cattle tick, Rhipicephalus (Boophilus) microplus. The selected ethnoveterinary plants were extracted using ethanol and aqueous (water) solvents at 0.02mg/ml and 0.04mg/ml concentrations. Of these seven plants, Lobelia leschenaultiana showed the highest percentage of tick mortality. The ethanol extracts of L. leschenaultiana showed 93.33% mortality at 0.04mg/ml and its LC50 was 0.05mg/ml. However, zinc acetate exhibited 70% mortality at 0.04mg/ml (LC50: 0.0192mg/ml). Further, we synthesized ZnO nanoparticle using the leaf extracts of L. leschenaultiana and zinc acetate as the precursor material to control R. (B.) microplus. The structural characterization of the synthesized ZnO nanoparticles (Ll-ZnO NPs) was performed by UV-vis spectroscopy, X-ray diffraction (XRD), Fourier transform infrared (FTIR) spectroscopy, scanning electron microscopy (SEM) and transmission electron microsopy (TEM). UV-vis spectra showed the absorption band at 383nm. XRD analysis clearly showed the crystalline nature of Ll-ZnO NPs with various Bragg's reflection peaks at 100, 002, 101, 102, 110, 103, 200, 201 and 202 planes. FTIR analysis showed the possible functional groups of Ll-ZnO NPs with strong band at 3420.63 and 2922.48cm(-1). SEM and TEM analysis revealed that the Ll-ZnO NPs were spherical and hexagonal in shape with particle size ranging between 20 and 65nm. The mortality of R. (B.) microplus after treatment with Ll-ZnO NPs was 35, 57.5 and 82.5% at 0.001, 0.002 and 0.004mg/ml. On the otherhand, 100% mortality of R. (B.) microplus was observed at 0.008mg/ml (LC50: 0.0017mg/ml). The results indicated that the Ll-ZnO NPs have good acaricidal properties compared to L. leschenaultiana leaf extract and zinc acetate. PMID:26801601

  1. Resistance to cypermethrin and amitraz in Rhipicephalus (Boophilus microplus on the Santa Catarina Plateau, Brazil Situação da resistência do Rhipicephalus (Boophilus microplus à cipermetrina e amitraz no Planalto Catarinense, Brasil

    Directory of Open Access Journals (Sweden)

    Luana Paula Haubold Neis Veiga

    2012-06-01

    Full Text Available With the objective of evaluating Rhipicephalus (Boophilus microplus resistance to cipermetrina and amitraz, were collected engorged tick females from cattle on 20 farms on the Santa Catarina Plateau, in southern Brazil, between January of 2004 and May of 2006. Were also received 20 groups of engorged R. (B. microplus females, collected by cattle farmers requesting acaricidal efficacy (AE testing. Were performed in vitro tests, which consisted of immersing engorged females in cypermethrin (0.015% and in amitraz (0.025%. An AE >95% was considered indicative of effectiveness. Of the 20 collected groups, 18 (90% showed cypermethrin resistance and 1 (5% showed amitraz resistance. Of the 20 received groups, 19 (95% showed cypermethrin resistance and 2 (10% showed amitraz resistance. The AE of cypermethrin was found to be >95%, 85-94%, and 55-64%, respectively, in 4 (57.1%, 2 (28.6%, and 1 (14.3% of 7 reference groups, collected in the 1997-2001 period. The AE of amitraz was >95% in all of those groups. Among the groups of specimens received for analysis in that period, the AE of amitraz was >95% in 6 (85.71% and 75-84% in 1 (14.28%. R. (B. microplus resistance to acaricides is increasing on the Santa Catarina Plateau.Com os objetivos de avaliar a resistência do Rhipicephalus (Boophilus microplus à cipermetrina e ao amitraz no Planalto Catarinense, no período de janeiro de 2004 a maio de 2006, foram coletadas teleóginas em bovinos de 20 propriedades onde os produtores autorizaram a coleta (amostras por conveniência e recebidas teleóginas de mais 20 propriedades com objetivo de diagnóstico de eficácia. Os testes in vitro foram realizados por imersão de teleóginas em cipermetrina (0,015% e amitraz (0,025%. Considerando a eficácia igual ou superior a 95%, das 20 propriedades amostradas, 18 (90% apresentaram resistência à cipermetrina e uma (5% ao amitraz. Das 20 propriedades com teleóginas para diagnóstico, 19 (95% apresentaram resist

  2. Rhipicephalus (Boophilus microplus: expression and characterization of Bm86-CG in Pichia pastoris Rhipicephalus (Boophilus microplus: expressão e caracterização da Bm86-CG em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Rodrigo Casquero Cunha

    2011-06-01

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (GavacTM and TickGardPLUS that have been developed against cattle ticks. The subcloning was done in the pPIC9 expression vector, for transformation in the yeast Pichia pastoris. This protein was characterized by expression of the recombinant Mut+ strain, which expressed greater quantities of protein. The expressed protein (rBm86-CG was recognized in the Western-blot assay using anti-Gavac, anti-TickGard, anti-larval extract and anti-rBm86-CG polyclonal sera. The serum produced in cattle vaccinated with the antigen CG rBm86 presented high antibody titers and recognized the native protein. The rBm86-GC has potential relevance as an immunogen for vaccine formulation against cattle ticks.O carrapato-do-boi Rhipicephalus (Boophilus microplus é responsável por grandes perdas econômicas. Seu controle é principalmente químico e apresenta limitações quanto ao desenvolvimento de resistência aos princípios ativos. As vacinas podem auxiliar no controle deste parasita diminuindo as aplicações de carrapaticidas. Considerando isso, foi realizada a subclonagem do gene da proteína Bm86-CG, proteína homologa a que atualmente é a base das vacinas desenvolvidas (GavacTM e TickGardPLUS contra o carrapato-do-boi, no vetor de expressão pPIC9, para ser transformado em levedura, Pichia pastoris. Esta proteína foi caracterizada pela expressão da cepa recombinante Mut+ que expressou maior quantidade de proteína. A proteína expressa, rBm86-CG, foi reconhecida no ensaio de Western-blot pelos soros policlonais anti-Gavac, anti-TickGard, anti

  3. Extratos de plantas no controle de Rhipicephalus (Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae em laboratório Plant extracts in control of Rhipicephalus (Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae in laboratory

    Directory of Open Access Journals (Sweden)

    Sônia Maria Forti Broglio-Micheletti

    2009-12-01

    Full Text Available Extratos vegetais foram estudados com o objetivo de avaliar suas eficiências no controle de Rhipicephalus (Boophilus microplus (Canestrini, 1887 em laboratório. Fêmeas ingurgitadas de carrapato foram coletadas de bovinos e mantidas em placas de Petri. Foram utilizados extratos orgânicos alcoólicos 2% (peso/volume de sementes de Annona muricata L. (Annonaceae (graviola; flores de Syzygium malaccensis (L. (Myrtaceae (jambo; folhas de Cymbopogon citratus (DC. Stapf (Poaceae (capim-santo; folhas de Azadirachta indica A. Juss (Meliaceae (nim; e extrato hexânico na mesma concentração de A. indica (sementes. Os grupos-controle foram compostos por fêmeas sem tratamento e fêmeas tratadas com água destilada e esterilizada e dimetilsulfóxido (DMSO a uma concentração de 1%. O extrato de A. muricata apresentou o maior poder acaricida, com eficácia de 100%, seguido dos extratos de S. malaccensis (75 e 59,24% e A. indica (65 e 38,49%. Houve 100% de redução na eclosão das larvas quando se utilizou o extrato de sementes de A. muricata.Plant extracts were studied to evaluate its efficiency in the control of Rhipicephalus (Boophilus microplus (Canestrini, 1887 in laboratory. Engorged female ticks were collected from the cattle, kept in Petri dishes. Organic alcoholic extracts 2% (weight/volume were used: seeds of Annona muricata L. (Annonaceae (soursop; flowers of Syzygium malaccensis (L. (Myrtaceae (iamb, leaves of Cymbopogon citratus (DC. Stapf (Poaceae (holy grass, leaves of Azadirachta indica A. Juss (Meliaceae (neem and hexane extract 2% (weight/volume of A. indica (seeds. The control groups consisted of untreated females and females treated with distilled water and sterile and dimethylsulfoxide (DMSO a concentration of 1%. The extract of A. muricata (seed had the highest mortality with acaricide activity and 100% efficacy followed by extracts of S. malaccensis (75 and 59.24% and A. indica (65 and 38.49%. The seed extract of A. muricata

  4. Use of biotherapic in the control of the natural infestation by Boophilus microplus: pilot study Uso de bioterápico en el control de la infestación natural por Boophilus microplus: estudio piloto

    OpenAIRE

    Laerte Francisco Filippsen; José Luiz Moletta; Nilceu Lemos Silva; Alessandro Pelegrine Minho

    2008-01-01

    In the control of tick-borne disease (TBD), resistance to chemical products has been reported and a concern with the preservation of the environment requires alternative procedures to control infestation by Boophilus microplus worldwide. The use of biotherapic preparations is one of such alternatives. The aim of this study was to evaluate the effects of a biotherapic mixture including B. microplus in naturally infested cattle. 27 animals were divided in 3 groups (n=9): I – control, re...

  5. The Rhipicephalus (Boophilus microplus Bm86 gene plays a critical role in the fitness of ticks fed on cattle during acute Babesia bovis infection

    Directory of Open Access Journals (Sweden)

    Knowles Donald P

    2010-11-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus is an economically important tick of cattle involved in the transmission of Babesia bovis, the etiological agent of bovine babesiosis. Commercial anti-tick vaccines based on the R. microplus Bm86 glycoprotein have shown some effect in controlling tick infestation; however their efficacy as a stand-alone solution for tick control has been questioned. Understanding the role of the Bm86 gene product in tick biology is critical to identifying additional methods to utilize Bm86 to reduce R. microplus infestation and babesia transmission. Additionally, the role played by Bm86 in R. microplus fitness during B. bovis infection is unknown. Results Here we describe in two independent experiments that RNA interference-mediated silencing of Bm86 decreased the fitness of R. microplus females fed on cattle during acute B. bovis infection. Notably, Bm86 silencing decreased the number and survival of engorged females, and decreased the weight of egg masses. However, gene silencing had no significant effect on the efficiency of transovarial transmission of B. bovis from surviving female ticks to their larval offspring. The results also show that Bm86 is expressed, in addition to gut cells, in larvae, nymphs, adult males and ovaries of partially engorged adult R. microplus females, and its expression was significantly down-regulated in ovaries of ticks fed on B. bovis-infected cattle. Conclusion The R. microplus Bm86 gene plays a critical role during tick feeding and after repletion during blood digestion in ticks fed on cattle during acute B. bovis infection. Therefore, the data indirectly support the rationale for using Bm86-based vaccines, perhaps in combination with acaricides, to control tick infestation particularly in B. bovis endemic areas.

  6. Transovarial Transmission Efficiency of Babesia bovis Tick Stages Acquired by Rhipicephalus (Boophilus) microplus during Acute Infection

    Science.gov (United States)

    The protozoan parasite Babesia bovis, a reemerging threat to U.S. cattle, is acquired by adult female ticks of the subgenus Boophilus, and is transovarially transmitted as the kinete stage to developing larval offspring. Sporozoites develop within larvae and are transmitted during larval feeding on ...

  7. New species of Ehrlichia isolated from Rhipicephalus (Boophilus) microplus shows an ortholog of the E. canis major immunogenic glycoprotein gp36 with a new sequence of tandem repeats

    OpenAIRE

    Cruz Alejandro Cabezas; Zweygarth Erich; Ribeiro Mucio Flavio Barbosa; da Silveira Julia Angelica Gonçalves; de la Fuente Jose; Grubhoffer Libor; Valdés James J; Passos Lygia Maria Friche

    2012-01-01

    Abstract Background Ehrlichia species are the etiological agents of emerging and life-threatening tick-borne human zoonoses that inflict serious and fatal infections in companion animals and livestock. The aim of this paper was to phylogeneticaly characterise a new species of Ehrlichia isolated from Rhipicephalus (Boophilus) microplus from Minas Gerais, Brazil. Methods The agent was isolated from the hemolymph of Rhipicephalus (B.) microplus engorged females that had been collected from natur...

  8. CattleTickBase: An integrated Internet-based bioinformatics resource for Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    The Rhipicephalus microplus genome is large and complex in structure, making a genome sequence difficult to assemble and costly to resource the required bioinformatics. In light of this, a consortium of international collaborators was formed to pool resources to begin sequencing this genome. We have...

  9. Rhipicephalus (Boophilus) microplus strain Deutsch, whole genome shotgun sequencing project first submission of genome sequence

    Science.gov (United States)

    The size and repetitive nature of the Rhipicephalus microplus genome makes obtaining a full genome sequence difficult. Cot filtration/selection techniques were used to reduce the repetitive fraction of the tick genome and enrich for the fraction of DNA with gene-containing regions. The Cot-selected ...

  10. Acaricidal activity of leaf extracts of Dalbergia sissoo Roxb. (Fabaceae) against synthetic pyrethroid resistant Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Singh, Nirbhay Kumar; Jyoti; Vemu, Bhaskar; Prerna, Mranalini; Singh, Harkirat; Dumka, V K; Sharma, S K

    2016-06-01

    Resistance status of Rhipicephalus (Boophilus) microplus against synthetic pyrethroids was assessed by larval packet test which revealed level I and II resistance against cypermethrin and deltamethrin, respectively. Adult immersion test was employed to study the acaricidal activity of leaf extracts of Dalbergia sissoo (sheesham) against these ticks. Mortality and fecundity of ticks exposed to sheesham leaf aqueous (SLA) and ethanolic (SLE) extracts were evaluated at concentrations of 0.625, 1.25, 2.5, 5.0 and 10.0% and controls (distilled water and 10% ethanol). Higher acaricidal activity was recorded in SLA with a lower LC50 (95% CL) value of 1.58% (0.92-2.71%) than SLE [5.25% (4.91-5.63%)]. A significant decrease in egg mass weight and reproductive index was recorded in treated ticks along with an increase in percent inhibition of oviposition. A complete inhibition of hatching was recorded in eggs laid by ticks treated with higher concentrations of SLA, whereas, SLE exhibited no effect on hatching percentage. PMID:27234528

  11. Breeding for resistance to Boophilus microplus in Australian Illawarra Shorthorn and Brahman x Australian Illawarra Shorthorn cattle.

    Science.gov (United States)

    Utech, K B; Wharton, R H

    1982-02-01

    Breeding for resistance to the cattle tick Boophilus microplus was undertaken in a herd of Australian Illawarra Shorthorn (AIS) cattle from 1961 to 1978 and in a herd of Braham x AIS cattle from 1970 to 1979. Breeder cows and their progeny were assessed for tick resistance during October to January. Resistance levels were determined as the average percentage mortality of female ticks from two artificial infestations with cohorts of c 20,000 larvae. Resistance increased from 89.2% to 99% in the AIS breeding herd, as a result of the yearly introductions of more resistant individuals and culling of less resistant ones. Concurrently resistance in the AIS progeny increased from 93.7% to 97.7%, thus demonstrating that the selection and breeding of the cows and bulls resulted in genetic improvement in the resistance of the progeny. Milk production tests on heifers from the selected AIS herd during 1975 to 79 indicated that selection for tick resistance did not select against milk production. Resistance of the Brahman x AIS increased from 98.4% to 99.3% in the breeding herd and from 97.6% to 99.6% in the progeny. Female calves of both breeds were more resistant than males. PMID:7082236

  12. Alterations in the oxidative metabolism of Rhipicephalus (Boophilus) microplus ticks in response to exposure to the insect growth regulator fluazuron.

    Science.gov (United States)

    Gaudêncio, Fabrício Nascimento; Tunholi-Alves, Vinícius Menezes; Lima, Mariana Gomes; Gôlo, Patrícia Silva; Angelo, Isabele da Costa; Castro, Rosane Nora; Fonseca, Adivaldo Henrique da; Scott, Fabio Barbour; Pinheiro, Jairo

    2016-03-01

    Aiming to characterize the potential off-target effects of fluazuron on ticks, biochemical analyses were conducted to evaluate changes in the carbohydrate metabolism of Rhipicephalus (Boophilus) microplus ticks after exposure to fluazuron. Hemolymph and fat body were collected from female ticks before and after (4, 8 and 15 days) exposure to fluazuron. Spectrophotometric analyses were done to quantify glucose concentration and lactate dehydrogenase (LDH) activity in the hemolymph and the concentration of glycogen in the tick's fat body. High Performance Liquid Chromatography (HPLC) was employed to determine the concentration of carboxylic acids in the hemolymph and to evaluate changes in intermediary metabolic processes requiring oxygen consumption. Increases in the levels of LDH activity and lactic acid concentration indicated that fluazuron enhanced fermentative metabolism in ticks. Exposure to fluazuron was also found to increase glucose concentrations in the hemolymph over time, although no significant differences were noted daily. In addition to expanding the body of knowledge about the mode of action of fluazuron, investigations into these mechanisms may also be useful in discovering new and as yet unexplored secondary effects. PMID:26982563

  13. Evaluation of Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) resistance to different acaricide formulations using samples from Brazilian properties.

    Science.gov (United States)

    Higa, Leandro de Oliveira Souza; Garcia, Marcos Valério; Barros, Jacqueline Cavalcante; Koller, Wilson Werner; Andreotti, Renato

    2016-06-01

    The Rhipicephalus (Boophilus) microplus tick is responsible for considerable economic losses in Brazil, causing leather damage, weight loss and reduced milk production in cattle and results in the transmission of pathogens. Currently, the main method for controlling this tick is using acaricides, but their indiscriminate use is one of the major causes of resistance dissemination. In this study, the adult immersion test (AIT) was used to evaluate resistance in ticks from 28 properties located in five different states (Mato Grosso do Sul, Mato Grosso, Ceará, São Paulo, e Minas Gerais) and the Distrito Federal (DF) of Brazil. The resistance was found in 47.64% of the repetitions demonstrating an efficacy of less than 90% in various locations throughout the country. The larvae packet test was used to evaluate samples from ten properties in four states (Mato Grosso do Sul, Mato Grosso, Minas Gerais and Espírito Santo). Spray products belonging to the main classes of acaricides, including combination formulations, were used in both types of test. New cases of resistance were found on properties within the states of Ceará, Espírito Santo and Mato Grosso, where such resistance was not previously reported. PMID:27334816

  14. Characterization of proteinases from the midgut of Rhipicephalus (Boophilus microplus involved in the generation of antimicrobial peptides

    Directory of Open Access Journals (Sweden)

    Craik Charles S

    2010-07-01

    Full Text Available Abstract Background Hemoglobin is a rich source of biologically active peptides, some of which are potent antimicrobials (hemocidins. A few hemocidins have been purified from the midgut contents of ticks. Nonetheless, how antimicrobials are generated in the tick midgut and their role in immunity is still poorly understood. Here we report, for the first time, the contribution of two midgut proteinases to the generation of hemocidins. Results An aspartic proteinase, designated BmAP, was isolated from the midgut of Rhipicephalus (Boophilus microplus using three chromatographic steps. Reverse transcription-quantitative polymerase chain reaction revealed that BmAP is restricted to the midgut. The other enzyme is a previously characterized midgut cathepsin L-like cysteine proteinase designated BmCL1. Substrate specificities of native BmAP and recombinant BmCL1 were mapped using a synthetic combinatorial peptide library and bovine hemoglobin. BmCL1 preferred substrates containing non-polar residues at P2 subsite and polar residues at P1, whereas BmAP hydrolysed substrates containing non-polar amino acids at P1 and P1'. Conclusions BmAP and BmCL1 generate hemocidins from hemoglobin alpha and beta chains in vitro. We postulate that hemocidins may be important for the control of tick pathogens and midgut flora.

  15. IN VITRO EFFICACY OF COMMERCIAL ACARICIDES INDICATE RESISTANT POPULATIONS OF RHIPICEPHALUS (BOOPHILUS MICROPLUS IN NORTHERN REGION OF MATO GROSSO

    Directory of Open Access Journals (Sweden)

    C. Eckstein

    2016-02-01

    Full Text Available Ticks are responsible for high economic and production losses on cattle production, and the use of acaricides is the main form of control applied. In recent decades, the resistance of ticks to acaricides was exacerbated by incorrect use of products, compromising the effectiveness of treatments. This study aimed to determine in vitro effectiveness of commercial acaricides in six populations of Rhipicephalus (Boophilus microplus in northern region of Mato Grosso. On average 100 engorged females were collected from each herd, which were selected and separated into homogeneous groups, sanitized, and immersed to acaricide diluted according to the manufacturer's statement, on sequence there was incubated. After the incubation was obtained from female reproductive efficiency and effectiveness of the tested acaricides. The association cypermethrin+ chlorpyrifos + citronellal showed satisfactory efficiency (> 95% in all the properties (mean 99.86% in properties, followed by trichlorfon (83.45%, amitraz (72.33%, neem oil (67.23% and cypermethrin (22.97%, which was not effective in any property. It indicates the use of the association cypermethrin +chlorpyrifos+ citronellal on evaluated properties for control of cattle tick effectively.

  16. Evaluation of Rhipicephalus (Boophilus microplus (Acari: Ixodidae resistance to different acaricide formulations using samples from Brazilian properties

    Directory of Open Access Journals (Sweden)

    Leandro de Oliveira Souza Higa

    2016-01-01

    Full Text Available Abstract The Rhipicephalus (Boophilus microplus tick is responsible for considerable economic losses in Brazil, causing leather damage, weight loss and reduced milk production in cattle and results in the transmission of pathogens. Currently, the main method for controlling this tick is using acaricides, but their indiscriminate use is one of the major causes of resistance dissemination. In this study, the adult immersion test (AIT was used to evaluate resistance in ticks from 28 properties located in five different states (Mato Grosso do Sul, Mato Grosso, Ceará, São Paulo, e Minas Gerais and the Distrito Federal (DF of Brazil. The resistance was found in 47.64% of the repetitions demonstrating an efficacy of less than 90% in various locations throughout the country. The larvae packet test was used to evaluate samples from ten properties in four states (Mato Grosso do Sul, Mato Grosso, Minas Gerais and Espírito Santo. Spray products belonging to the main classes of acaricides, including combination formulations, were used in both types of test. New cases of resistance were found on properties within the states of Ceará, Espírito Santo and Mato Grosso, where such resistance was not previously reported.

  17. Control of Boophilus microplus ticks in cattle calves by immunization with a recombinant Bm86 glucoprotein antigen preparation.

    Science.gov (United States)

    Khalaf-Allah, S S

    1999-06-01

    Forty Egyptian native cattle calves of 4-6 months old randomly allocated into two groups of twenty animals each were used to assess the effect of immunization of animals with a recombinant Bm86 antigen derived from Boophilus microplus ticks on induction of immunity that could protect calves during tick season. The immunization protocol involved two injections administered intramuscularly, the first was applied with complete Freund's adjuvant and the second was given with incomplete Freund's adjuvant two months later. Control calves were given saline plus adjuvant. Immunization reduced the number of adult ticks developing from a subsequent challenge infestation by 78% in immunized calves. Vaccination also, significantly reduced the weight of adult ticks in immunized calves (30.51%). The results of skin delayed hypersensitivity reaction revealed that the diameter of sites injected with the recombinant Bm86 antigen was significantly larger in immunized calves than those in controls. Analysis of the immune response indicated that there was a significant increase in the level of IgG and IgA antibodies in serum of immunized calves and protection from reinfestation was correlated with the levels of circulating antibodies. PMID:10422372

  18. Field studies and cost-effectiveness analysis of vaccination with Gavac against the cattle tick Boophilus microplus.

    Science.gov (United States)

    de la Fuente, J; Rodríguez, M; Redondo, M; Montero, C; García-García, J C; Méndez, L; Serrano, E; Valdés, M; Enriquez, A; Canales, M; Ramos, E; Boué, O; Machado, H; Lleonart, R; de Armas, C A; Rey, S; Rodríguez, J L; Artiles, M; García, L

    1998-02-01

    The control of tick infestations and the transmission of tick-borne diseases remains a challenge for the cattle industry in tropical and subtropical areas of the world. Traditional control methods have been only partially successful and the parasites continue to result in significant losses for the cattle industry. Recently, vaccines containing the recombinant Boophilus microplus gut antigen Bm86 have been developed. These vaccines have been shown to control tick infestations in the field. However, extensive field studies investigating the efficacy and cost-effectiveness of vaccination have not been reported and are needed to appraise the effect of this new approach for tick control. Here is reported the results of the application of Gavac in a field trial including more than 260,000 animals in Cuba. In this study the correlation between the antibody response to vaccination and the effect on ticks fertility is determined. Physiological status of the animals was found to affect the primary response to vaccination but not the antibody titers after revaccination. A cost-effectiveness analysis showed a 60% reduction in the number acaricide treatments, together with the control of tick infestations and transmission of babesiosis, which resulted in savings of $23.4 animal-1 year-1. These results clearly demonstrate the advantage of vaccination and support the application of Gavac for tick control. PMID:9607057

  19. Simulation of control strategies for the cattle tick Boophilus microplus employing vaccination with a recombinant Bm86 antigen preparation.

    Science.gov (United States)

    Labarta, V; Rodríguez, M; Penichet, M; Lleonart, R; Luaces, L L; de la Fuente, J

    1996-05-01

    Current strategies for the control of the cattle tick Boophilus microplus include the use of chemicals as the principal control method. These methods, however, have met with partially successful results. The recent development of immunological methods for the control of the cattle tick has opened new possibilities for the design of control strategies. Employing the results obtained by us in experiments testing the effect of vaccination with the recombinant vaccine, Gavac (Heber Biotec S.A.), on tick populations, we have developed a model to evaluate, through a computer program, the efficacy of the vaccine as a control method. The action of the vaccine on the control of tick populations was simulated and the specific serum antibody titers required to decrease the tick population in the field were calculated. The specific serum antibody titer required to decrease the tick population in the field after the first vaccination scheme was found to be > or = 57,200 and the antibody titer required to maintain this effect when the vaccine is already acting and after successive revaccinations was found to be > or = 27,500. Considerations about revaccination schemes and combination between vaccination and acaricide treatments as possible control strategies are discussed. PMID:8792587

  20. Abordagem sobre o controle do carrapato Rhipicephalus (Boophilus microplus no sul do Rio Grande do Sul Studies of the management of the tick Rhipicephalus (Boophilus microplus in southern Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Tânia Regina B. Santos

    2009-01-01

    Full Text Available Na região sul do Rio Grande do Sul a infestação dos bovinos por Rhipicephalus (Boophilus microplus ocorre, principalmente, entre os meses de outubro e abril, devido às condições climáticas. Além do conhecimento do ciclo biológico desse parasito, também é fundamental conhecer a epidemiologia, para estabelecer estratégias de controle. No Rio Grande do Sul, e também no Brasil, existem poucos estudos epidemiológicos a respeito da resistência aos acaricidas. Além disso, a grande área geográfica e a deficiência estrutural quanto ao uso e acesso a bancos de dados dificultam a obtenção de dados confiáveis. O presente estudo teve como objetivo realizar um inquérito abordando a percepção dos produtores da região sul do Rio Grande do Sul, quanto à identificação de populações de R. (B. microplus difíceis de controlar com acaricidas e os fatores de risco para a seleção de populações de carrapatos resistentes. Para execução do trabalho foram coletados dados sobre o controle do carrapato de bovinos de corte, em 85 propriedades de sete municípios, localizados na região sul do Estado. Os resultados revelaram a existência de associação positiva entre a dificuldade de controlar o carrapato com os acaricidas e o grau de instrução do proprietário (até o ensino fundamental com OR=3,67 e p=0,01 e o número de aplicação de carrapaticida por ano (superior a 4 com OR=4,05 e p=0,006. Esses resultados indicam também que propriedades com mais de 100 bovinos de corte em criação extensiva, na região sul do rio Grande do Sul apresentam características que podem contribuir para uma maior vida útil dos carrapaticidas do que as verificadas em outras regiões do País.In the southern region of Rio Grande do Sul, cattle become infested with Rhipicephalus (B. microplus mainly between October and April due to the climatic conditions. In addition to knowing its life cycle, knowledge of parasite's epidemiology is essential to

  1. Synthetic vaccine (SBm7462) against the cattle tick Rhipicephalus (Boophilus) microplus: preservation of immunogenic determinants in different strains from South America.

    Science.gov (United States)

    Peconick, A P; Sossai, S; Girão, F A; Rodrigues, M Q R B; Souza E Silva, C H; Guzman Q, F; Patarroyo V, A M; Vargas, M I; Patarroyo, J H

    2008-05-01

    The synthetic vaccine SBm7462 is based on three immunogenic epitopes (4822, 4823 and 4824) contained within protein Bm86 derived from the Australian Yeerongpilly strain of the tick Rhipicephalus (Boophilus) microplus. Twenty strains of the tick originating from Brazil, Argentina, Colombia and Uruguay were analysed in order to identify differences compared with sequences present in components of vaccine SBm7462. For each parasite population, three cDNA fragments containing the nucleotides coding for the epitopes 4822, 4824 and 4823 were sequenced, and the amino acid sequences were deduced and compared with those of the homologous bm86 gene. The results indicate that the epitope sequences of vaccine SBm7462 are conserved in the South American populations of the tick. The conservation of such sequences is very important for the immunological response of different populations of R. (B.) microplus. PMID:18226809

  2. Dinâmica populacional de Boophilus microplus (Canestrini, 1887) em bovinos leiteiros mantidos em manejo de pastejo rotativo de capim-elefante

    OpenAIRE

    Kasai N.; Labruna M.B.; Pires A.V.; Louvandini H.; Abdalla A.L.; Gennari S.G.

    2000-01-01

    De maio de 1996 a abril de 1998, avaliou-se a dinâmica do parasitismo pelo Boophilus microplus em 20 novilhas mestiças, submetidas ao manejo de rotação em piquetes de capim-elefante. Os animais, pesados a cada seis meses, foram distribuídos em dois grupos de 10, sendo realizados tratamentos acaricidas em um deles (grupo tratado). As curvas de infestação nos grupos controle e tratado apresentaram padrões semelhantes, com picos de parasitismo ocorrendo na mesma época. A menor carga parasitária ...

  3. Detección inmunoquímica de esterasas en dos cepas de la garrapata boophilus microplus (acarii: ixodidae) resistentes a ixodicidas

    OpenAIRE

    Rodrigo Rosario Cruz; Zeferino García Vázquez; John George Edward

    2000-01-01

    Se encontró una esterasa en Boophilus microplus con actividad incrementada, en dos cepas de garrapatas resistentes a acaricidas de la familia de los piretroides y organofosforados, que fue detectada después de ser separadas electroforéticamente. La proteína fue separada y utilizada en la preparación de un anticuerpo policlonal monoespecífico. La especificidad de este anticuerpo fue probada mediante un ensayo de inmunoelectrotransferencia, en extractos totales de dos cepas de garrapatas resist...

  4. Boophilus microplus: ASPECTOS BIOLÓGICOS Y MOLECULARES DE LA RESISTENCIA A LOS ACARICIDAS Y SU IMPACTO EN LA SALUD ANIMAL

    OpenAIRE

    Delia Inés Domínguez-García; Rodrigo Rosario-Cruz; Consuelo Almazán-García; Jorge Alberto Saltijeral Oaxaca; José de la Fuente

    2010-01-01

    La aplicación de ixodicidas durante mucho tiempo ha sido la alternativa de elección para el control de la garrapata Boophilus microplus, sin embargo, actualmente el uso de los ixodicidas tiene una eficacia limitada en la reducción de las infestaciones debido al desarrollo de poblaciones de garrapatas resistes. La resistencia a ixodicidas es un problema creciente que necesita ser atendido, por que en este momento está afectando la competitividad de la ganadería y la economía de miles de produc...

  5. Utilización del Boophilus microplus como remedio isopático en el control del ectoparásito en el Municipio de Aguazul (Casanare)

    OpenAIRE

    Francisco Javier Niño Murcia; Edwin Gustavo Morales Arguello

    2005-01-01

    En este estudio se demostró la efectividad de un remedio isopático vía oral, para el control de la garrapata Boophilus microplus, inocuo para los animales, medio ambiente y el hombre, evitando residuos de plaguicidas en el producto final. La investigación se realizó en una finca ubicada en el municipio de Aguazul (Casanare); localizada a los 05°10’23’’ de latitud norte y 72°33’17’’ de longitud oeste desde Greenwich, altitud: 300 msnm, temperatura media: 27ÚC. Precipitación anual media: 2.441 ...

  6. Persistencia de la eficacia de dos lactonas macrocíclicas contra infestaciones naturales de Rhipicephalus (Boophilus) microplus en bovinos del trópico mexicano

    OpenAIRE

    Ronnie de Jesús Arieta-Román; Roger Iván Rodríguez-Vivas; José Alberto Rosado- Aguilara; Genny Trinidad Ramírez-Cruz; Gertrudis Basto-Estrella

    2010-01-01

    Se evaluó la persistencia de la eficacia de ivermectina-3.15% (IVM-3.15%) y moxidectina-10% (MOX-10%) contra infestaciones naturales de Rhipicephalus (Boophilus) microplus en bovinos del trópico mexicano. Para ello se utilizaron 33 bovinos hembras que fueron distribuidos en tres grupos (n=11) recibiendo los siguientes tratamientos: a) IVM-3.15% (0.63 mg/kg de peso vivo por vía subcutánea; b) MOX-10% (1 mg/kg de peso vivo por vía subcutánea); c) grupo testigo. El número de garrapatas adultas f...

  7. Control of ticks resistant to immunization with Bm86 in cattle vaccinated with the recombinant antigen Bm95 isolated from the cattle tick, Boophilus microplus.

    Science.gov (United States)

    García-García, J C; Montero, C; Redondo, M; Vargas, M; Canales, M; Boue, O; Rodríguez, M; Joglar, M; Machado, H; González, I L; Valdés, M; Méndez, L; de la Fuente, J

    2000-04-28

    The recombinant Bm86-containing vaccine Gavac(TM) against the cattle tick Boophilus microplus has proved its efficacy in a number of experiments, especially when combined with acaricides in an integrated manner. However, tick isolates such as the Argentinean strain A, show low susceptibility to this vaccine. In this paper we report on the isolation of the Bm95 gene from the B. microplus strain A, which was cloned and expressed in the yeast Pichia pastoris producing a glycosylated and particulated recombinant protein. This new antigen was effective against different tick strains in a pen trial, including the B. microplus strain A, resistant to vaccination with Bm86. A Bm95-based vaccine was used to protect cattle against tick infestations under production conditions, lowering the number of ticks on vaccinated animals and, therefore, reducing the frequency of acaricide treatments. The Bm95 antigen from strain A was able to protect against infestations with Bm86-sensitive and Bm86-resistant tick strains, thus suggesting that Bm95 could be a more universal antigen to protect cattle against infestations by B. microplus strains from different geographical areas. PMID:10717348

  8. Evolutionary conserved microRNAs are ubiquitously expressed compared to tick-specific miRNAs in the cattle tick Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Tateno Yoshio

    2011-06-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small non-coding RNAs that act as regulators of gene expression in eukaryotes modulating a large diversity of biological processes. The discovery of miRNAs has provided new opportunities to understand the biology of a number of species. The cattle tick, Rhipicephalus (Boophilus microplus, causes significant economic losses in cattle production worldwide and this drives us to further understand their biology so that effective control measures can be developed. To be able to provide new insights into the biology of cattle ticks and to expand the repertoire of tick miRNAs we utilized Illumina technology to sequence the small RNA transcriptomes derived from various life stages and selected organs of R. microplus. Results To discover and profile cattle tick miRNAs we employed two complementary approaches, one aiming to find evolutionary conserved miRNAs and another focused on the discovery of novel cattle-tick specific miRNAs. We found 51 evolutionary conserved R. microplus miRNA loci, with 36 of these previously found in the tick Ixodes scapularis. The majority of the R. microplus miRNAs are perfectly conserved throughout evolution with 11, 5 and 15 of these conserved since the Nephrozoan (640 MYA, Protostomian (620MYA and Arthropoda (540 MYA ancestor, respectively. We then employed a de novo computational screening for novel tick miRNAs using the draft genome of I. scapularis and genomic contigs of R. microplus as templates. This identified 36 novel R. microplus miRNA loci of which 12 were conserved in I. scapularis. Overall we found 87 R. microplus miRNA loci, of these 15 showed the expression of both miRNA and miRNA* sequences. R. microplus miRNAs showed a variety of expression profiles, with the evolutionary-conserved miRNAs mainly expressed in all life stages at various levels, while the expression of novel tick-specific miRNAs was mostly limited to particular life stages and/or tick organs. Conclusions

  9. Perceptions of milk producers from Divinópolis, Minas Gerais, regarding Rhipicephalus (Boophilus microplus control Percepção dos produtores de leite de Divinópolis, Minas Gerais, sobre o controle de Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães da Rocha

    2011-12-01

    Full Text Available Semi-systematized interviews were conducted with 100 dairy cattle producers in the municipality of Divinópolis, Minas Gerais, with the aim of ascertaining their perceptions regarding the importance of Rhipicephalus (Boophilus microplus and of combating it. Content analysis was performed and the frequency distribution of each of the variables was used to construct profiles of the producers interviewed. The production losses caused by ticks were perceived incompletely by the producers, who were unaware of the pathogen transmission caused by the parasite and the indirect losses through combating it, such as the cost of acaricide and labor. The combat operations were performed in a traditional manner, with an excessive number of inefficient treatments that aimed to control the level of infestation at that moment. The quality of the acaricide dipping/spraying applied was affected by the quality of the equipment used to apply the products, lack of knowledge of the mode of action of these products, lack of the specific information needed and lack of motivation caused by unawareness of the disadvantages of chemical combat. It was concluded that the lack of knowledge about combat methods and the acceptance of endemicity of the parasitosis were impediments to changing the realities encountered.Entrevistas semissistematizadas foram aplicadas a 100 produtores de bovinos leiteiros do município de Divinópolis, Minas Gerais, com o objetivo de verificar a sua percepção sobre a importância de Rhipicephalus (Boophilus microplus e seu combate. Foi feita "análise de conteúdo" e a distribuição de frequência de cada uma das variáveis para a construção de perfis dos produtores entrevistados. Os prejuízos causados à produção pelo carrapato são percebidos de forma incompleta pelos produtores, que ignoram a transmissão de patógenos pelo parasito e as perdas indiretas pelo combate, como o custo do carrapaticida e da mão de obra. O combate era feito

  10. Toxicological effects and resistance to pyrethroids in Boophilus microplus from Goiás, Brazil Efeitos toxicológicos e resistência a piretróides em Boophilus microplus de Goiás

    Directory of Open Access Journals (Sweden)

    F.F. Fernandes

    2001-10-01

    Full Text Available In order to monitor the susceptibility of Boophilus microplus to acaricides and improve control measures, the effects of cypermethrin, deltamethrin and permethrin on larvae obtained in the city of Goiânia in the Brazilian state of Goiás were studied. Although these pyrethroids are already sold as acaricides, their cost-benefit efficiency has been questioned. Fasting 14-21 day-old larvae were immersed in solutions of the acaricides under test, maintained at 27±1° C, and relative humidity over 80%, and observed under the stereoscope within an apparatus originally designed for studying the non-parasitic phase of the tick life cycle. The observed toxicological effects were: excitability, repetitive motion, decreased motor ability, detachment, paralysis, knock-down and cuticular proliferation of liquids and gases. The materials used in the manufacture of this apparatus consisted of disposable Petri dishes, "organza" cloth and paraffin, none of which are toxic to tick larvae. Mean death rates after 24h were 76.3%, 87.5%, 77.6%, 91.2%, 86.2% and 100% for 25 and 50ppm deltamethrin, 150 and 300ppm cypermethrin and 1250 and 2500ppm permethrin, respectively. The ticks were resistant to commercial concentrations of deltamethrin and cypermethrin. Only 2500ppm permethrin produced the mortality recommended by the Brazilian Ministry of Agriculture.Estudaram-se os efeitos de cipermetrina, deltametrina e permetrina sobre larvas de uma cepa de campo de Goiânia, com o objetivo de monitorar a susceptibilidade de Boophilus microplus para esses acaricidas e fomentar medidas de controle. Larvas em jejum com 14 a 21 dias, imersas em soluções desses piretróides, foram mantidas a 27±1°C e UR% > ou = 80% e observadas por 24h ao estereoscópio, contidas em dispositivo desenvolvido originalmente para estudos da fase não parasitária do ciclo evolutivo. O material utilizado em sua confecção, placa de petri descartável, tecido organza e parafina, não foi t

  11. Acaricide resistance of Rhipicephalus (Boophilus microplus in State of Mato Grosso do Sul, Brazil Resistência do Rhipicephalus (Boophilus microplus aos acaricidas no Estado de Mato Grosso do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Renato Andreotti

    2011-06-01

    Full Text Available This study was conducted to obtain an epidemiological view of acaricide resistance in populations of Rhipicephalus (Boophilus microplus in the State of Mato Grosso do Sul. Twenty-four tick samples were collected from municipalities in the State where farmers had reported concerns about resistance to or failure of tick control. These ticks were subjected to in vitro resistance detection assays using the adult immersion test (AIT. The efficacy of alpha-cypermethrin, cypermethrin and amitraz treatments on samples collected throughout the State was generally poor. AIT showed efficacy > 90% from the use of DDVP + chlorfenvinphos (20 out of 21 municipalities, dichlorvos + cypermethrin (10 out of 16 municipalities and cypermethrin + citronella + chlorpyrifos + piperonyl butoxide (20 out of 21 municipalities. PCR assays were used to detect the presence of pyrethroid resistance-associated sodium channel gene mutation. Larvae from three different populations that had previously been diagnosed as pyrethroid-resistant, through AIT, were evaluated. The PCR assays showed that the pyrethroid resistance-associated gene mutation was absent from these three populations. This study confirms that the emergence of resistance is a constant challenge for the livestock industry, and that development of resistance continues to be a major driver for new antiparasitic drugs to be developed.Este estudo foi realizado com o objetivo de se obter uma visão epidemiológica da resistência aos acaricidas nas populações de Rhipicephalus (Boophilus microplus no Estado de Mato Grosso do Sul. Vinte e quatro amostras de carrapatos foram coletadas em cidades do estado onde os fazendeiros relataram preocupação com resistência ou falha no controle dos carrapatos. Estes carrapatos foram submetidos a testes de detecção de resistência in vitro usando o teste de imersão de adultos (TIA. A eficácia do tratamento com alfa-cipermetrina, cipermetrina e amitraz foi geralmente pobre

  12. Rhipicephalus (Boophilus) microplus tick in vitro feeding methods for functional (dsRNA) and vaccine candidate (antibody) screening.

    Science.gov (United States)

    Lew-Tabor, Ala E; Bruyeres, Anthea G; Zhang, Bing; Rodriguez Valle, Manuel

    2014-09-01

    Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) ticks cause economic losses for cattle industries throughout tropical and subtropical regions of the world estimated at $US2.5 billion annually. Lack of access to efficacious long-lasting vaccination regimes and increases in tick acaricide resistance have led to the investigation of targets for the development of novel tick vaccines and treatments. In vitro tick feeding has been used for many tick species to study the effect of new acaricides on the transmission of tick-borne pathogens. Few studies have reported the use of in vitro feeding for functional genomic studies using RNA interference and/or the effect of specific anti-tick antibodies. In particular, in vitro feeding reports for the cattle tick are limited due to its relatively short hypostome. Previously published methods were further modified to broaden optimal tick sizes/weights, feeding sources including bovine and ovine serum, optimisation of commercially available blood anti-coagulant tubes, and IgG concentrations for effective antibody delivery. Ticks are fed overnight and monitored for ∼5-6 weeks to determine egg output and success of larval emergence using a humidified incubator. Lithium-heparin blood tubes provided the most reliable anti-coagulant for bovine blood feeding compared with commercial citrated (CPDA) and EDTA tubes. Although >30mg semi-engorged ticks fed more reliably, ticks as small as 15mg also fed to repletion to lay viable eggs. Ticks which gained less than ∼10mg during in vitro feeding typically did not lay eggs. One mg/ml IgG from Bm86-vaccinated cattle produced a potent anti-tick effect in vitro (83% efficacy) similar to that observed in vivo. Alternatively, feeding of dsRNA targeting Bm86 did not demonstrate anti-tick effects (11% efficacy) compared with the potent effects of ubiquitin dsRNA. This study optimises R. microplus tick in vitro feeding methods which support the development of cattle tick vaccines and

  13. Efecto ixodicida de los extractos etanólicos de algunas plantas sobre garrapatas Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Ángela Rodríguez S.

    2010-12-01

    Full Text Available Objetivo. Evaluar in vitro, el efecto ixodicida del extracto etanólico de cinco plantas; Brugmasia arborea, Sambucus nigra, Nicotiana tabacum, Bidens pilosa y Ambrosia cumanenses sobre garrapatas adultas de la especie Rhipicephalus (Boophilus microplus. Materiales y métodos. El extracto de cada planta fue obtenido mediante la técnica de lixiviación. Para las pruebas, se utilizaron garrapatas adultas de dos tamaños (pequeñas y medianas, que fueron expuestas a los extractos de cada planta, utilizando la técnica de inmersión de garrapatas adultas. A las 24 h de exposición, se realizó la lectura de mortalidad, donde se tomó como mínimo eficaz una mortalidad del 60%. Las pruebas iniciales se realizaron con extractos puros y cuando éstos mostraban eficacia se procedía a realizar diluciones crecientes, hasta encontrar la concentración mínima eficaz. Estas pruebas fueron realizadas en clima frio y cálido. Resultados. El extracto de N. tabacum, mostró efectividad en garrapata pequeña, hasta las diluciones 0.5:10 y 1:10 en clima frio y cálido, respectivamente y con 2.5:10 y 5:10 sobre garrapata mediana en clima frio y cálido, respectivamente; B. arbórea, mostró eficacia sobre garrapata pequeña hasta la dilución 7.5:10 en ambos climas; S. nigra y B. pilosa solo fueron eficaces en clima cálido sobre garrapatas pequeñas empleando extracto puro. A. cumanenses no fue eficaz en ninguna de las pruebas. Conclusiones. N. tabacum, mostró mayor eficacia y se observó que los mejores resultados se obtuvieron con las mayores concentraciones.

  14. Successful vaccination against Boophilus microplus and Babesia bovis using recombinat antigens

    Directory of Open Access Journals (Sweden)

    P. Willadsen

    1992-01-01

    Full Text Available Current methods for the control of the cattle tick Boophils microplus and the agent of bovine babesiosis, Babesia bovis are unsatisfactory. Effective immunological control of both parasites would have great advantages. However, naturally acquired immunity to the tick is generally unable to prevent serious production losses. A vaccine against the tick, based on a novel form of immunization, is being developed. A protective antigen has been isolated from the tick, characterized and produced as an effective, recombinant protein. A vaccine incorporating this antigen is currently undergoing field trials. In the Australian situation, improved tick control will probably increase endemic instability with respect to B. bovis. Fortunately, a trivalent, recombinant B. bovis vaccine has also been developed. This too is now undergoing pre-registration field trials.

  15. IN VITRO EFFECT OF THE ASSOCIATION OF CITRONELLA, SANTA MARIA HERB (Chenopodium ambrosioides AND QUASSIA TINCTURE ON CATTLE TICK Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Fernanda Carlini Cunha dos Santos

    2013-03-01

    Full Text Available The tick Rhipicephalus (Boophilus microplus is an ectoparasite which causes high financial losses to the production of Brazilian cattle. The control of this parasite is accomplished by the administration of chemical products, but they are not adequately used, leading to high costs and stimulating the selection of resistant parasites. Thus, the objective of this experiment was to assess the in vitro efficiency of different formulations containing an association of citronella (Cymbopogon nardus, Santa Maria herb (Chenopodium ambrosioides and quassia (Quassia amara tinctures on the bovine tick R. microplus. For this, engorged females of the parasite were submitted to the laboratory immersion test. The solutions containing all three plants were tested in different concentrations. Approximately 84% of the treatments presented efficiency equal or superior to 95%. The treatments with citronella in concentration equal or superior to 5% showed better results and the concentration of 10% showed maximum efficiency, independently of the concentrations of the other two plants. The high efficiency of the solutions was attributed mainly to the reduction of egg laying and hatching rate, and, in a minor scale, to death of the engorged females. It suggests that the phytotherapic solutions are able to induce alterations on the system and reproductive capacity of the females of R. microplus in in vitro tests, besides presenting a tickicide action.

  16. [Efficacy of extracts of plants in engorged females of Boophilus microplus from the mesoregion West of Maranhão, Brazil.].

    Science.gov (United States)

    Costa, Francisco B; Vasconcelos, Pádua Suely Da S; Silva, Ana Maria M; Brandão, Vivian M; Da Silva, Iran A; Teixeira, Whaubtyfran C; Guerra, Rita De Maria S N; Dos Santos, Ana Clara G

    2008-09-01

    The objective was to evaluate the efficacy of hydro-alcoholic extracts of nim and citronela at 20% and eucalipto at 10% in Boophilus microplus engorged females collected in cattle naturally infected from the mesoregion West of Maranhão. At the laboratory the females were separated, weighted and distributed in six groups of 10, in duplicate. Each group was immersed in 10mL of the solution of the extracts, for two minutes. In the nim and citronela extracts there was 32% e 17%, respectively, while larval emergence the eucalipto extracts demonstrated 96% of efficacy. In the groups treated by Cipermetrina + Clorpirifós + Citronetal and Deltametrina (positive controls) the mortality occurred after 48h of treatment, while the groups immersed in distilled water (negative control) showed 100% of eggs mass and larval emergence. According to the results, it can be concluded that the extract of eucalipto could be used as acaricide in the control of B. microplus females since it was efficient in vitro, however to nim and citronela showed not efficacy. B. microplus females were not resistant to the chemical compounds used in this experiment. PMID:20059822

  17. Selection of reference genes for quantitative RT-PCR studies in Rhipicephalus (Boophilus microplus and Rhipicephalus appendiculatus ticks and determination of the expression profile of Bm86

    Directory of Open Access Journals (Sweden)

    Jongejan Frans

    2009-12-01

    Full Text Available Abstract Background For accurate and reliable gene expression analysis, normalization of gene expression data against reference genes is essential. In most studies on ticks where (semi-quantitative RT-PCR is employed, normalization occurs with a single reference gene, usually β-actin, without validation of its presumed expression stability. The first goal of this study was to evaluate the expression stability of commonly used reference genes in Rhipicephalus appendiculatus and Rhipicephalus (Boophilus microplus ticks. To demonstrate the usefulness of these results, an unresolved issue in tick vaccine development was examined. Commercial vaccines against R. microplus were developed based on the recombinant antigen Bm86, but despite a high degree of sequence homology, these vaccines are not effective against R. appendiculatus. In fact, Bm86-based vaccines give better protection against some tick species with lower Bm86 sequence homology. One possible explanation is the variation in Bm86 expression levels between R. microplus and R. appendiculatus. The most stable reference genes were therefore used for normalization of the Bm86 expression profile in all life stages of both species to examine whether antigen abundance plays a role in Bm86 vaccine susceptibility. Results The transcription levels of nine potential reference genes: β-actin (ACTB, β-tubulin (BTUB, elongation factor 1α (ELF1A, glyceraldehyde 3-phosphate dehydrogenase (GAPDH, glutathione S-transferase (GST, H3 histone family 3A (H3F3A, cyclophilin (PPIA, ribosomal protein L4 (RPL4 and TATA box binding protein (TBP were measured in all life stages of R. microplus and R. appendiculatus. ELF1A was found to be the most stable expressed gene in both species following analysis by both geNorm and Normfinder software applications, GST showed the least stability. The expression profile of Bm86 in R. appendiculatus and R. microplus revealed a more continuous Bm86 antigen abundance in R

  18. Detección de resistencia a los acaricidas en la garrapata del ganado Boophilus microplus mediante análisis de zimogramas (Acaricide resistance detection in the cattle tick Boophilus microplus by zymograms analysis.

    Directory of Open Access Journals (Sweden)

    Miranda, Miranda, Estefan

    2005-11-01

    Full Text Available La identificación de resistencia a los productos acaricidas en la garrapata B. microplus, se hace mediante un complicado bioensayo, que requiere garrapatas de referencia y de campo cultivadas sobre bovinos vivos y restringidos durante semanas. Con el fin de evaluar una posible alternativa diagnóstica, se hicieron ensayos enzimáticos en geles de poliacrilamida-SDS, usando extractos de larvas de garrapatas provenientes de cuatro cepas de referencia con diferentes niveles de resistencia y susceptibilidad a productos acaricidas. Los ensayos que se diseñaron para detectar las enzimas esterasa, fosfodiesterasa, glutatión peroxidasa y catalasa, fueron procesados como zimogramas en imágenes digitalizadas, a partir de las cuales se obtuvieron sus respectivos densitogramas, valorando las movilidades electroforéticas relativas (Rf, así como las diferentes masas moleculares (MM en miles de Daltons (kDa y actividades enzimáticas específicas (AEE. Se identificó una elevada actividad de esterasa en posición Rf 0.52 con una MM de 47 kDa en las cepas resistentes, con un incremento en AEE del 317 % cuando se compara con las garrapatas susceptibles a los acaricidas. También se identificó una fosfodiesterasa en Rf. 0.1 con MM de 130 kDa presente en las cepas resistentes, con un incremento de AEE del 340% con respecto al nivel basal de la cepa susceptible. Se concluyó que estos ensayos enzimáticos pueden ser utilizados como indicadores de resistencia a los acaricidas en poblaciones de garrapatas aisladas de campo, constituyendo un procedimiento rápido, eficaz y económico, como alternativa al complicado bioensayo actualmente utilizado. Acaricide resistance detection in the cattle tick Boophilus microplus, is achieved by a complex bioassay which requires reference strains of ticks as well as field isolated ticks, cultured on living cattle restrained for weeks. In order to assess an alternate diagnostics procedure, enzymatic assays were performed on

  19. PI3K/PKB signaling in Rhipicephalus (Boophilus) microplus tick embryo cell line BME26

    International Nuclear Information System (INIS)

    Full text: Ticks are obligatory blood-sucking arthropods and important vectors of both human and animal diseases. In order to study the insulin triggered pathway and its possible roles during embryogenesis we are using a culture of embryonic Rhipicephalus (Boophilus) micro plus cells (BME26). Besides its metabolic role, insulin signaling pathway (ISP) is widely described as crucial for vertebrate and invertebrate embryogenesis and development. In such cascade Phosphatidylinositol 3-OH Kinase (PI3K) is hierarchically located upstream Protein Kinase B (PKB). Exogenous insulin is able to increase the expression level of PI3K's regulatory sub unity (p85), as determined by Real Time RT-PCR. In the presence of PI3K inhibitors (Wortmannin or LY294002) these effects were reversed. This correlates well with the activation of PKB by phosphorylation, as it appears to be PI3K-dependent. Additionally, PI3K inhibition increased the expression level of two insulin-regulated downstream targets from glycogen metabolism (GSK3b) and gluneogenesis (PEPCK) pathways. GSK3b inhibition by phosphorylation diminished in cells treated with PI3K inhibitors. These results strongly suggest the presence of an insulin sensitive PI3K-PKB axis in BME26 cells. The further study of PI3K and PKB activity in egg homogenates during embryogenesis may help us to understand the role of ISP for R. micro plus development

  20. PI3K/PKB signaling in Rhipicephalus (Boophilus) microplus tick embryo cell line BME26

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, L.; Fabres, A.; Logullo, C. [Universidade Estadual do Norte Fluminense Darcy Ribeiro (UENF), Campos dos Goytacazes, RJ (Brazil). Centro de Biociencias e Biotecnologia. Lab. de Quimica e Funcao de Proteinas e Peptideos (LQFPP)]. E-mail: leoabreu@uenf.br; Esteves, E.; Daffre, S. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Dept. de Bioquimica

    2008-07-01

    Full text: Ticks are obligatory blood-sucking arthropods and important vectors of both human and animal diseases. In order to study the insulin triggered pathway and its possible roles during embryogenesis we are using a culture of embryonic Rhipicephalus (Boophilus) micro plus cells (BME26). Besides its metabolic role, insulin signaling pathway (ISP) is widely described as crucial for vertebrate and invertebrate embryogenesis and development. In such cascade Phosphatidylinositol 3-OH Kinase (PI3K) is hierarchically located upstream Protein Kinase B (PKB). Exogenous insulin is able to increase the expression level of PI3K's regulatory sub unity (p85), as determined by Real Time RT-PCR. In the presence of PI3K inhibitors (Wortmannin or LY294002) these effects were reversed. This correlates well with the activation of PKB by phosphorylation, as it appears to be PI3K-dependent. Additionally, PI3K inhibition increased the expression level of two insulin-regulated downstream targets from glycogen metabolism (GSK3b) and gluneogenesis (PEPCK) pathways. GSK3b inhibition by phosphorylation diminished in cells treated with PI3K inhibitors. These results strongly suggest the presence of an insulin sensitive PI3K-PKB axis in BME26 cells. The further study of PI3K and PKB activity in egg homogenates during embryogenesis may help us to understand the role of ISP for R. micro plus development.

  1. Cutaneous hyperaemia elicited by larvae of the cattle tick, Boophilus microplus.

    Science.gov (United States)

    Hales, J R; Schleger, A V; Kemp, D H; Fawcett, A A

    1981-01-01

    The responses of skin capillary blood flow (BF) to infestation by larvae of B. microplus have been determined using radioactive microspheres. Larvae were placed in gauze-covered rings glued to the closely clipped skin. In pilot experiments on three Brahman-cross calves which had prior exposure to ticks, BF measurements at intervals up to 25 h post-infestation revealed a continuing increase. 'High' rates of infestation (5000 larvae per ring) elicited up to an 80-fold increase in BF. In four Australian Illawarra Shorthorn (AIS) calves with prior exposure to ticks, BF had increased by 0.5 h post-infestation, it reached a peak at 24 h, and fell markedly by 48 and 75 h. In contrast, two AIS calves without prior tick exposure showed no significant increase in BF until 24 h and this increase continued until observations were terminated at 72 h. BF in the neck area (normally favoured by ticks) increased most in calves of highest resistance to ticks, but the flank area (normally unfavoured) showed no consistent difference in BF response between animals of different tick resistance. It is concluded that skin capillary hyperaemia is triggered by the host's immune response to larval attachment. Within the relatively narrow range of tick resistance in the present animals, the degree of hyperaemia was directly related to level of resistance to the tick in skin regions normally favoured by ticks and therefore it may play a role in determining resistance to ticks. PMID:7259632

  2. Reassociation kinetics-based approach for partial genome sequencing of the cattle tick, Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Bellgard Matthew

    2010-06-01

    Full Text Available Abstract Background The size and repetitive nature of the Rhipicephalus microplus genome makes obtaining a full genome sequence fiscally and technically problematic. To selectively obtain gene-enriched regions of this tick's genome, Cot filtration was performed, and Cot-filtered DNA was sequenced via 454 FLX pyrosequencing. Results The sequenced Cot-filtered genomic DNA was assembled with an EST-based gene index of 14,586 unique entries where each EST served as a potential "seed" for scaffold formation. The new sequence assembly extended the lengths of 3,913 of the 14,586 gene index entries. Over half of the extensions corresponded to extensions of over 30 amino acids. To survey the repetitive elements in the tick genome, the complete sequences of five BAC clones were determined. Both Class I and II transposable elements were found. Comparison of the BAC and Cot filtration data indicates that Cot filtration was highly successful in filtering repetitive DNA out of the genomic DNA used in 454 sequencing. Conclusion Cot filtration is a very useful strategy to incorporate into genome sequencing projects on organisms with large genome sizes and which contain high percentages of repetitive, difficult to assemble, genomic DNA. Combining the Cot selection approach with 454 sequencing and assembly with a pre-existing EST database as seeds resulted in extensions of 27% of the members of the EST database.

  3. ESTUDO DA EFICÁCIA “IN VITRO” DO AMITRAZ E DA DELTAMETRINA COMO CARRAPATICIDA NO CONTROLE DE Boophilus microplus (CANESTRINI, 1887 NA BACIA LEITEIRA DA MICRORREGIÃO DE GOIÂNIA - GOIÁS STUDY ON THE EFFICACY OF AMITRAZ AND DELTAMETHRIN AS ACARACIDES AGAINST Boophilus microplus (CAMESTRINI, 1887 IN THE DAIRY AREA OF GOIÂNIA - GOIÁS

    Directory of Open Access Journals (Sweden)

    Guido Fontgalland Coelho Linhares

    2007-09-01

    Full Text Available

    Para avaliar a eficácia antiixodídica do amitraz e da deltametrina sobre o Boophilus microplus na bacia leiteira da microrregião de Goiânia - Goiás, foram realizados testes in vitro por imersão de teleóginas, colhidas diretamente de bovinos da região. Os princípios ativos foram ensaiados na concentração de 250 ppm, através da avaliação da percentagem de inibição da reprodução (%INR. Entre eles o amitraz apresentou a melhor eficácia, com valor de 97,11%, estando acima do valor mínimo exigido pelo Ministério da Agricultura para produtos carrapaticidas. A deltametrina apresentou o valor de 70,86%, revelando uma eficácia insatisfatória.

    PALAVRAS-CHAVE: Boophilus microplus; carrapaticida; amidinas; piretróides; bovinos.

    The efficacy of amitraz and deltamethrin as acaricides against Boophilus microplus (Canestrini, 1887 was evaluated through an in vitro immersion test using engorged female ticks collected in the dairy area of the microrregion of Goiânia, State of Goiás. The effectiveness of the experimental compounds, on concentrations of 250 ppm, was determined by the effect as measured in percentages of inhibited reproduction (%INR after treatments of the ticks with liquid formulations. The results were: amitraz showed the best efficacy with a percentage of inhibited reproduction (%ITR of 97.11%; for deltamethrin such value was 70.86%, which was considered very low to be used as an acaricide.

    KEY-WORDS: Boophilus microplus; acaricides; amidines; pyrethroids; cattle.

  4. Acaricides efficiency on Rhipicephalus (Boophilus microplus from Bahia state North-Central region Eficiência de acaricidas sobreRhipicephalus (Boophilus microplusna região Centro-Norte, Bahia

    Directory of Open Access Journals (Sweden)

    José Tadeu Raynal

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is responsible for major losses in the Brazilian livestock, mainly due to reduction in cattle productive performance. Resistance development to major classes of acaricide widely used nowadays has been extensively reported, as well as the occurrence of residues from these compounds in animal products and the environment. This study aimed to evaluate the efficiency of acaricides on R. (B. microplus collected from rural properties in the North-Central region of Bahia State. Ticks were collected in several cattle farms in the cited region, and an in vitro acaricide efficiency assay was performed based on the immersion of ticks in acaricide solutions made according to manufacturers' recommendations. The results obtained in the experiments indicated varying degrees of efficiency of the several bases studied, with the products benzofenilurea, macrocyclic lactone and fipronil showing the highest levels of efficiency, 100%, 100% and 97.34%, respectively. It was possible to conclude that, for the region studied, there are different degrees of commercial acaricides efficiency, and many present less than 95% effectiveness, value determined as acceptable by the Brazilian legislation.O carrapato Rhipicephalus (Boophilus microplus é responsável por grandes perdas na pecuária brasileira, principalmente devido à redução no desempenho produtivo dos animais. A resistência do parasita a diferentes classes de acaricidas tem sido amplamente relatada, bem como os problemas de ocorrência de resíduos desses compostos em produtos de origem animal e no ambiente. Esse estudo teve como objetivo avaliar a eficiência de diversos acaricidas sobre populações de R. (B. microplus provenientes de propriedades rurais da Região Centro-Norte do Estado da Bahia, Brasil. Teleóginas ingurgitadas foram colhidas em diferentes propriedades da região e submetidas a ensaio in vitro de eficiência de acaricidas, baseado na

  5. Infestación natural de hembras de Boophilus microplus Canestrini, 1887 (Acari: Ixodidae) en dos genotipos de bovinos en el trópico húmedo de Veracruz, México

    OpenAIRE

    Miguel Ángel Alonso Díaz; Barud Josué López Silva; Ana Carolina Leme de Magalhães Labarthe; Roger Iván Rodríguez Vivas

    2007-01-01

    El objetivo del presente estudio fue determinar la dinámica poblacional anual de Boophilus microplus en dos genotipos de ganado bovino. El estudio se realizó en Martínez de la Torre, Veracruz, México (región trópico húmeda). Se utilizaron 20 toretes de diez meses de edad y 185 kg de peso, infestados naturalmente con garrapatas B. microplus. Se formaron dos grupos de diez animales cada uno, según el genotipo (¾ Bos taurus [½ Holstein, ¼ Simmental, ¼ Cebú] y ½ Bos taurus [½ Holstein, ½ Cebú]). ...

  6. INCIDENCE OF Boophilus microplus AND BLOOD PARAMETERS IN CROSSBRED STEERS FED OF SUNFLOWER INCIDÊNCIA DE Boophilus microplus E AVALIAÇÃO DOS PARÂMETROS SANGÜÍNEOS EM BOVINOS MESTIÇOS (HOLANDÊS x ZEBU ALIMENTADOS COM GIRASSOL

    Directory of Open Access Journals (Sweden)

    Sérgio Luíz S. Rezende

    2007-07-01

    Full Text Available This experiment aimed to evaluate the efficacy of sunflower meal and sunflower seeds to control Boophilus microplus in naturally infested steers. The experiment was developed in the Dairy Cattle Facilities of the Veterinary College - UFG. Two herds of steers (Holstein x zebu were allotted in a randomized block design in 2x10 factorial arrangement with six repetitions on Brachiaria decumbens pastures. After 14 days, weekly for two months, B. microplus females > 4 mm were counted, blood samples were collected and the animals were weighed. The B. microplus engorged females were collected to evaluate reproductive parameters. Blood samples were processed to determine: hematocrit, total protein, fibrinogen and leukocytes. The results had been submitted to the analysis of variance and the averages compared for the Scott-Knott test (5%. Tick counts, index (%, larval eclosion, hematocrit, total protein, fibrinogen and leukocytes were similar between treatments. The results do not corroborate the empirical reports concerning the effectiveness of the sunflower to control B. microplus in crossbred steers. KEY-WORDS: Blood values, oily seeds, parasites, tick count. Objetivou-se avaliar a ação do farelo ou das sementes de girassol no controle de Boophilus microplus em novilhos mestiços (holandês x zebu infestados naturalmente. O experimento foi desenvolvido no Setor de Bovinocultura do Departamento de Produção Animal da Escola de Veterinária (EV da UFG. Foram utilizados dois lotes de animais, distribuídos inteiramente ao acaso num fatorial 2 x 10 com seis repetições, em piquetes de Brachiaria decumbens, onde foram suplementados. Após quatorze dias de experimento e a cada sete dias, durante dois meses, num curral de manejo, efetuaram-se a contagem das fêmeas de B. microplus > 4 mm, as coletas de sangue e as pesagens dos bovinos. Colheram-se fêmeas ingurgitadas de B. microplus para avaliação de parâmetros reprodutivos. Amostras de sangue

  7. Avaliação do potencial de controle biológico do Metarhizium anisopliae sobre Boophilus microplus em teste de estábulo Evaluation of the biological control potential of Metarhizium anisopliae toward Boophilus microplus in pen trials

    Directory of Open Access Journals (Sweden)

    Thiago C. Bahiense

    2007-12-01

    Full Text Available Avaliou-se por meio de um teste de estábulo a capacidade de Metarhizium anisopliae em controlar o carrapato Boophilus microplus. Foram realizados tratamentos em bovinos estabulados, utilizando este fungo aplicando-se suspensão conidial em banhos por aspersão. Os resultados foram obtidos pelo percentual de mortalidade de carrapatos durante 28 dias após o tratamento e pelos índices biológicos após incubação destes em câmara climatizada. Constatou-se 33% de mortalidade no período total observado, sendo o índice de produção de ovos e índice nutricional reduzidos somente em um curto período após o tratamento.The aim of the present study was to evaluate the capacity of the fungus Metarhizium anisopliae to control Boophilus microplus tick in pen trials. Infested calves were held in individual pen and treated with fungus suspension through aspersion bath. The results were evaluated based on ticks' mortality rate for 28 days after treatment, and on the analysis of biology of tick's samples which were transferred to an incubation chamber. It was reported 33% of mortality during the total period analyzed, and the production of eggs and nutritional rates were decreased only for a short period after treatment.

  8. Use of biotherapic in the control of the natural infestation by Boophilus microplus: pilot study Uso de bioterápico en el control de la infestación natural por Boophilus microplus: estudio piloto

    Directory of Open Access Journals (Sweden)

    Laerte Francisco Filippsen

    2008-03-01

    Full Text Available In the control of tick-borne disease (TBD, resistance to chemical products has been reported and a concern with the preservation of the environment requires alternative procedures to control infestation by Boophilus microplus worldwide. The use of biotherapic preparations is one of such alternatives. The aim of this study was to evaluate the effects of a biotherapic mixture including B. microplus in naturally infested cattle. 27 animals were divided in 3 groups (n=9: I – control, received no treatment; II- treated with amitraz dip; III- treated with a standard commercial mixture of biotherapic 12cH, p.o. Group III presented a statistically significant decrease of ticks when compared to the control group (p Keywords: Biotherapic; Tick; Alternative control; Cattle.   Uso do bioterapico no controle da infestação natural por Boophilus microplus: estudo piloto Resumo No controle de enfermidades transmitidas por carrapatos tem sido notada a resistência a produtos químicos. A preocupação com a conservação do meio ambiente tem exigido procedimentos alternativos para controlar a infestação por Boophilus microplus, em todo o mundo. O uso de bioterápicos representa uma dessas alternativas. O objetivo deste estudo foi avaliar o efeito de uma mistura de bioterápicos incluindo B. microplus, em gado bovino infestado naturalmente. 27 animais foram divididos em 3 grupos (n=9: I controle sem tratamento; II tratado com banho de amitraz; III tratado com mistura comercial de bioterápicos 12 cH, via oral. O grupo III apresentou uma diminuição estatísticamente significativa de carrapatos, em comparação com grupo controle (p Palavras-chave: Bioterapicos; Carrapato; Controles alternativos; Bovinos.   Uso de bioterápico en el control de la infestación natural por Boophilus microplus: estudio piloto

  9. Strategic applications of long-acting acaricides against Rhipicephalus (Boophilus) microplus in northwestern Argentina, with an analysis of tick distribution among cattle.

    Science.gov (United States)

    Nava, Santiago; Mangold, Atilio J; Canevari, José T; Guglielmone, Alberto A

    2015-03-15

    Strategic applications of long-acting acaricides for the control of Rhipicephalus (Boophilus) microplus in northwestern Argentina were evaluated for one year. In addition, tick distribution among cattle was analyzed to evaluate if partial selective treatment or culling the small proportion of most heavily infested animals were feasible options to control R. (B.) microplus. Two different treatments schemes based on two applications of fluazuron and one application of 3.15% ivermectin were performed. Treatments were made in late winter and spring so as to act on the small 1st spring generation of R. (B.) microplus, in order to preclude the rise of the larger autumn generation. The overall treatment effect was positively significant in both schemes. The number of ticks observed in the control group was significantly higher than in the treated groups on all post-treatment counts. Group 2 exhibited more than 80% of efficacy almost throughout the study period, whereas Group 1 exhibited an efficacy percentage higher than 80% in September, October, December, February, April and May, but not in November (73.4%), January (58.3%), March (45.2%) or June (53.4%). Absolute control was observed in Group 2 in the counts of September and October, and in Group 1 in the count of February. The control strategies evaluated in this work provide an acceptable control level with only three applications of acaricides; at the same time, they prevent the occurrence of the autumn peak of tick burdens, which is characteristic of R. (B.) microplus in northwestern Argentina. Tick distribution was markedly aggregated in all counts. Although ticks were not distributed evenly among calves, the individual composition of the most heavily infested group was not consistent throughout the study period. In addition, the level of aggregation varied with tick abundance. These results suggest that applying acaricides to a portion of the herd or culling the most infested individuals at a given moment of the

  10. Two initial vaccinations with the Bm86-based Gavacplus vaccine against Rhipicephalus (Boophilus microplus induce similar reproductive suppression to three initial vaccinations under production conditions

    Directory of Open Access Journals (Sweden)

    Fernández Erlinda

    2010-09-01

    Full Text Available Abstract Background The cattle tick, Rhipicephalus (Boophilus microplus, affects livestock production in many regions of the world. Up to now, the widespread use of chemical acaricides has led to the selection of acaricide-resistant ticks and to environmental contamination. Gavacplus is a subunit vaccine based on the recombinant Bm86 tick antigen expressed in yeast, capable to control infestations of R. microplus under controlled and production conditions. The vaccine constitutes the core element of broad control programs against this ectoparasite, in which acquired immunity in cattle to Bm86 is combined with a rational use of acaricides. At present, the conventional vaccine scheme consists of three doses that should be administered at weeks 0, 4 and 7, followed by a booster every six months. Results In this study we assayed a reduction in the number of the initial doses of Gavacplus, evaluated the time course and the level of bovine anti-Bm86 antibodies elicited, and analyzed the vaccine effect on ticks engorging on immunized cattle under production conditions. Following three different immunization schemes, the bovines developed a strong and specific immune response characterized by elevated anti-Bm86 IgG titers. A reduction in the weight of engorging female ticks, in the weight of the eggs laid and also in R. microplus viable eggs percentage was obtained by using only two doses of Gavacplus administered at weeks 0 and 4, followed by a booster six months later. This reduction did not differ from the results obtained on ticks engorging on cattle immunized at weeks 0, 4 and 7. It was also demonstrated that anti-Bm86 antibody titers over 1:640, measured in bovines immunized at weeks 0 and 4, were sufficient to affect weight and reproductive potential of female ticks as compared with ticks engorging on unvaccinated animals. In addition, no statistically significant differences were detected in the average weight of eggs laid by ticks engorged on

  11. Gene silencing of the tick protective antigens, Bm86, Bm91 and subolesin, in the one-host tick Boophilus microplus by RNA interference.

    Science.gov (United States)

    Nijhof, Ard M; Taoufik, Amar; de la Fuente, José; Kocan, Katherine M; de Vries, Erik; Jongejan, Frans

    2007-05-01

    The use of RNA interference (RNAi) to assess gene function has been demonstrated in several three-host tick species but adaptation of RNAi to the one-host tick, Boophilus microplus, has not been reported. We evaluated the application of RNAi in B. microplus and the effect of gene silencing on three tick-protective antigens: Bm86, Bm91 and subolesin. Gene-specific double-stranded (dsRNA) was injected into two tick stages, freshly molted unfed and engorged females, and specific gene silencing was confirmed by real time PCR. Gene silencing occurred in injected unfed females after they were allowed to feed. Injection of dsRNA into engorged females caused gene silencing in the subsequently oviposited eggs and larvae that hatched from these eggs, but not in adults that developed from these larvae. dsRNA injected into engorged females could be detected by quantitative real-time RT-PCR in eggs 14 days from the beginning of oviposition, demonstrating that unprocessed dsRNA was incorporated in the eggs. Eggs produced by engorged females injected with subolesin dsRNA were abnormal, suggesting that subolesin may play a role in embryonic development. The injection of dsRNA into engorged females to obtain gene-specific silencing in eggs and larvae is a novel method which can be used to study gene function in tick embryogenesis. PMID:17196597

  12. Efficacy of amitraz (Taktic 12.5% EC) as a dip for the control of Boophilus microplus (Canestrini) (Acari: Ixodidae) on cattle.

    Science.gov (United States)

    George, J E; Davey, R B; Ahrens, E H; Pound, J M; Drummond, R O

    1998-12-01

    Four groups of cattle infested with Boophilus microplus (Canestrini) were each dipped in a different concentration of amitraz diluted from a 12.5% EC formulation to determine the efficacy and performance of the product in an 11,400 l dipping vat. Except for the period when heifers were dipped, animals were restrained in stanchions placed individually inside 3.3 x 3.3 m2 stalls within an open-sided barn. The amitraz in the vat was stabilized with hydrated lime to maintain a pH of ca. 12. Analyses of vat samples showed that concentrations of amitraz in the vat were 7.6 to 13% lower than the targeted concentrations of 0.010, 0.015, 0.020, and 0.025% active ingredient (AI) for dilutions prepared according to instructions on the manufacturer's label. The large quantity of hydrated lime added to the vat (10 kg/1000 l) interfered with the HPLC analysis of vat samples. Therapeutic efficacy of each of the four observed concentrations (0.0088, 0.0131, 0.0174, and 0.0231% AI) of amitraz was excellent (> 99% control). However, the rapid detachment of all ticks from an animal within a few hours after treatment with amitraz, that has been frequently observed, was not pronounced in the present study. Only 47% of the B. microplus detached in the first 4 h post-treatment, and 84% detached within the first 24 h. All of the treatments, except the lowest concentration, provided protection of cattle against re-infestation by B. microplus larvae for 14 days post-treatment. Possibly as a result of the formation of a compact layer of lime and amitraz on the bottom after the vat was undisturbed for six weeks, intense agitation was required to re-suspend the active ingredient. PMID:9879580

  13. Evaluation in vitro of the infection times of engorged females of Rhipicephalus (Boophilus microplus by the entomopathogenic nematode Steinernema glaseri CCA strain Avaliação in vitro dos tempos de infecção de fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus pelo nematoide entomopatogênico Steinernema glaseri estirpe CCA

    Directory of Open Access Journals (Sweden)

    Leandro Barbiéri de Carvalho

    2010-04-01

    Full Text Available Studies have shown that ticks are susceptible to infection by entomopathogenic nematodes. These studies indicate different susceptibilities of ticks to infection by these fungi, depending on the tick species, development phase, entomopathogenic nematodes species and strains and the time the ticks are exposed to them. Usually this period ranges from 24 to 72 hours. The aim of this study was to evaluate the infection times in vitro of engorged Rhipicephalus (Boophilus microplus females by the entomopathogenic nematodes Steinernema glaseri CCA strain, by analysis of the ticks' biological parameters. The results show that a 2-hour exposure time was sufficient for the engorged R. microplus females to be infected by S. glaseri CCA, but that a minimum exposure time of 24 hours was necessary to generate treatment efficacy above 90%.Os carrapatos são susceptíveis à infecção por nematoides entomopatogênicos. Essa susceptibilidade diverge quanto às espécies de carrapato estudadas, à fase evolutiva, às espécies e estirpes dos nematoides e ao tempo ao qual os carrapatos ficam expostos a estes. O presente trabalho teve como objetivo avaliar os tempos de infecção in vitro de fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus pelo nematoide entomopatogênico Steinernema glaseri estirpe CCA, pela análise dos parâmetros biológicos do carrapato. Os resultados obtidos demonstraram que um período de duas horas de exposição foi suficiente para que fêmeas ingurgitadas de R. microplus fossem infectadas por S. glaseri CCA e que um período de exposição mínimo de 24h foi necessário para que houvesse infecção de fêmeas ingurgitadas de R. microplus por S. glaseri estirpe CCA, capaz de gerar, in vitro, eficácia no tratamento superior a 90%.

  14. Transmisión de cepas atenuadas de babesia bigemina y babesia bovis por garrapatas rhipicephalus (Boophilus) microplus

    OpenAIRE

    Edmundo E. Rojas Ramírez; Juan J. Mosqueda Gualito; Jesús A. Álvarez Martínez; Rubén Hernández Ortíz; Juan A. Ramos Aragón; Carmen Rojas Martínez; Germinal J. Cantó Alarcón; Carlos A. Vega y Murguía; Julio V. Figueroa Millán

    2011-01-01

    Para evaluar la transmisión por garrapatas Rhipicephalus microplus (R. microplus) de una clona atenuada de Babesia bovis (BOR) y una cepa atenuada de Babesia bigemina (BIS), doce bovinos se dividieron en cuatro grupos e infestados de forma escalonada con larvas de R. microplus libres de Babesia spp. Un becerro de cada grupo se inoculó con 1x108 eritrocitos infectados (EI) con BIS, BOR, y cepas virulentas de B. bigemina y B. bovis, respectivamente. Se realizaron dos inoculaciones seriadas adic...

  15. Principal component analysis on the perceptions of milk producers about Rhipicephalus (Boophilus microplus control in Minas Gerais Análise de componente Principal da percepção dos produtores de leite sobre o controle do Rhipicephalus (Boophilus microplus em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães da Rocha

    2012-09-01

    Full Text Available Milk producers in Lavras, Passos and Divinópolis, Minas Gerais, were interviewed with the aim of evaluating their perceptions and attitudes regarding control over Rhipicephalus (Boophilus microplus. Multivariate correlation between the variables was done by means of principal component analysis. The producers' perceptions and attitudes regarding R. (B. microplus were similar: most of them did not have any basic knowledge of tick biology or control, and they applied acaricide products through backpack spraying, without any defined technical criteria. Some of the results obtained were: I. a negative correlation between schooling level and the frequency of spraying cattle with acaricides; II. a positive correlation between milk production, quality of equipment for acaricide application and technological level of the farm; III. farm properties with greater production and technification tended to keep the intervals between acaricide applications constant over the course of the year. After applying principal component analysis, a positive correlation was observed between schooling level, technological level of the farm and perceptions regarding R. (B. microplus, but without any correlation with attitudes towards controlling this tick. It was concluded that higher technological level and schooling level improved the producers' perceptions relating to the biology of the tick R. (B. microplus, but did not achieve effectiveness with regard to using controls more rationally.Produtores de leite de Lavras, Passos e Divinópolis, MG, foram entrevistados com objetivo de avaliar sua percepção e atitude no controle do Rhipicephalus (Boophilus microplus. A análise da correlação multivariada entre as variáveis foi feita através de componentes principais (ACP. A percepção e atitude sobre o R. (B. microplus foram semelhantes entre os produtores, sendo que a maioria deles não tem o conhecimento básico sobre a biologia e o controle desse carrapato

  16. Percepção dos produtores de leite do município de Passos, MG, sobre o carrapato Boophilus microplus (Acari: Ixodidae, 2001 Perception of dairy farmers from Passos county, MG, Brazil, concerning the tick Boophilus microplus (acari: ixodidae, 2001

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães da Rocha

    2006-08-01

    Full Text Available Entrevistas com 25 proprietários de rebanhos com produção diária acima de 500 litros de leite, sorteados da listagem da cooperativa de Passos/MG/Brasil, foram aplicadas para caracterizar suas percepções sobre a biologia do Boophilus microplus e suas atitudes no controle de carrapatos. A maioria desses produtores tem pelo menos o ensino médio completo e está na atividade há mais de dez anos. Os prejuízos biológicos produzidos pelos carrapatos são bem percebidos por eles; porém, não demonstraram conhecimento sobre a biologia do B. microplus e as desvantagens dos banhos carrapaticidas, principalmente com relação aos riscos toxicológicos. Esses produtores realizam controle de carrapatos sem critérios técnicos e com alta freqüência, baseando-se na avaliação subjetiva da infestação nos animais. Isto favorece o estabelecimento da resistência aos acaricidas e demonstra que a transferência de tecnologia sobre controle de carrapatos para o setor pecuário é falha.Twenty five dairy farms were randomly chosen from all farms producing more than 500 liters of milk/ day in Passos, MG, Brazil. The owners were interviewed to characterize their perceptions about the biology of B. microplus and their attitudes towards tick control. Most of the producers have a college degree and more than six year-experience in the activity. The biological damages caused by ticks are perceived by the farmers. Their tick control is performed without technical criteria and they did not show a proper knowledge on the biology of B. microplus nor on the toxicological risks of acaricides application. The results reveal a gap between the technology and farmers, favoring tick resistance to acaricides.

  17. Avaliação in vitro da ação do óleo essencial de capim limão (Cymbopogon citratus sobre o carrapato bovino Rhipicephalus (Boophilus microplus In vitro evaluation of the action of lemon grass (Cymbopogon citratus essential oil on the cattle tick Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    F.C.C. Santos

    2012-01-01

    Full Text Available O uso indiscriminado de produtos químicos no controle do carrapato bovino constitui a principal causa do gradativo aumento do número de cepas resistentes deste parasita às bases disponíveis no mercado. A utilização de óleos essenciais e extratos vegetais é uma prática antiga no controle de carrapatos, porém só recentemente tem recebido a devida atenção dos pesquisadores. O objetivo deste experimento foi avaliar a eficácia in vitro do óleo de capim limão (Cymbopogon citratus sobre fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus através do exame de biocarrapaticidograma. Foram testadas seis diluições do óleo de C. citratus (1; 5; 10; 25; 50 e 100% em uma população de carrapatos resistentes a amidínicos e piretróides sintéticos. A inibição de postura foi de 3; 23; 46; 66; 46 e 46%, a eclosão larval foi de 83; 58; 31; 0; 38 e 25% e a eficácia do tratamento foi de 32; 64; 83; 100; 88 e 82%, respectivamente. O óleo de C. citratus apresentou controle parcial do carrapato R. microplus in vitro, mesmo frente a populações resistentes a produtos químicos.The indiscriminate use of chemical products to control the cattle tick is the main cause of the gradual increase in the number of strains of this parasite that are resistant to the bases currently available in the market. The use of essential oils and plant extracts is an ancient practice for tick control; however, only recently has it received due attention by researchers. The aim of this experiment was to evaluate the in vitro efficacy of lemongrass (Cymbopogon citratus essential oil on engorged females of Rhipicephalus (Boophilus microplus through immersion test. Six concentrations of Cymbopogon citratus oil (1; 5; 10; 25; 50 and 100% were tested against a tick population resistant to synthetic formamidines and pyrethroids. The inhibition of egg-laying was 3; 23; 46; 66; 46 and 46%, the hatching was 83; 58; 31; 0; 38 and 25%, and the treatment efficacy was 32

  18. New species of Ehrlichia isolated from Rhipicephalus (Boophilus microplus shows an ortholog of the E. canis major immunogenic glycoprotein gp36 with a new sequence of tandem repeats

    Directory of Open Access Journals (Sweden)

    Cruz Alejandro Cabezas

    2012-12-01

    Full Text Available Abstract Background Ehrlichia species are the etiological agents of emerging and life-threatening tick-borne human zoonoses that inflict serious and fatal infections in companion animals and livestock. The aim of this paper was to phylogeneticaly characterise a new species of Ehrlichia isolated from Rhipicephalus (Boophilus microplus from Minas Gerais, Brazil. Methods The agent was isolated from the hemolymph of Rhipicephalus (B. microplus engorged females that had been collected from naturally infested cattle in a farm in the state of Minas Gerais, Brazil. This agent was then established and cultured in IDE8 tick cells. The molecular and phylogenetic analysis was based on 16S rRNA, groEL, dsb, gltA and gp36 genes. We used the maximum likelihood method to construct the phylogenetic trees. Results The phylogenetic trees based on 16S rRNA, groEL, dsb and gltA showed that the Ehrlichia spp isolated in this study falls in a clade separated from any previously reported Ehrlichia spp. The molecular analysis of the ortholog of gp36, the major immunoreactive glycoproteins in E. canis and ortholog of the E. chaffeensis gp47, showed a unique tandem repeat of 9 amino acids (VPAASGDAQ when compared with those reported for E. canis, E. chaffeensis and the related mucin-like protein in E. ruminantium. Conclusions Based on the molecular and phylogenetic analysis of the 16S rRNA, groEL, dsb and gltA genes we concluded that this tick-derived microorganism isolated in Brazil is a new species, named E. mineirensis (UFMG-EV, with predicted novel antigenic properties in the gp36 ortholog glycoprotein. Further studies on this new Ehrlichia spp should address questions about its transmissibility by ticks and its pathogenicity for mammalian hosts.

  19. Avaliação in vitro da eficácia de acaricidas sobre Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae de bovinos no município de Ilhéus, Bahia, Brasil In vitro valuation of acaricides efficiency to Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae from bovines at the region of Ilhéus, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Dunezeu Alves Campos Júnior

    2005-12-01

    Full Text Available O carrapato Boophilus microplus é a espécie de maior distribuição geográfica e importância econômica para os países produtores de bovinos em áreas tropicais e sub-tropicais do planeta. No Brasil, a Região Nordeste apresenta algumas áreas mais favoráveis para as infestações do gado. O controle químico ainda é a forma mais eficaz de combate deste ectoparasita, mas o manejo inadequado dos acaricidas tem contribuído com o aparecimento de resistência de populações aos produtos disponíveis no mercado. O município de Ilhéus, na Região Cacaueira da Bahia, vem incrementando sua atividade pecuária em substituição à lavoura cacaueira devastada. Foram realizados 30 testes de imersão in vitro (biocarrapaticidogramas com fêmeas ingurgitadas de B. microplus colhidas em propriedades rurais aleatoriamente selecionadas num grupo de 96 entrevistadas na região. O estudo revelou a existência de resistência ou sensibilidade de populações de B. microplus frente aos carrapaticidas de contato mais utilizados nas propriedades de exploração pecuária da região de Ilhéus. Os quatro carrapaticidas testados apresentaram as seguintes eficiências médias: Amitraz - 30,95%; Deltametrina - 65,04%; Cipermetrina / diclorvos - 75,73%; e Triclorfon / coumaphos / cyfluthrin - 75,13%.The tick Boophilus microplus is the species with the greatest geographical distribution and economic importance for the countries situated at tropical and sub-tropical zones of the planet. In Brazil, the Northwest Region is showed as the most favorable to the cattle infestation. Chemical control is an efficient control method employed, but the inadequate handling of acaricides contributed for to the onset of resistant ticks to the available acaricides in the market. The county of Ilhéus, at the Cocoa's Region from Bahia, has been increasing the cattle activity instead of the devastated cocoa's plantations. Between April and September 2000, in vitro imersion tests

  20. Detección de resistencia a los acaricidas en la garrapata del ganado Boophilus microplus mediante análisis de zimogramas (Acaricide resistance detection in the cattle tick Boophilus microplus by zymograms analysis).

    OpenAIRE

    Miranda, Miranda, Estefan; Osorio, Miranda Jorge; Cossío, Bayúgar, Raquel

    2005-01-01

    La identificación de resistencia a los productos acaricidas en la garrapata B. microplus, se hace mediante un complicado bioensayo, que requiere garrapatas de referencia y de campo cultivadas sobre bovinos vivos y restringidos durante semanas. Con el fin de evaluar una posible alternativa diagnóstica, se hicieron ensayos enzimáticos en geles de poliacrilamida-SDS, usando extractos de larvas de garrapatas provenientes de cuatro cepas de referencia con diferentes niveles de resistencia y suscep...

  1. A theoretical analysis of codon adaptation index of the Boophilus microplus bm86 gene directed to the optimization of a DNA vaccine.

    Science.gov (United States)

    Ruiz, Lina María; Armengol, Gemma; Habeych, Edwin; Orduz, Sergio

    2006-04-21

    DNA vaccines utilize host cell molecules for gene transcription and translation to proteins, and the interspecific difference of codon usage is one of the major obstacles for effective induction of specific and strong immune response. In an attempt to improve codon usage effects of DNA vaccine on protein expression, a quantitative study was conducted to clarify the relationship of codon usage in the tick gene bm86 and its potential expression in bovine cells. The calculated relative synonymous codon usage (RSCU) and codon adaptation index (CAI) values of bm86 from Boophilus microplus and a set of 14 highly expressed genes from Bos taurus indicated that some codons utilized frequently in bm86 are rarely used in B. taurus genes and vice versa. The different translational efficiencies obtained suggested that after DNA vaccination using the wild bm86 gene, the protein Bm86 would be expressed in bovines, but it would not be the optimum sequence. However, using the codon-optimized bm86 gene to bovines, whose sequence was theoretically designed, would probably improve the level of the immune response generated against ticks. PMID:16171828

  2. [Elaboration and evaluation of a candidate to the DNA vaccine using synthetic genes derived from the peptídeo SBm7462 against the carrapato Rhiphicephalus (Boophilus) microplus].

    Science.gov (United States)

    Medeiros, Carla L; Mendonça, Bianca G; Tavares, Larissa C; Girão, Flávia A; Sossai, Sidimar; Peconick, Ana P; Carvalho, Gabriel D; Patarroyo, Joaquín H

    2008-09-01

    Rhiphicephalus (Boophilus) microplus is one of the most important arthropods in veterinary medicine due economic losses and health problems caused in cattle production. The vaccination represents optimum method evaluated with effective cost to prevent economic losses and to increase the duration and quality of life of the production animals. A synthetic peptide, SBm 7462, derived from Bm86, has been shown great results in control of ticks. The construction and synthesis of one nucleotide sequence based on this peptide might be useful for design a DNA vaccine that has many advances than peptide vaccine. A gene, called seq1, was constructed with a three repetition of nucleotide sequence of SBm 7462. It was cloned into a pCIneo vector expression in mammals and injected in BALB/c mouse. When mice were inoculated with the expression cassette they did not response in ELISA. They elevated antibody titles only when vaccinated with the synthetic peptide SBm7462®. And, the best titles of immunoglobulins were seen when the SBm7462® was administered subcutaneously. PMID:20059811

  3. [Morphologic characterization and biological aspects of evolutive forms of Babesia bigemina (Smith and Kilborne, 1893) (Protozoa: Babesiidae) in Boophilus microplus (Canestrini, 1887)].

    Science.gov (United States)

    Barreira, Jairo D; Rossi, Maria Inês D; da Silva, Gil Vicente O; Pires, Fabiano A; Massard, Carlos L

    2005-01-01

    The development of Babesia bigemina in Boophilus microplus were studied in experimental conditions, using crossed-breed bovine from free-area of these parasites. Stages of the hemoparasites were observed in the tick vector, starting from the infected red-blood cells observed in the gut of engorged females, from the first 24 hours after detachment to the emergence of sporokinets in the larvas. In the period from 24 to 48 hours after detachment of the engorged females (DEF), the presence of some infected red-blood cells was verified, beside the occurrence of ray bodies and of vermiculars forms, known as oocynets. Since 72 hours after the DEF, the of okinets presence was observed in the cytoplasm of the epithelium cells besides of great sporokinets number in development. At same period, the presence of sporokinets of B. bigemina in the hemolymph samples was observed inside the hemocytes. After the fourth day of incubation beside the presence of the sporokinets was also verified in the Malpighi's tubes and ovaries. As well as in the ticks eggs from the sporokinets were also observed ticks eggs from the fourty day after the natural detachment of the engorged females of the host. PMID:16153336

  4. 3β-O-Tigloylmelianol from Guarea kunthiana: A New Potential Agent to Control Rhipicephalus (Boophilus microplus, a Cattle Tick of Veterinary Significance

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Miguita

    2014-12-01

    Full Text Available Chemical investigation of Guarea kunthiana fruits, guided by their effect on the reproductive cycle of engorged females of the cattle tick Rhipicephalus (Boophilus microplus—a major economic problem to the livestock industry worldwide—led to isolation of 3β-O-tigloylmelianol, a new protolimonoid, from the bioactive hexane phase obtained by partitioning the crude ethanol extract. An adult immersion test was performed. The compound strongly inhibited egg-laying and hatchability (99.2% effectiveness at a 0.01% concentration. Melianone, isolated from the same phase, yielded unremarkable results in the adult immersion test. From the dichloromethane phase, melianol, melianodiol, meliantriol, and a new protolimonoid, 3β-O-tigloylmeliantriol, were isolated, all of which, in the same manner as melianone, exhibited unremarkable results in the test. The structures of new and known compounds were mostly established by 1D- and 2D-NMR analyses and mass spectrometry data. This is the first report on the bioactivity of protolimonoids on the reproductive cycle of engorged females of R. (B. microplus. 3β-O-Tigloylmelianol proved a promising candidate for the development of a biocontrol agent against the cattle tick investigated, as an alternative to environmentally hazardous synthetic acaricides.

  5. Expression and secretion in Aspergillus nidulans and Aspergillus niger of a cell surface glycoprotein from the cattle tick, Boophilus microplus, by using the fungal amdS promoter system.

    OpenAIRE

    Turnbull, I F; Smith, D R; Sharp, P. J.; Cobon, G S; Hynes, M J

    1990-01-01

    A cell surface glycoprotein (Bm86) from cells of the digestive tract of the cattle tick Boophilus microplus, which has been shown to elicit a protective immunological response in vaccinated cattle, was expressed and secreted in the filamentous fungi Aspergillus nidulans and Aspergillus niger by using the fungal amdS promoter system. The cloned gene coded for the Bm86 secretory signal and all of the Bm86 mature polypeptide except for the hydrophobic carboxy-terminal segment. High levels of Bm8...

  6. Evaluation of antibodies production against Borrelia burgdorferi in cattle submitted to rBm86 protein Boophilus microplus tick immunization and associated challenges influence Avaliação da produção de anticorpos anti Borrelia burgdorferi em bovinos submetidos à imunização com proteína rBm86 de carrapato Boophilus microplus e influência dos desafios associados

    OpenAIRE

    Márcia Mayumi Ishikawa; Adivaldo Henrique Fonseca; Natalino Hajime Yoshinari; Ana Luiza Alves Rosa Osório

    2003-01-01

    IgG antibodies production against Borrelia burgdorferi in immunized cattle with rBm86 protein from Boophilus microplus was evaluated as well as the influence of the association between immunizations and stress through indirect ELISA test during one year. In the present study there was no influence of the isolated challenged used on the production of IgG antibodies against B. burgdorferi. The rBm86 immunogen did not cause significant oscillation in the production of IgG antibodies against B. b...

  7. ANTI-IXODIDIC EVALUATION OF DIAZINON, COUMAPHOS AND CYPERMETHRIN THROUGH IN VITRO TESTS OF ENGORGED FEMALES OF Boophilus microplus (CANESTRINI, 1887 IN THE DAIRY MICROREGION OF GOIÂNIA - GOIÁS AVALIAÇÃO ANTIIXODÍDICA DE DIAZINON, COUMAFÓS E CIPERMETRINA, ATRAVÉS DE TESTES “IN VITRO”, SOBRE FÊMEAS INGURGITADAS DE Boophilus microplus (CANESTRINI, 1887 NA BACIA LEITEIRA DA MICRORREGIÃO DE GOIÂNIA-GOIÁS

    Directory of Open Access Journals (Sweden)

    Reinaldo Neves Sobrinho

    2007-09-01

    Full Text Available

    The efficacy of the acaricides diazinon, coumaphos and cypermethrin against Boophilus microplus was evaluated in an attempt to study the susceptibility of this ixodid tick in the dairy region of Goiânia, GO. For this study it was collected engorged female ticks in 22 farms from March until June, 1996. In a laboratory the ticks were submitted to a conventional immersion method as an in vitro test. The acaricides and the respective concentration tested were as follows: diazinon 500 ppm, coumaphos 500 ppm and cipermethrin 150 ppm. The results showed an efficacy of 94.13% for diazinon, 91.20% for coumaphos and only 69.14% for cypermethrin.

    KEY-WORDS: Boophilus microplus; acaricide; cattle; organophosphorus; pyrethroids.

    Para avaliar a eficácia de alguns carrapaticidas sobre Boophilus microplus, colheram-se teleóginas desse ixodídeo em bovinos naturalmente infestados, em 22 propriedades da bacia leiteira de Goiânia, GO, entre março e junho de 1996. Utilizou-se a técnica de imersão das teleóginas in vitro, calculando-se a eficácia percentual das drogas, diazinon 500 ppm, coumafós 500 ppm e cipermetrina 150 ppm, pelos resultados de respectivas de inibição da reprodução: 94,13% (diazinon, 91,2% (coumafós e 69,14% (cipermetrina. Os índices alcançados permaneceram abaixo do mínimo de 95%, recomendado pelo Ministério da Agricultura e do Abastecimento para carrapaticidas, sendo, então, os três produtos reprovados pelos critérios daquele órgão.

    PALAVRAS-CHAVE: Boophilus microplus; acaricida; gado; organofosforados; piretroides.

  8. Perceptions about the biology of Rhipicephalus (Boophilus microplus among milk producers in Divinópolis, Minas Gerais Percepção dos produtores de leite de Divinópolis, Minas Gerais, sobre a biologia do Rhipicephalus (Boophilus microplus

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães da Rocha

    2011-12-01

    Full Text Available One hundred semi-systematized interviews were applied with the aim of surveying the perceptions of milk producers in the municipality of Divinópolis, Minas Gerais regarding the biology of the tick Rhipicephalus (Boophilus microplus. Content analysis was conducted on each of the variables surveyed and their descriptions, highlighting the higher frequencies in order to construct profiles of perceptions about each of the matters surveyed. In addition, each of the producers was categorized regarding their readiness to proceed with efficient control, from the assessment of their responses. Among the variables surveyed were the tick lifespan, duration of parasitic life, time of greatest incidence, survival in pastures and egg-laying volume. These questions are considered important for defining the knowledge needed for rational combat. It was concluded that the information needed for adopting effective practices to combat ticks was insufficient among the milk farm properties in Divinópolis. Moreover, the producers interviewed had a good perception of what they observed in their daily routine, but did not have complementary information about the tick life cycle.Foram aplicadas 100 entrevistas semissistematizadas com o objetivo de levantar a percepção dos produtores de leite do município de Divinópolis, Minas Gerais, sobre a biologia do carrapato Rhipicephalus (Boophilus microplus. Foi feita "análise de conteúdo" de cada uma das variáveis levantadas e sua descrição com destaque das maiores frequências para a construção de perfis de percepção sobre cada um dos aspectos levantados. Além disso, cada um dos produtores foram categorizados quanto a estar ou não apto a proceder um controle eficiente pela avaliação de suas respostas. Algumas das variáveis levantadas foram tempo de vida do carrapato, tempo de vida parasitária, época de maior incidência, sobrevivência nas pastagens e volume de postura, questões consideradas importantes

  9. Proposta para teste carrapaticida por imersão de larvas de Rhipicephalus (Boophilus microplus: avaliação em cipermetrina e amitraz Proposal of an acaricide laboratory test larvae immersion of Rhipicephalus (Boophilus microplus: evaluation with cypermethrin and amitraz

    Directory of Open Access Journals (Sweden)

    Antonio P. de Souza

    2008-12-01

    Full Text Available Objetivou-se desenvolver uma técnica de avaliação de carrapaticidas por imersão de larvas de Riphicephalus (Boophilus microplus. As larvas foram obtidas a partir de ovos de 30 teleóginas coletadas em bovinos de uma propriedade rural do município de Lages, SC, Brasil, os quais foram acondicionados em alíquotas de 10mg por seringa descartável de 5ml, previamente preparadas e mantidas em câmara climatizada até a eclosão. Larvas com sete a dez dias de idade foram submetidas à imersão por 30 segundos em oito diluições de produtos carrapaticidas comerciais à base de amitraz e de cipermetrina, cada uma com dez repetições, sendo mantido um grupo controle para cada repetição e produto, o qual foi imerso em água destilada. A leitura foi realizada 24 horas após o tratamento com a contagem de larvas vivas e mortas. A média de DL50 para cipermetrina foi de 2,99ppm e o erro padrão de 0,36 e para o amitraz foi de 17,22ppm e o erro padrão de 4,20, com intervalo de confiança (IC 95%.The aim of this work was to develop a technique of acaricides evaluation by immersion of larvae. Larvae were obtained from 30 engorged females of Riphicephalus (Boophilus microplus were collected in a ranch in Lages, Santa Catarina state, Brazil. Larvae were obtained from 10mg of eggs placed into 5ml disposable syringes, previously prepared and kept under controlled conditions of laboratory, and collected between the third and the twelfth day of oviposition. Seven to ten days old larvae were submitted to the acaricide laboratory test, in ten replications, by their immersion in eight dilutions of commercial acaricides (amitraz or cypermethrin, for 30 seconds; for each replication and commercial product, a control group was immersed in distilled water. Results were evaluated 24 hours after each treatment by counting the number of live and dead larvae. The mean LD50 values and standard error of the mean for cypermethrin and amitraz were 2.99 ± 0.36 and 17.22

  10. Rusa deer (Cervus timorensis) as a host for the cattle tick (Boophilus microplus) in Papua New Guinea.

    Science.gov (United States)

    Owen, I L

    1977-04-01

    The rusa deer (Cervus timorensis) is more resistant to the cattle tick (Boophlilus microplus) than are Britsh breed cattle in Papua New Guinea. The average yield of replete female ticks from deer was 1.6% (0.3-3.2%) as compared to 11.2% (3.4-23.1%) from calves. Ticks from deer were more slender, lighter in weight and produced fewer eggs (mean 1,800) than did ticks from calves (mean 2,200) but the deer was shown to be an effective host. A cervid population can maintain a tick population in the absence of bovine hosts thus presenting an important factor in eradication programs. Nutritional stress appears to result in a higher seasonal prevalence of infestation amongst males and non-pregnant females. PMID:864854

  11. INFLUÊNCIA DO PESO INICIAL E DA ESTAÇÃO DO ANO NA CONVERSÃO EM OVOS DE FÊMEAS DE Boophilus microplus (ACARI: IXODIDAE

    Directory of Open Access Journals (Sweden)

    Abraão Garcia Gomes

    2006-10-01

    Full Text Available Este trabalho objetivou avaliar a influência do peso inicial da fêmea e da estação do ano na conversão em ovos de Boophilus microplus. O índice de eficiência reprodutiva (IER de 411 fêmeas pesando entre 31 e 360 mg foi correlacionado com seu peso inicial. Para avaliar a influência das diferentes estações do ano neste parâmetro biológico, dez fêmeas ingurgitadas de B. microplus pesando acima de 150 mg foram colhidas, a cada duas semanas, e mantidas em condições climáticas controladas até a determinação do IER. Uma relação curvilinear foi observada entre o peso das fêmeas e o IER. Fêmeas pesando entre 151 e 360 mg tiveram IER’s mais altos (variando de 44,9% a 51,4% do que aquelas mais leves, as quais apresentaram uma menor capacidade de conversão em ovos (variando de 31,4% a 39,0%. Foi observado que a capacidade de as fêmeas converterem o peso em ovos variou sazonalmente. Os mais altos IER foram observados no período seco, de abril a setembro (47,6% a 58,3%, do que no período chuvoso, de outubro a março (40,2% a 43,6% (P<0,05. PALAVRAS-CHAVE: Boophilus microplus, biologia, conversão em ovos, bovinos.

  12. Role of Rusa deer Cervus timorensis russa in the cycle of the cattle tick Boophilus microplus in New Caledonia.

    Science.gov (United States)

    Barré, N; Bianchi, M; Chardonnet, L

    2001-01-01

    Two field experiments were conducted to evaluate the efficiency of Rusa deer in the development of the cattle tick Boaphilus microplus in comparison with that of steers in the same pastures and under the same conditions of infestation. No difference was noted between a mixed steer/deer herd and a pure steer or pure deer herd in the infestation pattern of each host, suggesting that attachment to the alternative host is mechanical and not affected by the simultaneous presence of the primary host on the pasture. Deer are capable of producing engorged viable females, with weight and reproductive performances similar to or even better than females fed on steers. For moderate levels (1 million larvae per hectare) and high levels (32 million larvae per hectare) of pasture infestation, tick burdens on steers were not very different (e.g. average 1,911 and 2,681 ticks per m2 skin, respectively, on day 24). This may be because of saturation of steer skin sites at the moderate larval dose. Deer harboured 2.7-33 times fewer ticks than steers and produce no engorged females at the moderate larval level and 32 times fewer engorged females than steers at the high larval level. Infestation of deer was dose-dependent with averages of 12 and 399 ticks per m2 skin on day 25 at the moderate and high larval levels, respectively. At a high infestation level of the environment, Rusa deer may contribute, but to a limited extent, to infestation of pastures and, consequently, of cattle. However, their role in sustaining a viable tick population requires further investigation. PMID:11508531

  13. Caracterização do controle de Haematobia irritans e Rhipicephalus (Boophilus microplus no Triângulo Mineiro e Alto Paranaíba, Minas Gerais

    Directory of Open Access Journals (Sweden)

    Luísa N. Domingues

    2012-12-01

    Full Text Available O controle eficaz de Haematobia irritans (mosca-dos-chifres e Rhipicephalus (Boophilus microplus (carrapato-do-boi é um fator crucial à maior rentabilidade da pecuária brasileira, porém ainda constitui-se um desafio. Um maior conhecimento das práticas adotadas no combate destes parasitos faz-se necessário para que se possam estruturar estratégias de controle mais próximas da realidade do produtor rural e mais fáceis de serem executadas. Este estudo caracterizou, através de entrevistas, as práticas adotadas no controle desses ectoparasitos em 23 propriedades da mesorregião do Triângulo Mineiro e Alto Paranaíba, Minas Gerais. A maioria dos entrevistados reconheceu a importância desses parasitos para a atividade pecuária, entretanto, diversos problemas relativos ao controle parasitário foram observados. O controle da mosca-dos-chifres e do carrapato-do-boi era uma prática rotineira em, respectivamente, 17,4% e 95,7% das propriedades, geralmente realizado em função de elevado grau de infestação dos animais. Mais de seis aplicações de ectoparasiticidas eram realizadas por ano em todas as propriedades que empregavam tratamentos para o controle da mosca e em 76,5% daquelas que combatiam o carrapato. Os produtos eram aplicados principalmente com bombas costais manuais (63,6% e sem a contenção dos animais em 45,5% das propriedades. A diluição dos produtos segundo recomendações dos fabricantes era realizada por 45,4% dos entrevistados, porém, 63,6% aplicavam um volume de solução por animal menor do que o tecnicamente recomendado. Utilizava-se principalmente a associação de piretróides e organofosforados para o controle de ambos os parasitos. Apesar de utilizar rotineiramente ectoparasiticidas, o uso de equipamento de proteção individual (EPI não era comum entre os entrevistados. A maioria dos entrevistados conhecia algumas características epidemiológicas dos parasitos, entretanto, o controle parasitário adotado na

  14. Evaluation of antibodies production against Borrelia burgdorferi in cattle submitted to rBm86 protein Boophilus microplus tick immunization and associated challenges influence Avaliação da produção de anticorpos anti Borrelia burgdorferi em bovinos submetidos à imunização com proteína rBm86 de carrapato Boophilus microplus e influência dos desafios associados

    Directory of Open Access Journals (Sweden)

    Márcia Mayumi Ishikawa

    2003-11-01

    Full Text Available IgG antibodies production against Borrelia burgdorferi in immunized cattle with rBm86 protein from Boophilus microplus was evaluated as well as the influence of the association between immunizations and stress through indirect ELISA test during one year. In the present study there was no influence of the isolated challenged used on the production of IgG antibodies against B. burgdorferi. The rBm86 immunogen did not cause significant oscillation in the production of IgG antibodies against B. burgdorferi capable to interfere in the serological results for Lyme Borreliosis in cattle. This study demonstrated the possibility of transitory changes in the production of antibodies after the association of vaccine stimuli and stress, emphasizing the necessity of serological studies combined with epidemiological and management data.Avaliou-se a produção de anticorpos da classe Ig-G anti Borrelia burgdorferi em bovinos imunizados com proteína recombinante Bm86 de Boophilus microplus, assim como a influência de imunizações e estresse associados por meio do teste ELISA indireto no período de um ano. Não houve interferência na produção de anticorpos IgG anti B. burgdorferi pelos desafios utilizados isoladamente no presente estudo. O imunógeno rBm86 não causou oscilações significantes na produção de anticorpos IgG anti B. burgdorferi capazes de interferir nos resultados sorológicos para Borreliose de Lyme em bovinos. O estudo demonstrou a possibilidade de alterações transitórias na produção de anticorpos após estímulos vacinais e de estresse associados, ressaltando a necessidade de estudos sorológicos em conjunto a dados epidemiológicos e de manejo.

  15. In vitro analysis of the action of acaricides on Boophilus microplus strains (Canestrini, 1887 taken from dairy cattle from northeast area of the São Paulo State/ Análise in vitro da ação de carrapaticidas em cepas de Boophilus microplus (Canestrini, 1887 colhidas de bovinos leiteiros da região nordeste do Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Alvimar José da Costa

    2001-08-01

    Full Text Available The susceptibility of Boophilus microplus ticks to nine insecticides was evaluated in vitro through immersion test. The insecticides contained the following compounds: Alphamethrin + Dichlorvos, Amitraz, Cypermethrin, Cypermethrin + Chlorphenvinphos, Coumaphos, Deltamethrin, Dichlorvos + Cypermethrin, Dichlorvos + Chlorphenvinphos and Zetacypermethrin. Ticks were collected from dairy cows in 17 properties of the northeast of the Sao Paulo State. Only three formulations reached recommended effectiveness (³ 95,0%: Cypermethrin + Chlorphenvinphos in nine properties, with average 89,69% ± 15,49, Dichlorvos + Chlorphenvinphos in eight, with average 91,22% ± 11,50 and the Amitraz in seven, with 78,62% ± 24,47. The results did not differ significantly (P > 0,05 from each other.Avaliou-se por meio de teste de imersão “in vitro” a susceptibilidade do Boophilus microplus a nove carrapaticidas contendo os seguintes princípios ativos: Alfamethrina + Diclorvos, Amitraz, Cipermetrina, Cipermetrina + clorfenvinfós, Coumafós, Deltametrina, Diclorvos + Cipermetrina, Diclorvinil + Clorfenvinfós e Zetacipermetrina. A colheita dos carrapatos foi realizada em 17 propriedades de bovinos leiteiros da região nordeste do Estado de São Paulo. Das formulações avaliadas apenas três alcançaram eficácia superior à recomendada (³ 95,0 %: Cipermetrina + Clorfenvinfós em nove propriedades, com média 89,69 % ± 15,49, Diclorovinil + Clorfenvinfós em oito, com média 91,22% ± 11,50 e o Amitraz em sete, com 78,62% ± 24,47. Estatisticamente estes resultados não diferiram (P> 0,05 entre si.

  16. Effect of vaccination with a recombinant Bm86 antigen preparation on natural infestations of Boophilus microplus in grazing dairy and beef pure and cross-bred cattle in Brazil.

    Science.gov (United States)

    Rodríguez, M; Massard, C L; da Fonseca, A H; Ramos, N F; Machado, H; Labarta, V; de la Fuente, J

    1995-12-01

    Current methods for the control of the cattle tick Boophilus microplus infestations are not effective and the parasite remains a serious problem for the cattle industry in tropical and sub-tropical areas. Recent advances have introduced the possibility for the immunological control of the parasite through the use of recombinant vaccines. Recently, it was shown that the recombinant vaccine Gavac (Heber Biotec S.A.) is able to control B. microplus populations in artificially infected grazing dairy cattle in Cuba. To assay the effect of the vaccine on a different B. microplus strain and under different ecological conditions, we conducted a trial in Brazil on grazing dairy and beef pure and cross-bred cattle under natural infestation conditions. A farm in the northeast of the state of Sao Paulo was selected and two groups of animals per breed were included in the experiment and were maintained grazing on separate but similar pastures. For each breed, one group was vaccinated with the vaccine Gavac and the second group was not vaccinated and was employed as a control. In vaccinated cattle, during 36 weeks of experiment, the average infestation rate was maintained below 78 ticks per animal while average infestation peaks (mean +/- S.E.) of 144 +/- 44 ticks per animal (for dairy cross-bred cattle) and 195 +/- 42 ticks per animal (for beef cross-bred cattle) were recorded in the control groups. Tick infestation rates showed statistical significant differences (p = 0.04) between both experimental groups throughout the experiment. These results clearly showed, as in the Cuban study, that the vaccine controlled tick numbers in successive generations in the field. PMID:8701597

  17. Utilización del Boophilus microplus como remedio isopático en el control del ectoparásito en el Municipio de Aguazul (Casanare

    Directory of Open Access Journals (Sweden)

    Francisco Javier Niño Murcia

    2005-12-01

    Full Text Available En este estudio se demostró la efectividad de un remedio isopático vía oral, para el control de la garrapata Boophilus microplus, inocuo para los animales, medio ambiente y el hombre, evitando residuos de plaguicidas en el producto final. La investigación se realizó en una finca ubicada en el municipio de Aguazul (Casanare; localizada a los 05°10’23’’ de latitud norte y 72°33’17’’ de longitud oeste desde Greenwich, altitud: 300 msnm, temperatura media: 27ÚC. Precipitación anual media: 2.441 mm. Se contó con 32 animales de doble propósito; con la propuesta adoptada por la Corporación Colombiana de Investigación Agropecuaria, CORPOICA, en cuanto al Manejo Integrado de Plagas (MIP; acerca del control ejercido con base en niveles críticos, se inició con un conteo de garrapatas, con un tamaño entre 4.5 mm y 8 mm, por un lado del cuerpo del animal; animales con más de 20 garrapatas, entraban en el proceso de investigación, se les administró el remedio isopático, el cual correspondía al grupo A, y el placebo el cual correspondió con el grupo B, durante cuatro días consecutivos. Se administraron dos potencias del remedio, la primera con nueve centésimal (9 C, la cual no tuvo ningún efecto sobre la garrapata, la segunda potencia treinta centesimal (30 C, con la cual se observaron los resultados propuestos sobre la garrapata, se hace un segundo conteo de garrapatas con los mismos tamaños para verificar la efectividad de la segunda potencia; veinticinco días después de la administración, se hizo un último conteo de garrapatas con los mismos tamaños con los cuales se partió. Se utilizó la técnica experimental de doble ciego para obtener datos más veraces. El estudio estadístico se realizó por la técnica de análisis operacional de varianza de dos factores con varias muestras por grupo; los recuentos de garrapatas se trasformaron a la expresión logarítmica: t = Log 10 (X+1, donde X es el recuento de

  18. Caracterização do controle de Haematobia irritans e Rhipicephalus (Boophilus microplus no Triângulo Mineiro e Alto Paranaíba, Minas Gerais Characterization of Haematobia irritans and Rhipicephalus (Boophilus microplus control in Triângulo Mineiro and Alto Paranaíba, Minas Gerais

    Directory of Open Access Journals (Sweden)

    Luísa N. Domingues

    2012-12-01

    Full Text Available O controle eficaz de Haematobia irritans (mosca-dos-chifres e Rhipicephalus (Boophilus microplus (carrapato-do-boi é um fator crucial à maior rentabilidade da pecuária brasileira, porém ainda constitui-se um desafio. Um maior conhecimento das práticas adotadas no combate destes parasitos faz-se necessário para que se possam estruturar estratégias de controle mais próximas da realidade do produtor rural e mais fáceis de serem executadas. Este estudo caracterizou, através de entrevistas, as práticas adotadas no controle desses ectoparasitos em 23 propriedades da mesorregião do Triângulo Mineiro e Alto Paranaíba, Minas Gerais. A maioria dos entrevistados reconheceu a importância desses parasitos para a atividade pecuária, entretanto, diversos problemas relativos ao controle parasitário foram observados. O controle da mosca-dos-chifres e do carrapato-do-boi era uma prática rotineira em, respectivamente, 17,4% e 95,7% das propriedades, geralmente realizado em função de elevado grau de infestação dos animais. Mais de seis aplicações de ectoparasiticidas eram realizadas por ano em todas as propriedades que empregavam tratamentos para o controle da mosca e em 76,5% daquelas que combatiam o carrapato. Os produtos eram aplicados principalmente com bombas costais manuais (63,6% e sem a contenção dos animais em 45,5% das propriedades. A diluição dos produtos segundo recomendações dos fabricantes era realizada por 45,4% dos entrevistados, porém, 63,6% aplicavam um volume de solução por animal menor do que o tecnicamente recomendado. Utilizava-se principalmente a associação de piretróides e organofosforados para o controle de ambos os parasitos. Apesar de utilizar rotineiramente ectoparasiticidas, o uso de equipamento de proteção individual (EPI não era comum entre os entrevistados. A maioria dos entrevistados conhecia algumas características epidemiológicas dos parasitos, entretanto, o controle parasitário adotado na

  19. Expressed gene sequences from adult ovary and adult female gut genes over-expressed upon Babesia bovis infection of Rhipcephalus (Boophilus) microplus

    Science.gov (United States)

    Boophilus ticks are vectors of Babesia bovis, the protozoan causative agent of cattle fever, a disease which is responsible for significant production losses to cattle producers in much of Africa, Central and South America and Australia. We utilized subtractive cDNA library synthesis techniques to o...

  20. 3β-O-Tigloylmelianol from Guarea kunthiana: A New Potential Agent to Control Rhipicephalus (Boophilus) microplus, a Cattle Tick of Veterinary Significance

    OpenAIRE

    Carlos Henrique Miguita; Carolina da Silva Barbosa; Lidilhone Hamerski; Ulana Chaves Sarmento; José Nicácio do Nascimento; Walmir Silva Garcez; Fernanda Rodrigues Garcez

    2014-01-01

    Chemical investigation of Guarea kunthiana fruits, guided by their effect on the reproductive cycle of engorged females of the cattle tick Rhipicephalus (Boophilus) microplus—a major economic problem to the livestock industry worldwide—led to isolation of 3β-O-tigloylmelianol, a new protolimonoid, from the bioactive hexane phase obtained by partitioning the crude ethanol extract. An adult immersion test was performed. The compound strongly inhibited egg-laying and hatchability (99.2% effect...

  1. Detección de resistencia a los acaricidas en la garrapata del ganado Boophilus microplus mediante análisis de zimogramas

    OpenAIRE

    Estefan Miranda Miranda; Jorge Miranda Osorio; Raquel Cossío Bayúgar

    2005-01-01

    La identificación de resistencia a los productos acaricidas en la garrapata B. microplus, se hace mediante un complicado bioensayo, que requiere garrapatas de referencia y de campo cultivadas sobre bovinos vivos y restringidos durante semanas. Con el fin de evaluar una posible alternativa diagnóstica, se hicieron ensayos enzimáticos en geles de poliacrilamida- SDS, usando extractos de larvas de garrapatas provenientes de cuatro cepas de referencia con diferentes niveles de resistencia y susce...

  2. [Molecular analysis of the antigenic sequence (SBm7462®) from Bm86 of the Rhipicephalus (Boophilus) microplus and similarity with Rhipicephalus sanguineus and Hyalomma anatolicum anatolicum].

    Science.gov (United States)

    Peconick, Ana P; Sossai, Sidimar; Medeiros, Carla L; Carvalho, Gabriel D; Vargas, Marlene I; Patarroyo, Joaquín H

    2008-09-01

    The vaccination represents optimum method evaluated with effective cost to prevent economic losses and to increase the duration and quality of life of the production animals. . Diverse vaccines are produced from the intestinal protein Bm86 of the Rhipicephalus. (B.) microplus. The knowledge of the conservation of the gene bm86 is very important to evaluate the vaccine efficiency and the possibility of reaction crossed between different species of ticks. Samples of R. (B.) microplus come from different localities had been sequenced. The analyses of multiple alignments of the sequences had been made through the BioEdit program 7.0.5.3 version and the verification of polymorphism for visual inspection. In this work the alignment of all was become fulfilled sequences using itself BLAST in the search for similarity. Similarity was observed enters the sequenced fragments of R. (B.) microplus with the sequence of the protein Rs86 de Rhipicephalus sanguineus and with protein HA98 of the tick Hyalomma anatolicum anatolicum. The results give molecular support to synthetic the vaccine use based in the gene bm86 (SBm7462®) to be used in different species of ticks. PMID:20059809

  3. Acaricidal effects of fluazuron (2.5 mg/kg) and a combination of fluazuron (1.6 mg/kg) + ivermectin (0.63 mg/kg), administered at different routes, against Rhipicephalus (Boophilus) microplus parasitizing cattle.

    Science.gov (United States)

    Gomes, Lucas Vinicius Costa; Lopes, Welber Daniel Zanetti; Cruz, Breno Cayeiro; Teixeira, Weslen Fabricio; Felippelli, Gustavo; Maciel, Willian G; Bichuette, Murilo Abud; Ruivo, Maycon A; Alcantara Colli, Marcos Henrique; Carvalho, Rafael Silveira; Martinez, Antonio Campanha; Soares, Vando Edésio; da Costa, Alvimar José

    2015-06-01

    The present study aimed to evaluate the acaricidal efficacy of fluazuron (2.5 mg/kg), administered as a pour-on, in comparison to an injectable formulation containing fluazuron (1.6 mg/kg) + ivermectin (0.63 mg/kg), against Rhipicephalus (Boophilus) microplus in naturally and experimentally infested cattle. Two studies were conducted with different tick strains, one with artificial infestations (Stall Test, using leight animals per group) and one with natural infestations (utilizing ten animals per group). In both studies, the animals were randomized, according to average tick counts performed on days -3, -2 and -1, into four groups: T01, negative control (saline solution); T02, pour-on fluazuron (2.5 mg/kg); T03: subcutaneous fluazuron (1.6 mg/kg) + ivermectin (0.63 mg/kg); and T04 subcutaneous ivermectin (0.63 mg/kg). Based on obtained results, and considering the utilized tick strains, it was possible to conclude that the pour-on fluazuron (2.5 mg/kg) formulation demonstrated high acaricidal efficacy, with protection periods ranging from 49 to 77 days against Rhipicephalus (Boophilus) microplus. On the other hand, for the injectable fluazuron (1.6 mg/kg) + ivermectin (0.63 mg/kg) formulation, it was not possible to observe elevated anti-R. (B.) microplus effect on both artificial and experimental infestation studies. Results observed for this combination were similar or inferior to those obtained by subcutaneous ivermectin (0.63 mg/kg). Future studies with this formulation containing fluazuron (1.6 mg/kg) + ivermectin (0.63 mg/kg), regarding pharmacokinetic and/or bioavailability profiles, or even studies analyzing both this active principles separately, are needed, seeking to better understand the effects of such combination against Rhipicephalus (Boophilus) microplus parasitizing cattle. PMID:25728230

  4. A Mitochondrial Membrane Exopolyphosphatase Is Modulated by, and Plays a Role in, the Energy Metabolism of Hard Tick Rhipicephalus (Boophilus microplus Embryos

    Directory of Open Access Journals (Sweden)

    Carlos Logullo

    2011-06-01

    Full Text Available The physiological roles of polyphosphates (polyP recently found in arthropod mitochondria remain obscure. Here, the relationship between the mitochondrial membrane exopolyphosphatase (PPX and the energy metabolism of hard tick Rhipicephalus microplus embryos are investigated. Mitochondrial respiration was activated by adenosine diphosphate using polyP as the only source of inorganic phosphate (Pi and this activation was much greater using polyP3 than polyP15. After mitochondrial subfractionation, most of the PPX activity was recovered in the membrane fraction and its kinetic analysis revealed that the affinity for polyP3 was 10 times stronger than that for polyP15. Membrane PPX activity was also increased in the presence of the respiratory substrate pyruvic acid and after addition of the protonophore carbonyl cyanide-p-trifluoromethoxyphenylhydrazone. Furthermore, these stimulatory effects disappeared upon addition of the cytochrome oxidase inhibitor potassium cyanide and the activity was completely inhibited by 20 µg/mL heparin. The activity was either increased or decreased by 50% upon addition of dithiothreitol or hydrogen peroxide, respectively, suggesting redox regulation. These results indicate a PPX activity that is regulated during mitochondrial respiration and that plays a role in adenosine-5’-triphosphate synthesis in hard tick embryos.

  5. Acaricidal properties of vetiver essential oil from Chrysopogon zizanioides (Poaceae) against the tick species Amblyomma cajennense and Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Campos, Roseane Nunes de Santana; Nascimento Lima, Cecília Beatriz; Passos Oliveira, Alexandre; Albano Araújo, Ana Paula; Fitzgerald Blank, Arie; Barreto Alves, Péricles; Nascimento Lima, Rafaely; Albano Araújo, Vinícius; Santana, Alisson Silva; Bacci, Leandro

    2015-09-15

    Ticks are arthropods widely distributed in tropical and subtropical regions, which can transmit infectious agents also responsible for zoonoses. Excessive use of conventional acaricides has resulted in the onset of drug resistance by these parasites, thus the need to use alternative methods for their control. This study evaluated the acaricidal activities of Chrysopogon zizanioides (vetiver) essential oils containing different zizanoic and khuzimol (high and low acidity) acid concentrations on Amblyomma cajennense and Rhipicephalus microplus (Acari: Ixodidae). To this aims, toxicity tests of different concentrations of examined essential oils were conducted on adult females and larval stages. Results showed that the essential oils of C. zizanioides with high and low acidity reduced oviposition of females, eggs hatch and larval survival, being more effective than some commercial products widely used to control these ectoparasites. These results indicate that the C. zizanoides essential oils are promising candidates as acaricidal agents and represent also an add value to vetiver oil with high acidity, which is commercially undervalued in the cosmetic industry. PMID:26359641

  6. Molecular analysis of Boophilus spp. (Acari: Ixodidae) tick strains.

    Science.gov (United States)

    Fuente, J; García-García, J C; González, D M; Izquierdo, G; Ochagavia, M E

    2000-10-01

    Boophilus spp. (Acari: Ixodidae) parasitize cattle and other farm and wild animals in tropical and subtropical regions of the world. Ticks belonging to the genus Boophilus have undergone evolutionary processes associated with habitat adaptation following biogeographical separation, resulting in strains with marked morphological differences. We have characterized at the molecular level B. microplus strains from Latin America and Australia, employing sequences derived from the bm86 coding region, an intron located within the bm86 gene, and DNA short tandem repeats (STR). A B. annulatus strain was employed for comparison. The results indicated that variation within the bm86 coding region is higher between B. microplus strains than between some B. microplus strains and B. annulatus. The sequence of the intron was not informative for phylogenetic analysis, varying among individuals of the same strain. Two STRs were identified in B. microplus (STRs BmM1 and BmM2) and one in B. annulatus (STR Ba1). Southern hybridization experiments with STRs BmM1 and BmM2 as a probe revealed the prevalence of dispersed moderately repeated DNA in the genome of B. microplus. The analysis of polymorphism at STR locus BmM1 evidenced differences within and between populations of B. microplus. These results support at the molecular level the existing differences between B. microplus strains and suggest tools to characterize these populations. PMID:10962158

  7. Effects of fluazuron (2.5 mg/kg) and a combination of fluazuron (3.0 mg/kg) + abamectin (0.5 mg/kg) on the reproductive parameters of a field population of Rhipicephalus (Boophilus) microplus on experimentally infested cattle.

    Science.gov (United States)

    Cruz, Breno Cayeiro; Teixeira, Weslen Fabricio Pires; Maciel, Willian Giquelin; Felippelli, Gustavo; Fávero, Flávia Carolina; Cruz, André Cayeiro; Buzzulini, Carolina; Soares, Vando Edésio; Gomes, Lucas Vinicius Costa; Lopes, Welber Daniel Zanetti; de Oliveira, Gilson Pereira; da Costa, Alvimar José

    2014-08-01

    The current study assessed the deleterious effects of two formulations of fluazuron (2.5 mg/kg fluazuron and a combination of 3.0 mg/kg fluazuron + 0.5 mg/kg abamectin) on the reproductive parameters of engorged Rhipicephalus (Boophilus) microplus females that naturally detached from experimentally infested cattle in two experiments. Based on the obtained results, it can be concluded that fluazuron (2.5 mg/kg) showed deleterious effects only on the hatchability percentage in the period of 2-7 post-treatment days of this ectoparasite's engorged females. On the other hand, the fluazuron (3.0 mg/kg) + abamectin (0.5 mg/kg) combination presented harmful effects over reproductive parameters of this tick species. Further studies should be performed with a known tick population (reference susceptible strain) to determine the effect of these formulations on the reproductive parameters and to elucidate if this field population is fluazuron resistant. PMID:24837997

  8. Rhipicephalus microplus strain Deutsch, whole genome shotgun sequencing project Version 2

    Science.gov (United States)

    The cattle tick, Rhipicephalus (Boophilus) microplus, has a genome over 2.4 times the size of the human genome, and with over 70% of repetitive DNA, this genome would prove very costly to sequence at today's prices and difficult to assemble and analyze. Cot filtration/selection techniques were used ...

  9. Monophyly, divergence times, and evolution of host plant use inferred from a revised phylogeny of the Drosophila repleta species group.

    Science.gov (United States)

    Oliveira, Deodoro C S G; Almeida, Francisca C; O'Grady, Patrick M; Armella, Miguel A; DeSalle, Rob; Etges, William J

    2012-09-01

    We present a revised molecular phylogeny of the Drosophila repleta group including 62 repleta group taxa and nine outgroup species based on four mitochondrial and six nuclear DNA sequence fragments. With ca. 100 species endemic to the New World, the repleta species group represents one of the major species radiations in the genus Drosophila. Most repleta group species are associated with cacti in arid or semiarid regions. Contrary to previous results, maximum likelihood and Bayesian phylogenies of the 10-gene dataset strongly support the monophyly of the repleta group. Several previously described subdivisions in the group were also recovered, despite poorly resolved relationships between these clades. Divergence time estimates suggested that the repleta group split from its sister group about 21millionyears ago (Mya), although diversification of the crown group began ca. 16Mya. Character mapping of patterns of host plant use showed that flat leaf Opuntia use is common throughout the phylogeny and that shifts in host use from Opuntia to the more chemically complex columnar cacti occurred several times independently during the history of this group. Although some species retained the use of Opuntia after acquiring the use of columnar cacti, there were multiple, phylogenetically independent instances of columnar cactus specialization with loss of Opuntia as a host. Concordant with our proposed timing of host use shifts, these dates are consistent with the suggested times when the Opuntioideae originated in South America. We discuss the generally accepted South American origin of the repleta group. PMID:22634936

  10. Comparison of efficiency and reproductive aptitude indexes between a reference and field strains of the cattle tick Rhipicephalus (Boophilus microplus, in Sinaloa, Mexico Comparação dos índices de eficiência e aptidão reprodutiva entre uma cepa de referência e outra de campo do carrapato do gado, Rhipicephalus (Boophilus microplus, em Sinaloa, México

    Directory of Open Access Journals (Sweden)

    Soila Gaxiola-Camacho

    2009-12-01

    Full Text Available The objective of this work was to study the reproductive behavior of two strains of R. (B. microplus, one wild-caught (Native and one reference strain (Media Joya for two years, measuring the reproductive efficiency index (REI and reproductive aptitude index (RAI. Engorged ticks from each strain were collected monthly from February 2002 to February 2004. These were weighed and kept in the laboratory until egg-laying. Oogenic masses were individually weighed and incubated until larvae emergence. REI and RAI were calculated from each sample, grouping ticks by weight in 100 mg range classes. An analysis of variance and Duncan's multiple rank tests were carried out on the data (P O objetivo deste trabalho foi estudar a conduta reprodutiva de duas cepas de R. (B. microplus, uma coletada no campo (Nativa e outra de referência (Média Jóia, por dois anos, calculando o índice de eficiência reprodutiva (REI e o índice de aptidão reprodutiva (RAI. Foram coletados mensalmente carrapatos fêmeas engurgitadas de cada cepa no período de Fevereiro de 2002 a Fevereiro de 2004. Estas foram pesadas e conservadas no laboratório até ovipositar. As massas de ovos foram pesadas individualmente e incubadas até a eclosão das larvas. O REI e o RAI foram calculados para cada coleta, agrupando os carrapatos em classe de peso de 100 mg. Os dados foram submetidos a uma análise de variância e prova de classe múltipla de Duncan (P < 0,05. Foram calculados os coeficientes de correlação de Pearson (P < 0,01 para estimar a associação entre o peso dos carrapatos engurgitados e o peso e número de ovos postos e eclosionados. A cepa Nativa mostrou um peso ao engurgitamento mais alto do que a cepa Média Jóia. Os valores de REI e de RAI em ambas cepas foram similares em todos as classes de peso, mostrando tendência cuadrática na Média Jóia e linear-cuadrática na cepa Nativa (P < 0,05. Ambos os índices por classe de peso no engurgitamento foram sempre mais

  11. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  12. A revision of two distinct species of Rhipicephalus: R. microplus and R. australis

    Directory of Open Access Journals (Sweden)

    Abid Ali

    2016-01-01

    Full Text Available ABSTRACT: Rhipicephalus ( Boophilus species are monoxenous ticks with seasonal distribution in tropical and subtropical regions. For many years, Rhipicephalus microplus was considered as a single species; however, further analysis split these ticks into two distinct species. Because R. microplus and R. australis share similar attributes, it is hard to discriminate these two species and explain the changes in the classification of these parasites over the past decades. The reappearance of R. australis is an outcome of new research, which has afforded to better characterize these probably cryptic species. Evidence based on morphological features, the lack of conspecificity, microsatellite markers, mitochondrial 12S and 16S ribosomal DNA, and mitochondrial genome supports the re-classification of R. microplus as different species. Therefore, populations of R. microplus from Australia, Cambodia, Philippines, Indonesia, New Caledonia, Borneo, New Guinea, Tahiti and parts of Southeast Asia were recently reinstated as R. australis . Moreover, a better knowledge on the speciation between these two species could pave the way to important advances in tick control strategies.

  13. Lesser protein degradation machinery correlates with higher BM86 tick vaccine efficacy in Rhipicephalus annulatus when compared to Rhipicephalus microplus.

    Science.gov (United States)

    Popara, Marina; Villar, Margarita; Mateos-Hernández, Lourdes; de Mera, Isabel G Fernández; Marina, Anabel; del Valle, Mercedes; Almazán, Consuelo; Domingos, Ana; de la Fuente, José

    2013-10-01

    Infestations with cattle ticks, Rhipicephalus (Boophilus) microplus and Rhipicephalus annulatus, economically impact cattle production in tropical and subtropical regions of the world. Vaccines containing the recombinant R. microplus BM86 gut antigen were developed and commercialized to induce an immunological protection in cattle against tick infestations. These vaccines demonstrated that tick control by vaccination is cost-effective, reduces environmental contamination and prevents the selection of drug resistant ticks that result from repeated acaricide applications. The protection elicited by BM86-containing vaccines against tick infestations is mediated by a collaborative action between the complement system and IgG antibodies. The efficacy of the vaccination with BM86 and other tick antigens is always higher for R. annulatus than against R. microplus, suggesting that tick genetic and/or physiological factors may affect tick vaccine efficacy. These factors may be related to BM86 protein levels or tick physiological processes such as feeding and protein degradation that could result in more efficient antibody-antigen interactions and vaccine efficacy. To test this hypothesis, we compared the proteome in R. annulatus and R. microplus female ticks after feeding on BM86-vaccinated and control cattle. The results showed that cattle proteins were under represented in R. annulatus when compared to R. microplus, suggesting that R. annulatus ticks ingested less blood, a difference that increased when feeding on vaccinated cattle, probably reflecting the effect of antibody-BM86 interactions on this process. The results also showed that tick protein degradation machinery was under represented in R. annulatus when compared to R. microplus. BM86 mRNA and protein levels were similar in both tick species, suggesting that lesser protease activity in R. annulatus results in more efficient antibody-antigen interactions and higher vaccine efficacy. These results have important

  14. Genetic divergence within the Drosophila mayaguana subcluster, a closely related triad of Caribbean species in the repleta species group.

    Science.gov (United States)

    O'Grady, P M; Durando, C M; Heed, W B; Wasserman, M; Etges, W; Desalle, R

    2002-01-01

    The mayaguana triad of the Drosophila repleta species group includes D. mayaguana, D. straubae, and D. parisiena, the latter two of which are very similar when examined morphologically. Many morphological characters used to define these taxa are quantitative and overlap substantially among some forms--it is only through suites of such characters that species can be identified. We apply Population Aggregation Analysis and tree building methods to five rapidly evolving gene regions--the mitochondrial AT rich region and the nuclear acetylcholinesterase, hunchback, mastermind, and vestigial loci to test the morphological species delineations within the morphocryptic mayaguana triad. We find that D. mayaguana is diagnosable using DNA sequences, but the other two species form a non-diagnosable paraphyletic assemblage. A single ecological factor, oviposition substrate, is an important diagnostic character distinguishing D. straubae from D. parisiena, highlighting the importance of examining a diverse array of data (morphological, molecular, ecological, and behavioral) when defining species limits. PMID:12471672

  15. Histoarchitecture of the Ovary of Rhipicephalus (Boophilus annulatus during Pre- and Postengorgement Period

    Directory of Open Access Journals (Sweden)

    Sreelekha Kanapadinchareveetil

    2015-01-01

    Full Text Available The present communication describes the detailed day wise study of histological changes of the ovary of Rhipicephalus (Boophilus annulatus in the postengorgement period together with the systematic classification of their oocytes. The ovary of R. (B. annulatus is panoistic type with an asynchronous development of oocytes. All the stages (II, III, IV, and V of oocytes except stage I were similar to R. (B. microplus. The stage I oocytes showed basophilia, which was not reported earlier in other species of ticks. Day wise changes were in the form of presence of oogonia in partially fed and day one engorged adults, considerable degeneration of oocytes on day two, emergence of new wave of oocytes on day three, presence of mature oocytes up to day eight, and complete degeneration of ovarian tissue from day eight onwards. The degenerative changes in the ovary appeared initially in the oocytes followed by germinal epithelium.

  16. A simulation study of the effects of acaricides and vaccination on Boophilus cattle-tick populations.

    Science.gov (United States)

    Lodos, J; Ochagavia, M E; Rodriguez, M; De La Fuente, J

    1999-01-01

    This paper describes a simulation model to evaluate different control strategies for Boophilus microplus. The model combines a dynamic life-history module for tick-population dynamics with other modules for vaccination, sterile-hybrid larval release and use of acaricide dipping vats. The tick life-history module considers the cattle's nutritional level and allows for distribution of ticks by age at all stages of growth. Appropriately, the model was sensitive to host resistance and to host-nutritional status. The validity of the life-history module--as well as that of the vaccination and acaricide dipping--vats modules--was demonstrated by comparing simulated and real data for several geographical locations in Cuba and Brazil. Optimum tick-control strategies for the first year of vaccination were designed and the effect of long-term vaccination on tick population was also studied. PMID:10022052

  17. Vaccination against ticks (Boophilus spp.): the experience with the Bm86-based vaccine Gavac.

    Science.gov (United States)

    de la Fuente, J; Rodríguez, M; Montero, C; Redondo, M; García-García, J C; Méndez, L; Serrano, E; Valdés, M; Enríquez, A; Canales, M; Ramos, E; Boué, O; Machado, H; Lleonart, R

    1999-11-01

    The control of tick infestations and the transmission of tick-borne diseases remain a challenge for the cattle industry in tropical and subtropical areas of the world. Traditional control methods have been only partially successful and the parasites continue to result in significant losses for the cattle industry. Recently, vaccines containing the recombinant B. microplus gut antigen Bm86 have been developed. Our vaccine formulation (Gavac, Heber Biotec S.A., Havana, Cuba) has been registered and is commercially available in Cuba, Colombia, Dominican Republic, Brazil and Mexico. In controlled pen trials, Gavac has been effective for the control of artificial infestations of B. annulatus, B. decoloratus and chemical-sensitive and resistant B. microplus strains from Australia, Africa, America and Iran. In controlled field trials in Cuba, Brazil, Argentina and Mexico, Gavac has shown a 55-100% efficacy in the control of B. microplus infestations in grazing cattle 12-36 weeks after the first vaccination. Field trials under production conditions have been conducted in Cuba, Colombia, Brazil and Mexico in pure and cross-bred cattle herds. The application of Gavac has increased the time between acaricide treatments by an average of 32 /-21 days (P = 0.0005) resulting in important savings for the cattle industry. In Cuba, a cost-effectiveness analysis was conducted in more than 260000 animals. The cost-effectiveness analysis showed a 60% reduction in the number of acaricide treatments, together with the control of tick infestations and transmission of babesiosis, which resulted in savings of 23.4 dollars animal(-1) year (-1). These results clearly demonstrate the advantage of vaccination and support the application of Gavac for the control of Boophilus spp. infestations. PMID:10596754

  18. Acaricidal activity of synthesized titanium dioxide nanoparticles using Calotropis gigantea against Rhipicephalus microplus and Haemaphysalis bispinosa

    Institute of Scientific and Technical Information of China (English)

    Sampath Marimuthu; Moorthy Iyappan; Chinnadurai Siva; Loganathan Karthik; Kokati Venkata Bhaskara Rao; Abdul Abdul Rahuman; Chidambaram Jayaseelan; Arivarasan Vishnu Kirthi; Thirunavukkarasu Santhoshkumar; Kanayairam Velayutham; Asokan Bagavan; Chinnaperumal Kamaraj; Gandhi Elango

    2013-01-01

    Objective: To assess the acaricidal activity of titanium dioxide nanoparticles (TiO2 NPs) synthesized from flower aqueous extract of Calotropis gigantea (C. gigantea) against the larvae of Rhipicephalus (Boophilus) microplus [R. (B.) microplus] and the adult of Haemaphysalis bispinosa (H. bispinosa). Methods: The lyophilized C. gigantea flower aqueous extract of 50 mg was added with 100 mL of TiO(OH)2 (10 mM) and magnetically stirred for 6 h. Synthesized TiO2 NPs were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Scanning electron microscopy (SEM), and Energy dispersive X-ray spectroscopy (EDX). The synthesised TiO2 NPs were tested against the larvae of R. (B.) microplus and adult of H. bispinosa were exposed to filter paper impregnated method. Results:XRD confirmed the crystalline nature of the nanoparticles with the mean size of 10.52 nm. The functional groups for synthesized TiO2 NPs were 1 405.19, and 1 053.45 cm-1 for-NH2 bending, primary amines and amides and 1 053.84 and 1 078.45 cm-1 for C-O. SEM micrographs of the synthesized TiO2 NPs showed the aggregated and spherical in shape. The maximum efficacy was observed in the aqueous flower extract of C. gigantea and synthesized TiO2 NPs against R. (B.) microplus (LC50=24.63 and 5.43 mg/L and r2=0.960 and 0.988) and against H. bispinosa (LC50=35.22 and 9.15 mg/L and r2=0.969 and 0.969), respectively. Conclusions: The synthesized TiO2 NPs were highly stable and had significant acaricidal activity against the larvae of R. (B.) microplus and adult of H. bispinosa. This study provides the first report of synthesized TiO2 NPs and possessed excellent anti-parasitic activity.

  19. Vaccination of cattle with TickGARD induces cross-reactive antibodies binding to conserved linear peptides of Bm86 homologues in Boophilus decoloratus.

    Science.gov (United States)

    Odongo, David; Kamau, Lucy; Skilton, Robert; Mwaura, Stephen; Nitsch, Cordula; Musoke, Anthony; Taracha, Evans; Daubenberger, Claudia; Bishop, Richard

    2007-01-26

    Vaccines based on recombinant Bm86 gut antigen from Boophilus microplus are a useful component of integrated control strategies against B. microplus infestations of cattle. The capacity of such vaccines to control heterologous infestations by two African tick species was investigated. The mean weight of engorged female ticks and mean egg mass per tick were significantly reduced in B. decoloratus infestations, but there was no effect of the vaccine against adult Rhipicephalus appendiculatus. We cloned, sequenced and expressed two Bm86 homologues (Bd86) from B. decoloratus. Amino acid sequence identity between Bd86 homologues (Bd86-1 and Bd86-2) and Bm86 was 86% and 85%, respectively, compared to 93% identity between the variants. Native Bd86 protein in B. decoloratus tick mid-gut sections and recombinant Bd86-1 reacted strongly with sera from TickGARD vaccinated cattle. TickGARD can therefore protect against a heterologous tick species with multiple antigen sequences. Epitope mapping using sera from TickGARD-vaccinated cattle identified two linear peptides conserved between the Bd86 homologues and Bm86. These epitopes represent candidate synthetic peptide vaccines for control of Boophilus spp. and the pathogens transmitted by these tick vectors. PMID:17070625

  20. Acaricidal properties of Ricinus communis leaf extracts against organophosphate and pyrethroids resistant Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Ghosh, Srikanta; Tiwari, Shashi Shankar; Srivastava, Sharad; Sharma, Anil Kumar; Kumar, Sachin; Ray, D D; Rawat, A K S

    2013-02-18

    Indian cattle ticks have developed resistance to commonly used acaricides and an attempt has been made to formulate an ecofriendly herbal preparation for the control of acaricide resistant ticks. A 95% ethanolic extract of Ricinus communis was used to test the efficacy against reference acaricide resistant lines by in vitro assay. In in vitro assay, the extract significantly affects the mortality rate of ticks in dose-dependent manner ranging from 35.0 ± 5.0 to 95.0 ± 5.0% with an additional effect on reproductive physiology of ticks by inhibiting 36.4-63.1% of oviposition. The leaf extract was found effective in killing 48.0, 56.7 and 60.0% diazinon, deltamethrin and multi-acaricide resistant ticks, respectively. However, the cidal and oviposition limiting properties of the extract were separated when the extract was fractionated with hexane, chloroform, n-butanol and water. The HPTLC finger printing profile of R. communis leaf extract under λ(max.) - 254 showed presence of quercetin, gallic acid, flavone and kaempferol which seemed to have synergistic acaricidal action. In vivo experiment resulted in 59.9% efficacy on Ist challenge, however, following 2nd challenge the efficacy was reduced to 48.5%. The results indicated that the 95% ethanolic leaf extract of R. communis can be used effectively in integrated format for the control of acaricide resistant ticks. PMID:23084038

  1. Nuclear glycogen synthase kinase-3 β (GSK-3) in Rhipicephalus (Boophilus) microplus tick embryogenesis

    International Nuclear Information System (INIS)

    Full text: Glycogen synthase kinase-3 (GSK3) is recognized as a key component of a large number of cellular processes and diseases. Several mechanisms play a part in controlling the actions of GSK3, including phosphorylation, protein complex formation, and subcellular distribution. Recent observations point to functions for phosphorylases several transcription factors in the nucleus. Also, GSK3b participate of the canonical W nt signalling pathway, which has been studied intensively in embryonic and cancer cells. Like in many other signaling pathways, most components in W nt signal transduction were highly conserved during the evolution. More than 40 proteins have been reported to be phosphorylated by GSK3, including over a dozen transcription factors. Although the mechanisms regulating GSK3 are not fully understood, precise control appears to be achieved by a combination of phosphorylation, localization, and interactions with GSK3-binding proteins. Although GSK3 is traditionally considered a cytosolic protein, it is also present in nuclei. Nuclear GSK3 is particularly interesting because of the many transcription factors that it regulates enabling GSK3 to influence many signaling pathways that converge on these transcription factors, thereby regulating the expression of many genes. Our group identified that GSK-3 β could be detected in different stage eggs of R. micro plus. In this work we detected the GSK-3 in isolated nuclear fraction from the egg homogenates of R. micro plus by western-blot analysis, using anti-GSK- 3 β antibodies. The enzyme activity was also detected radiochemically throughout embryogenesis in same fraction. The GSK-3 activity was inhibiting by using SB 216763 (selective molecule inhibitors of GSK-3). Taken together our results suggest that GSK-3 β isoform probably is involved in gene transcription factors during R. micro plus embryo development

  2. Reproductive and safety assessment of vaccination with Gavac against the cattle tick (Boophilus microplus).

    Science.gov (United States)

    Boué, O; Redondo, M; Montero, C; Rodríguez, M; de la Fuente, J

    1999-06-01

    Recent developments in cattle tick control have incorporated the use of recombinant Bm86 vaccines against this ectoparasite. The vaccine developed by our group (Gavac) contains an antigen expressed in Pichia pastoris, and has been successfully employed for the control of tick infestations and transmission of tick-borne diseases. Here, we examined the safety and effect of the Gavac vaccine on reproductive parameters in cattle. Toxicity tests in mice and guinea pigs demonstrated the safety of Gavac. To study the adverse effects of vaccination on reproduction, a field trial involving 9,500 animals in Cuba was conducted. The cattle at 3 farms were vaccinated while those on a fourth farm were left unvaccinated and served as the control. Following vaccination, the control of tick infestation and the transmission of babesiosis were used to demonstrate the efficacy of the vaccine. No adverse effects were observed in any of the reproductive parameters studied when comparing the data before and after vaccination with Gavac and between the vaccinated farms and the control farm. These results demonstrate that under the conditions of our study vaccination with Gavac is safe for use on cattle. PMID:10729081

  3. Cloning and expression of a protective antigen from the cattle tick Boophilus microplus.

    OpenAIRE

    Rand, K N; Moore, T.; Sriskantha, A; Spring, K; Tellam, R; P. Willadsen; Cobon, G S

    1989-01-01

    Glycoproteins located on the luminal surface of the plasma membrane of tick gut epithelial cells, when used to vaccinate cattle, are capable of stimulating an immune response that protects cattle against subsequent tick infestation. One such tick gut glycoprotein, designated Bm86, has been purified to homogeneity and the amino acid sequences of peptide fragments generated by endoproteinase Lys-C digestion have been determined. We report here the isolation and characterization of a cDNA that e...

  4. Analysis of Babesia bovis-induced gene expression changes in the cattle tick, Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    Background: Cattle babesiosis is a tick-borne disease of cattle that has severe economic impact on cattle producers throughout the world's tropical and subtropical countries. The most severe form of the disease is caused by the apicomplexan, Babesia bovis, and transmitted to cattle through the bite ...

  5. Nuclear glycogen synthase kinase-3 {beta} (GSK-3) in Rhipicephalus (Boophilus) microplus tick embryogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Mentzingen, Leticia; Andrade, Josiana G. de; Logullo, Carlos [Universidade Estadual do Norte Fluminense Darcy Ribeiro (UENF), Campos dos Goytacazes, RJ (Brazil). Centro de Biociencias e Biotecnologia. Lab. de Quimica e Funcao de Proteinas e Peptideos (LQFPP); Andrade, Caroline P. de; Vaz Junior, Itabajara [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Centro de Biotecnologia

    2008-07-01

    Full text: Glycogen synthase kinase-3 (GSK3) is recognized as a key component of a large number of cellular processes and diseases. Several mechanisms play a part in controlling the actions of GSK3, including phosphorylation, protein complex formation, and subcellular distribution. Recent observations point to functions for phosphorylases several transcription factors in the nucleus. Also, GSK3b participate of the canonical W nt signalling pathway, which has been studied intensively in embryonic and cancer cells. Like in many other signaling pathways, most components in W nt signal transduction were highly conserved during the evolution. More than 40 proteins have been reported to be phosphorylated by GSK3, including over a dozen transcription factors. Although the mechanisms regulating GSK3 are not fully understood, precise control appears to be achieved by a combination of phosphorylation, localization, and interactions with GSK3-binding proteins. Although GSK3 is traditionally considered a cytosolic protein, it is also present in nuclei. Nuclear GSK3 is particularly interesting because of the many transcription factors that it regulates enabling GSK3 to influence many signaling pathways that converge on these transcription factors, thereby regulating the expression of many genes. Our group identified that GSK-3 {beta} could be detected in different stage eggs of R. micro plus. In this work we detected the GSK-3 in isolated nuclear fraction from the egg homogenates of R. micro plus by western-blot analysis, using anti-GSK- 3 {beta} antibodies. The enzyme activity was also detected radiochemically throughout embryogenesis in same fraction. The GSK-3 activity was inhibiting by using SB 216763 (selective molecule inhibitors of GSK-3). Taken together our results suggest that GSK-3 {beta} isoform probably is involved in gene transcription factors during R. micro plus embryo development.

  6. Exploring the use of an anti-tick vaccine as a tool for the integrated eradication of the cattle fever tick, Rhipicephalus (Boophilus) annulatus.

    Science.gov (United States)

    Miller, Robert; Estrada-Peña, Agustín; Almazán, Consuelo; Allen, Andrew; Jory, Lauren; Yeater, Kathleen; Messenger, Matthew; Ellis, Dee; Pérez de León, Adalberto A

    2012-08-17

    Bovine babesiosis, also known as cattle fever, is a tick-borne protozoal disease foreign to the United States. It was eradicated by eliminating the vector species, Rhipicephalus (Boophilus) annulatus and Rhipicephalus (Boophilus) microplus, through the efforts of the Cattle Fever Tick Eradication Program (CFTEP), with the exception of a permanent quarantine zone (PQZ) in south Texas along the border with Mexico. Keeping the U.S. free of cattle fever ticks in a sustainable manner is a critical national agricultural biosecurity issue. The efficacy of a Bm86-based anti-tick vaccine commercialized outside of the U.S. was evaluated against a strain of R. annulatus originated from an outbreak in Texas. Vaccination controlled 99.9 and 91.4% of the ticks 8 weeks and 5.5 months after the initial vaccination, respectively. Computer modeling of habitat suitability within the PQZ typically at risk of re-infestation with R. annulatus from Mexico predicted that at a level of control greater than 40%, eradication would be maintained indefinitely. Efficacy and computer modeling data indicate that the integration of vaccination using a Bm86-based anti-tick vaccine with standard eradication practices within the northwestern half of the PQZ could incentivize producers to maintain cattle on pasture thereby avoiding the need to vacate infested premises. Implementing this epidemiologically proactive strategy offers the opportunity to prevent R. annulatus outbreaks in the U.S., which would represent a significant shift in the way the CFTEP operates. PMID:22687762

  7. Humoral immune response of dairy cattle immunized with rBm95 (KU-VAC1) derived from Thai Rhipicephalus microplus.

    Science.gov (United States)

    Jittapalapong, S; Kaewhom, P; Kengradomkij, C; Saratapan, N; Canales, M; de la Fuente, J; Stich, R W

    2010-04-01

    Rhipicephalus (Boophilus) microplus is an important cause of economic losses in Thailand through direct effects of feeding on cattle and pathogen transmission. Current tick control methods rely on expensive chemical acaricides that result in environmental contamination, residues in food animal products and acaricide-resistant ticks. Anti-tick vaccines based on concealed antigens have shown promising results in the control of cattle tick. Thus, recombinant Bm95 (rBm95) from Thai R. microplus (KU-VAC1) was cloned and expressed to test as an anti-tick vaccine in Thailand. The objective of this study was to compare antibody responses induced by KU-VAC1 to that obtained after vaccination with Gavac that is based on the Bm86 homologue. Four groups of six cattle each were immunized with KU-VAC1, Gavac, adjuvant or phosphate-buffered saline, and boosted three times at 21-day intervals. Enzyme-linked-immunosorbent serologic assay were used to measure the humoral antibody responses specific to Thai rBm95. Cattle immunized with either KU-VAC1 or Gavac showed significantly greater antibody production than the controls. Antibody titres were detected after the first immunization and peaked after the seventh week. These results indicated that KU-VAC1 and Gavac are similarly immunogenic, and that further studies are warranted to compare performance parameters of ticks fed on immunized cattle. PMID:20537117

  8. Bm86 antigen induces a protective immune response against Boophilus microplus following DNA and protein vaccination in sheep.

    Science.gov (United States)

    De Rose, R; McKenna, R V; Cobon, G; Tennent, J; Zakrzewski, H; Gale, K; Wood, P R; Scheerlinck, J P; Willadsen, P

    1999-11-30

    Vaccination of sheep with a plasmid bearing the full length gene for the tick antigen Bm86 either alone or co-administered with plasmid carrying the ovine genes for the cytokines, granulocyte and macrophage colony stimulating factor (GM-CSF) or interleukin (IL)-1beta induced a relatively low level of protection against subsequent tick infestation. This tick damage reached statistical significance only for the groups which were vaccinated with plasmid encoding for Bm86, co-administered with plasmid encoding for ovine GM-CSF. Antibody titres measured against Bm86 were also low in all groups injected with the Bm86 DNA vaccine. Antibody production and anti-tick effect were significantly less than that achieved by two vaccinations with recombinant Bm86 protein. In all cases only a low level of antigen-specific stimulation of peripheral blood lymphocytes was recorded, as measured either by the incorporation of tritiated thymidine or the release of IFN-gamma. Injection of DNA encoding for Bm86, either alone or with co-administered cytokine genes, did however prime for a strong subsequent antibody response following a single injection of recombinant Bm86 protein in adjuvant. Antibody production nevertheless appeared to be slightly less effective than following two vaccinations with recombinant protein. The persistence of antibody following vaccination was the same regardless of the method of primary sensitization. In all cases the half-life of the antibody response was approximately 40-50 days indicating that, in contrast to results reported in mice, DNA vaccination in sheep did not result in sustained antibody production. PMID:10587297

  9. Persistently Infected Calves as Reservoirs for Acquisition and Transovarial Transmission of Babesia bovis by Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    Babesia bovis is a deadly disease of cattle resulting in severe economic losses in the vast regions of the world where it is endemic. If re-introduced into the United States, babesiosis would cause significant mortality in the naïve cattle population. In order to address the risk to U.S. cattle, i...

  10. Ixodid ticks of traditionally managed cattle in central Nigeria: where Rhipicephalus (Boophilus) microplus does not dare (yet?)

    OpenAIRE

    Lorusso, Vincenzo; Picozzi, Kim; de Bronsvoort, Barend Mc; Majekodunmi, Ayodele; Dongkum, Charles; Balak, Gyang; Igweh, Augustine; Welburn, Susan C

    2013-01-01

    Background Ticks and tick-borne diseases (TBDs) undermine cattle fitness and productivity in the whole of sub-Saharan Africa, including Nigeria. The aim of this study was to document the composition of tick species, assessing the burden of infestation, in traditionally managed cattle in an area of central Nigeria where acaricides have not been used historically. Methods The study was carried out in September 2010 in 9 villages belonging to three neighbouring local government areas in Plateau ...

  11. Effect of the association of cattle and rusa deer (Cervus timorensis russa) on populations of cattle ticks (Boophilus microplus).

    Science.gov (United States)

    Barre, N; Bianchi, M; De Garine-Wichatitsky, M

    2002-10-01

    The wild population of rusa deer (Cervus timorensis russa) in New Caledonia (South Pacific) is nearly as large as the cattle population. The cattle tick is widespread and occurs all year round. Opinions are divided on the role of deer in the biological cycle of the tick: i) Do they maintain a sustainable tick population that is secondarily available for cattle? ii) Do they decrease the infestation of the environment by collecting larvae on the pasture, but preventing their development to the engorged female stage? or iii) Do they contribute to both situations? An experiment was conducted in three groups of pastures, each seeded with 450 000 larvae/ha and allowed to be grazed only by cattle, only by deer, and by a mixed herd of deer and cattle (deer representing 30% of the biomass), at approximately the same stocking rate (470-510 kg/ha). After 15 months of exposure, the tick burden per weight unit of host was 42 ticks/kg for the steers-only herd and 0.01/kg for the deer-only herd. The steers in the "mixed group" harbored 7 times fewer ticks (6.2/kg) than the cattle-only group, and the deer in the "mixed group," 130 times more (1.3/kg) than the deer-only group. Five emergency acaricide treatments had to be applied in the cattle-only group, but none in the other groups. The long-term sustainability of a viable tick population on deer as well as the potential benefit resulting from the association of deer and susceptible cattle in the tick control of cattle are highlighted. PMID:12381606

  12. Assessment of bovine immunoprotecion against Rhipicephalus microplus using Bm86-CG antigen expressed in Pichia pastoris

    Science.gov (United States)

    The cattle tick Rhipicephalus microplus is a major pest of cattle in tropical and subtropical parts of the world. In addition to direct effects associated with its obligate parasitic way of life, R. microplus also transmits the pathogens that cause bovine babesiosis and anaplasmosis. Commercially ...

  13. Acaricide activity in vitro of Acmella oleracea against Rhipicephalus microplus.

    Science.gov (United States)

    Castro, K N C; Lima, D F; Vasconcelos, L C; Leite, J R S A; Santos, R C; Paz Neto, A A; Costa-Júnior, L M

    2014-10-01

    Cattle tick control has been limited by the resistance of these parasites to synthetic acaricides. Natural products are a possible alternative as they have different mechanisms of action. Acmella oleracea is a native plant with a large cultivated area in the Amazon region and could be easily used for large-scale preparation of a commercial product. This study evaluated the in vitro action of the hexane extract of the aerial parts of A. oleracea on larvae and engorged females of the cattle tick Rhipicephalus microplus. Spilanthol was the major constituent with a content of 14.8% in the extract. The hexane extract of A. oleracea was highly effective against larvae of R. microplus with an LC50 of 0.8 mg mL(-1). Against engorged females, hexane extract of A. oleracea reduced oviposition and hatchability of eggs with an LC50 of 79.7 mg mL(-1). Larvae and engorged females were killed by the hexane extract with high efficiency (>95%) at concentrations of 3.1 and 150.0 mg mL(-1), respectively. These results demonstrate that the hexane extract of A. oleracea has significant activity against R. microplus and has potential to be developed into formulations for tick control. PMID:25033813

  14. High efficacy of a 20 amino acid peptide of the acidic ribosomal protein P0 against the cattle tick, Rhipicephalus microplus.

    Science.gov (United States)

    Rodríguez-Mallon, Alina; Encinosa, Pedro E; Méndez-Pérez, Lídice; Bello, Yamil; Rodríguez Fernández, Rafmary; Garay, Hilda; Cabrales, Ania; Méndez, Luis; Borroto, Carlos; Estrada, Mario Pablo

    2015-06-01

    Current strategies to control cattle ticks use integrated control programs (ICP) that include vaccination. Reduction in the use of chemicals and in the cost of tick control, the delay or elimination of acaricide resistance and the decreasing of environmental pollution are the advantages of using these programs. This integrated program is potentially applicable to all genotypes of chemical resistant ticks. However, the problem here is to improve the efficacy of anti-tick vaccines. The P0 protein is a structural component of the ribosome of all organisms. We have identified an immunogenic region of ribosomal protein P0 from Rhipicephalus spp. ticks that is not very conserved compared to the orthologous protein in their hosts. A synthetic 20 amino acid peptide from this sequence was effective as a vaccine against Rhipicephalus sanguineus infestations in an immunization and challenge experiment using rabbits. In this paper, the same peptide used as vaccine against the cattle tick Rhipicephalus Boophilus microplus shows a significant diminution in the number of engorged females recovered, in the weight of females and the weight of egg masses. The number of eggs hatched was also significantly reduced for the vaccinated group, with an overall effectivity for the antigen pP0 of 96%. These results, together with the conserved sequence of the P0 peptide among ticks, suggest that this antigen could be a good broad spectrum vaccine candidate. It would be expected to be active against many species of ticks and thus has promise in an ICP for effective control of ticks and thereby to improve the efficiency and productivity of the livestock industry. PMID:25958782

  15. Virulence of Isaria sp. and Purpureocillium lilacinum to Rhipicephalus microplus tick under laboratory conditions.

    Science.gov (United States)

    Angelo, Isabele C; Fernandes, Éverton K K; Bahiense, Thiago C; Perinotto, Wendell M S; Golo, Patricia S; Moraes, Ana Paula R; Bittencourt, Vânia R E P

    2012-10-01

    Rhipicephalus microplus (Canestrini) is an ectoparasite accountable for great economic losses. The use of entomopathogenic fungi to control arthropods has shown promising responses. The present study evaluated the virulence of Isaria farinosa (Holmsk.) Fr., Isaria fumosorosea (Wize) Brown and Smith, and Purpureocillium lilacinum (=Paecilomyces lilacinus) (Thom.) Samson to engorged females, eggs, and larvae of R. microplus. There were four treatment groups (10(5), 10(6), 10(7), and 10(8) conidia ml(-1)) and the control group (water and Tween 80, 0.1% v/v). The treatment was based on immersion of the specimen in 1 ml of the suspension or control solution. The study observed changes in egg viability and larval mortality after treatment. The results showed that I. farinosa, P. lilacinum, and I. fumosorosea caused alterations in the biological parameters of R. microplus ticks. I. fumosorosea presented the greatest potential to control R. microplus engorged females in vitro, causing a 49% decrease in nutritional index. All fungal isolates presented significant reduction in the egg production index. I. farinosa reduced the hatching percentage if the eggs were treated with the two highest conidial concentrations. All conidial concentrations of I. fumosorosea were able to reduce the hatching percentage significantly. All tested isolates showed pathogenicity toward unfed R. microplus larvae. As far as we know, this is the first study reporting the effect in vitro of I. farinosa, I. fumosorosea, and P. lilacinum to different developmental stages of R. microplus ticks. PMID:22710525

  16. VIABILIDADE ECONÔMICA DA ADOÇÃO DO CONTROLE ESTRATÉGICO DO CARRAPATO RHIPICEPHALUS (BOOPHILUS MICROPLUS (CANESTRINI, 1887 EM REBANHOS BOVINOS LEITEIROS

    Directory of Open Access Journals (Sweden)

    André Monteiro de Souza

    2014-06-01

    Full Text Available Este trabalho tem como objetivo avaliar a viabilidade econômica do programa de controle estratégico do carrapato em bovinos leiteiros adotado pela Embrapa Gado de Leite. O programa se fundamenta na racionalização do uso de carrapaticidas com a realização de tratamentos no período em que a população de carrapatos encontra-se reduzida; na escolha do produto mais adequado para o combate da população de carrapatos, por meio da realização de testes de sensibilidade dos carrapatos aos carrapaticidas; e, pela utilização do carrapaticida na diluição recomendada e quantidade suficiente para banhar todo o corpo do animal. O estudo foi realizado junto a 104 produtores rurais, criadores de gado de leite, em 27 municípios da região central e norte do estado de Minas Gerais. As informações foram coletadas por meio de questionário, no período de setembro a novembro de 2010. Constatou-se que em 68% dos rebanhos, a infestação por TPB é a que mais afeta os animais. Por causa desse e outros problemas, 79% dos consultados resolveram aderir ao Programa por recomendação do técnico e outros 70% por causa das altas infestações nos animais. Setenta e nove por cento aderiram e seguiram o Programa, de maneira correta. Nessas fazendas, a maior parte da mão de obra é contratada (46%, o sistema de exploração da atividade leiteira é o semi-intensivo (84%, o padrão racial do rebanho é o cruzamento Girolando (95% e em, 45%, a produção média diária de leite varia entre 40 a 400 litros. Antes da adesão ao Programa, em 89% das propriedades, as vacas lactantes eram as mais afetadas, seguidas de bezerros. Para escolher o carrapaticida, 41% dos produtores baseavam a escolha na indicação do balconista. Após a adesão ao Programa, 94% dos fazendeiros seguiram as orientações repassadas pelos técnicos. O primeiro motivo citado (78% para permanência com o plano de controle foi a credibilidade no teste de sensibilidade dos carrapatos aos acaricidas. Com isso, 90% notaram a diminuição dos ataques pelo parasito, mudando a maneira de realizar os banhos (100% dos produtores. Houve a redução de 57% dos gastos em reais com a compra de carrapaticidas por mês e de 33% da quantidade de tratamentos por ano. Em relação à TPB, houve queda de 60% do número médio de casos e 100% da média do número de mortes em bezerros. Portanto, os resultados indicaram que a adoção do controle estratégico do carrapato em bovinos leiteiros possibilitou a redução das despesas dos produtores com aquisição de carrapaticidas químicos. Além disso, a adoção do controle estratégico possibilitou a redução de prejuízos diretos e indiretos causados pelo carrapato, com reflexos positivos sobre a produção e a qualidade do leite e derivados.

  17. Mapping of quantitative trait loci controlling tick [Riphicephalus (Boophilus) microplus] resistance on bovine cjrp,psp,es 5, 7 and 14

    Science.gov (United States)

    Since Bos taurus and Bos indicus cattle breeds have diverged at approximately 10.000 years ago, the differences in the process of domestication and subsequent selection for desired phenotypes is presumed to have contributed the phenotypic and genetic differences between these subspecies. Of particu...

  18. 微小牛蜱Bm86基因的真核表达%Eukaryotic expression of Bm86 gene of Boophilus microplus in Pichia pastoris

    Institute of Scientific and Technical Information of China (English)

    李文卉; 任巧云; 罗建勋; 殷宏; 关贵全; 马米玲; 刘志杰; 刘爱红; 党志胜; 高金亮

    2005-01-01

    采用RT-PCR技术从微小牛蜱饥饿幼蜱破解物中扩增到Bm86基因,将其与巴斯德毕赤酵母分泌型表达载体pPIC9K重组构建了重组表达载体pPIC9K-Bm86,测序正确后将其用SacⅠ内切酶线性化后采用电穿孔法转化巴斯德毕赤酵母菌GS115,经G418抗性筛选高拷贝重组菌株后用甲醇诱导表达,SDS-PAGE和Western-blotting分析结果表明,诱导表达的培养上清液中表达出具有反应活性的68 ku重组Bm86蛋白,目的蛋白约占培养上清液中蛋白总量的32%以上,诱导96 h目的蛋白的表达量为0.36 mg/mL.

  19. Selection of reference genes for quantitative RT-PCR studies in Rhipicephalus (Boophilus) microplus and Rhipicephalus appendiculatus ticks and determination of the expression profile of Bm86

    OpenAIRE

    Jongejan Frans; Postigo Milagros; Balk Jesper A; Nijhof Ard M

    2009-01-01

    Abstract Background For accurate and reliable gene expression analysis, normalization of gene expression data against reference genes is essential. In most studies on ticks where (semi-)quantitative RT-PCR is employed, normalization occurs with a single reference gene, usually β-actin, without validation of its presumed expression stability. The first goal of this study was to evaluate the expression stability of commonly used reference genes in Rhipicephalus appendiculatus and Rhipicephalus ...

  20. Comparison of predicted binders in Rhipicephalus (Boophilus) microplus intestine protein variants Bm86 Campo Grande strain, Bm86 and Bm95.

    Science.gov (United States)

    Andreotti, Renato; Pedroso, Marisela S; Caetano, Alexandre R; Martins, Natália F

    2008-01-01

    This paper reports the sequence analysis of Bm86 Campo Grande strain comparing it with Bm86 and Bm95 antigens from the preparations TickGardPLUS and Gavac, respectively. The PCR product was cloned into pMOSBlue and sequenced. The secondary structure prediction tool PSIPRED was used to calculate alpha helices and beta strand contents of the predicted polypeptide. The hydrophobicity profile was calculated using the algorithms from the Hopp and Woods method, in addition to identification of potential MHC class-I binding regions in the antigens. Pair-wise alignment revealed that the similarity between Bm86 Campo Grande strain and Bm86 is 0.2% higher than that between Bm86 Campo Grande strain and Bm95 antigens. The identities were 96.5% and 96.3% respectively. Major suggestive differences in hydrophobicity were predicted among the sequences in two specific regions. PMID:18823577

  1. Boophilus microplus: estado actual de la resistencia a los acaricidas en la frontera México Estados Unidos y su impacto en la relación comercial

    OpenAIRE

    Juan Ramón González Sáenz Pardo; Rubén Hernández Ortiz

    2012-01-01

    Se aborda la importancia de las exportaciones de ganado bovino en pie a los Estados Unidos de América, destacando el valor comercial que representa para México la entrada de divisas por 700 millones USD anuales por este concepto. La comercialización de ganado se ve frenada por barreras no arancelarias, tales como la tuberculosis (TB), brucelosis y las garrapatas. Se ha formado un grupo binacional de expertos para tratar estos temas. En el tema de garrapatas se han establecido sistemas de cola...

  2. The penultimate arginine of the carboxy terminus determines slow desensitisation in a P2X receptor from the cattle tick Boophilus microplus

    Science.gov (United States)

    P2X ion channels have been functionally characterised from a range of eukaryotes. Whilst these receptors can be broadly classified into fast and slow desensitising, the molecular mechanisms underlying current desensitisation are not fully understood. Here we describe the characterisation of a P2X ch...

  3. Assessing bovine babesiosis in Rhipicephalus (Boophilus microplus ticks and 3 to 9-month-old cattle in the middle Magdalena region, Colombia

    Directory of Open Access Journals (Sweden)

    Sandra Ríos-Tobón

    2014-04-01

    Full Text Available Babesia sp. is a protozoan hemoparasite that affects livestock worldwide. The Colombian Middle Magdalena is an enzootic region for babesiosis, but there is no previous research providing detail on its transmission cycle. This study aims to assess some Babesia sp. infection indicators in cattle and ticks from the area, by using direct microscopic and molecular techniques to detect the infection. In the cattle, 59.9% and 3.4 % positivity values for B. bigemina and mixed infection (B. bovis + B. bigemina were found respectively. In ticks, the positivity of B. bigemina reached 79.2% and 9.4% for the mixed infection. The degree of infestation in the region was 3.2 ticks per bovine. There was positive correlation between tick control acaricide frequencies and infestation in bovines. This leads us to infer that control periodicity greater than 90 days, in stable zones, is an abiotic factor that benefits the acquisition of protective immunity in calves, the natural control of the infection and eventual disease absence. It is necessary to monitor the disease by applying new entomological and parasitological indicators showing the complexity of this phenomenon.

  4. An integrative approach to understanding pyrethroid resistance in Rhipicephalus microplus and R. decoloratus ticks.

    Science.gov (United States)

    Wyk, Roelof Dj van; Baron, Samantha; Maritz-Olivier, Christine

    2016-06-01

    Rhipicephalus microplus and Rhipicephalus decoloratus species occur in regions with savannah and temperate climates, typically in grassland and wooded areas used as cattle pasture. Both species are associated with the transmission of Anaplasma and Babesia spp., impacting livestock health and quality of livestock-associated products. In Africa, tick control is predominantly mediated with the use of acaricides, such as synthetic pyrethroids. After several years on the market, reports of resistance to synthetic pyrethroids escalated but limited field data and validation studies have been conducted to determine the extent of acaricide resistance in Africa. Without this data, knowledge-based tick control will remain problematic and selection pressure will remain high increasing the rate of resistance acquisition. To date, several pyrethroid resistance associated single nucleotide polymorphisms (SNPs) have been reported for arthropods within the voltage-gated sodium channel. Three SNPs have been identified within this channel in pyrethroid resistant R. microplus ticks, but none has been reported for R. decoloratus. This study is the first to report the presence of a shared SNP within the voltage-gated sodium channel in both R. microplus and R. decoloratus, which is directly linked to pyrethroid resistance in R. microplus. As the mode of action by which these SNPs mediate pyrethroid resistance remains unknown, this study aims to set hypotheses by means of predictive structural modelling. This not only paves the way forward to elucidating the underlying biological mechanisms involved in pyrethroid resistance, but also improvement of existing acaricides and ultimately sustainable tick control management. PMID:26851840

  5. Phosphoenolpyruvate carboxykinase in bovine tick Rhipicephalus (Boophilus) micro plus embryogenesis and starvation larvae

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, J.G. de; Mentizingen, L.G.; Logullo, C. [Universidade Estadual do Norte Fluminense Darcy Ribeiro (UENF), Campos dos Goytacazes, RJ (Brazil). Centro de Biociencias e Biotecnologia. Lab.de Quimica e Funcao de Proteinas e Peptideos (LQFPP); Andrade, C.P. de; Vaz Junior, Itabajara [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Centro de Biotecnologia; Daffre, S.; Esteves, E. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Ciencias Biomedicas

    2008-07-01

    Full text: Phosphoenolpyruvate carboxykinase (PEPCK) is considered a key rate controlling enzyme in gluconeogenesis pathway. Gluconeogenesis is a highly regulated process, catalyzed by several enzymes subject to regulation by insulin. Normally, insulin rapidly and substantially inhibits PEPCK gene transcription and the PEPCK activity is proportional to the rate of gene transcription. The transcriptional regulation of the PEPCK gene has been extensively studied. CREM is the transcription factor that bind efficiently to the putative cyclic AMP response element (CRE) in PEPCK gene. Several other transcription factors can bind to this element and activate transcription. In oviparous animals, such as bovine tick R. microplus, the embryonic development occurs outside the maternal organism, implying that all the nutrients necessary for embryogenesis must be present in the oocytes. We observed the relationship between the main energy sources and the morphogenetic changes that occur during R. microplus tick embryogenesis. Energy homeostasis is maintained by glycogen mobilization in the beginning of embryogenesis, as its content is drastically decreased during the first five days of development. Afterwards, the activity of the gluconeogenesis enzyme PEPCK increases enormously, as indicated by a concomitant increase in glucose content (Moraes et al., 2007). Here, we analyzed PEPCK gene transcription by qPCR during the embryogenesis and starvation larvae. The PEPCK transcription was higher at first and 15th day eggs of the development. In larvae the levels of PEPCK transcripts is increased at fifth day after hatch. However, the activity is continuous increased in larvae the form first up to 15th day. Now we are investigating the involvement of CREM in the PEPCK gene transcription in these cells. In this sense, we obtained CREM sequence from TIGR ESTs R. microplus bank and designed the specific primers to qPCR. Taken together our results suggest the involvement of PEPCK to the

  6. Avaliação in vitro da ação do óleo essencial de capim limão (Cymbopogon citratus) sobre o carrapato bovino Rhipicephalus (Boophilus) microplus In vitro evaluation of the action of lemon grass (Cymbopogon citratus) essential oil on the cattle tick Rhipicephalus (Boophilus) microplus

    OpenAIRE

    F.C.C. Santos; F.S.F Vogel

    2012-01-01

    O uso indiscriminado de produtos químicos no controle do carrapato bovino constitui a principal causa do gradativo aumento do número de cepas resistentes deste parasita às bases disponíveis no mercado. A utilização de óleos essenciais e extratos vegetais é uma prática antiga no controle de carrapatos, porém só recentemente tem recebido a devida atenção dos pesquisadores. O objetivo deste experimento foi avaliar a eficácia in vitro do óleo de capim limão (Cymbopogon citratus) sobre fêmeas ingu...

  7. Comparison of predicted binders in Rhipicephalus (Boophilus microplus intestine protein variants BM86 Campo Grande strain, BM86 and BM95 Comparação da previsão de ligação das variantes de proteína de intestino de Rhipicephalus (Boophilus microplus Bm86 cepa Campo Grande, Bm86 e Bm95

    Directory of Open Access Journals (Sweden)

    Renato Andreotti

    2008-06-01

    Full Text Available This paper reports the sequence analysis of Bm86 Campo Grande strain comparing it with Bm86 and Bm95 antigens from the preparations TickGardPLUS and GavacTM, respectively. The PCR product was cloned into pMOSBlue and sequenced. The secondary structure prediction tool PSIPRED was used to calculate alpha helices and beta strand contents of the predicted polypeptide. The hydrophobicity profile was calculated using the algorithms from the Hopp and Woods method, in addition to identification of potential MHC class-I binding regions in the antigens. Pair-wise alignment revealed that the similarity between Bm86 Campo Grande strain and Bm86 is 0.2% higher than that between Bm86 Campo Grande strain and Bm95 antigens. The identities were 96.5% and 96.3% respectively. Major suggestive differences in hydrophobicity were predicted among the sequences in two specific regions.O objetivo deste estudo foi analisar a seqüência de Bm86 cepa Campo Grande comparando-a com os antígenos Bm86 e Bm95 das preparações TickGardPLUS e GavacTM, respectivamente. O produto de PCR foi clonado em PMOSBlue e seqüenciado. Para calcular os conteúdos de alfa-hélice e fita beta do polipeptídio previsto, foi utilizada a ferramenta de prognóstico de estrutura secundária PSIPRED. O perfil de hidrofobicidade foi calculado usando os algoritmos de Hopp e Woods, além da identificação das possíveis regiões de ligação com MHC classe I nos antígenos. O alinhamento "pair-wise" revelou que a similaridade entre Bm86 cepa Campo Grande e Bm86 é 0,2% maior que aquela entre Bm86 cepa Campo Grande e Bm95. As identidades foram de 96,5% e 96,3%, respectivamente. Com relação à hidrofobicidade, os resultados sugerem que a maior diferença entre as seqüências está localizada em duas regiões específicas.

  8. Comparison of predicted binders in Rhipicephalus (Boophilus) microplus intestine protein variants BM86 Campo Grande strain, BM86 and BM95 Comparação da previsão de ligação das variantes de proteína de intestino de Rhipicephalus (Boophilus) microplus Bm86 cepa Campo Grande, Bm86 e Bm95

    OpenAIRE

    Renato Andreotti; Marisela S. Pedroso; Caetano, Alexandre R; Natália F. Martins

    2008-01-01

    This paper reports the sequence analysis of Bm86 Campo Grande strain comparing it with Bm86 and Bm95 antigens from the preparations TickGardPLUS and GavacTM, respectively. The PCR product was cloned into pMOSBlue and sequenced. The secondary structure prediction tool PSIPRED was used to calculate alpha helices and beta strand contents of the predicted polypeptide. The hydrophobicity profile was calculated using the algorithms from the Hopp and Woods method, in addition to identification of po...

  9. Sequence variation of Bm86 in cattle fever ticks isolated from outbreaks in south Texas

    Science.gov (United States)

    The prevalence of Rhipicephalus (Boophilus) microplus and Rhipicephalus (Boophilus) annulatus cattle infestations have significantly expanded beyond the original quarantine zone established in south Texas as part of the Cattle Fever Tick Eradication Program. Major obstacles for containment of ticks...

  10. An update on distribution models for Rhipicephalus microplus in West Africa

    Directory of Open Access Journals (Sweden)

    Eva M. De Clercq

    2013-11-01

    Full Text Available The cattle tick, Rhipicephalus microplus, which reached the West African region approximately 8 years ago, has established viable populations in Côte d’Ivoire and Benin and spread rapidly from the assumed points of introduction. However, existing maps of its distribution range do not agree on the areas at risk, most probably due to suboptimal modelling approaches. Therefore, we undertook a re-investigation of the potential distribution range based on a high-quality dataset from West Africa that includes information on 104 farms located all over Benin. Focussing on climate suitability and applying advanced modelling, a subset of representative and uncorrelated climate variables was selected and fed into Maxent software to obtain an estimate of climate suitability for West Africa. The resulting map was validated using an independent dataset of 13 farms along the apparent distribution edge. The entire southern part of West Africa (covering southern Nigeria, Benin, Togo and Ghana features high climate suitability for R. microplus. All of Côte d’Ivoire is inside the distribution range of this tick and the southern rim of Burkina Faso is expected to be suitable for the establishment of R. microplus populations. The validation of the distribution, dated one year after the initial field visit, confirmed the predicted distribution range, although a small number of individuals of R. microplus were found north of the predicted limit. These low numbers might indicate that the climate is not suitable for the establishment of a viable tick population. An alternative explanation is the recent introduction by nomadic cattle herds passing through this location. In this region of the world, it is quite common for cattle owners to lead their livestock over distances of more than 500 km in search of food and water.

  11. Acaricidal activity of synthesized titanium dioxide nanoparticles using Calotropis gigantea against Rhipicephalus microplus and Haemaphysalis bispinosa

    Institute of Scientific and Technical Information of China (English)

    Sampath; Marimuthu; Abdul; Abdul; Rahuman; Chidambaram; Jayaseelan; Arivarasan; Vishnu; Kirthi; Thirunavukkarasu; Santhoshkumar; Kanayairam; Velayutham; Asokan; Bagavan; Chinnaperumal; Kamaraj; Gandhi; Elango; Moorthy; Iyappan; Chinnadurai; Siva; Loganathan; Karthik; Kokati; Venkata; Bhaskara; Rao

    2013-01-01

    Objective:To assess the acaricidal activity of titanium dioxide nanoparticles(TiO2 NPs)synthesized from flower aqueous extract of Calotropis gigantea(C.gigantea)against the larvae of Rhipicephalus(Boophilus)microplus[R.(B.)microplus]and the adult of Haemaphrysalis bispinosa(H.bispinosa).Methods:The lyophilized C.gigantea flower aqueous extract of 50 mg was added with 100 mL of TiO(OH2)(10 mM)and magnetically stirred for 6 h.Synthesized TiO2 NPs were characterized by X-ray diffraction(XRD).Fourier transform infrared spectroscopy(FTIR),Scanning electron microscopy(SEM),and Energy dispersive X-ray spectroscopy(EDX).The synthesised TiO2 NPs were tested against the larvae of R(B.)microplus and adult of H.bispinosa were exposed to filter paper impregnated method.Results:XRD confirmed the crystalline nature of the nanoparticles with the mean size of 10.52 nm.The functional groups for synthesized TiO2NPs were 1405.19,and 1053.45 cm-1for-NH2 bending,primary amines and amides and 1053.84and 1078.45 cm-1for C-O.SEM micrographs of the synthesized TiO2 NPs showed the aggregated and spherical in shape.The maximum efficacy was observed in the aqueous flower extract of C.gigantea and synthesized TiO2 NPs against R.(B.)microplus(LC50=24.63 and 5.43 mg/L and r2=0.960 and 0.988)and against H.bispinosa(LC50=35.22 and 9.15 mg/L and r2=0.969 and 0.969).respectively.Conclusions:The synthesized TiO2 NPs were highly stable and had significant acaricidal activity against the larvae of R.(B.)microplus and adult of H.bispinosa.This study provides the first report of synthesized TiO2 NPs and possessed excellent anti-parasitic activity.

  12. Functional genomics studies of Rhipicephalus (Boophilus) annulatus ticks in response to infection with the cattle protozoan parasite, Babesia bigemina

    Czech Academy of Sciences Publication Activity Database

    Antunes, S.; Galindo, R. C.; Almazán, C.; Rudenko, Natalia; Golovchenko, Maryna; Grubhoffer, Libor; Shkap, V.; do Rosário, A.; de la Fuente, J.; Domingos, A.

    2012-01-01

    Roč. 42, č. 2 (2012), s. 187-195. ISSN 0020-7519 Institutional research plan: CEZ:AV0Z60220518 Keywords : Tick * Genomics * Babesia * Rhipicephalus * Boophilus * RNA interference * Vaccine Subject RIV: EC - Immunology Impact factor: 3.637, year: 2012 http://www.sciencedirect.com/science/article/pii/S0020751912000033

  13. Prevalence of Resistant Strains of Rhipicephalus microplus to Acaricides in Cattle Ranch in the Tropical Region of Tecpan of Galeana, Guerrero, Mexico

    Directory of Open Access Journals (Sweden)

    J. Olivares-Pérez*, S. Rojas-Hernández, M.T. Valencia-Almazan, I. Gutiérrez-Segura and E.J. Míreles-Martínez

    2011-10-01

    Full Text Available Tick and tick borne diseases cause many problems to the cattle industry worldwide. The prevalence of resistant strains of Rhipicephalus microplus to different acaricides on cattle farms in the tropical region of Tecpan of Galeana, Guerrero, Mexico, and risk factors related to prevalence of resistant strains of R. microplus. Sixty one ranches infested were sampled; in each ranch were collected 30-50 fully-engorged female R. microplus ticks, of 10 cattle randomly selected, and evaluated in their progeny resistance to acaricides, using the larval packet test. The prevalence of resistant strains was total pyrethroids and amitraz. In organophosphorus 31.1, 48.3 and 82.2% of strains were resistant to clorpyriphos, coumaphos and diazinon, respectively. Risk factors favored (P<0.05 the development of resistant strains of acaricides. We concluded that the resistance of R. microplus to acaricides used to control a problem, and risk factors (livestock management have accelerated the development of resistance.

  14. Evaluation of tea tree oil for controlling Rhipicephalus microplus in dairy cows.

    Science.gov (United States)

    Pazinatto Boito, Jhonatan; Santos, Roberto C; Vaucher, Rodrigo A; Raffin, Renata; Machado, Gustavo; Tonin, Alexandre A; Da Silva, Aleksandro S

    2016-07-30

    Our research aimed to test the effects of Melaleuca alternifolia oil (pure and in nanocapsules) in the control of Rhipicephalus microplus in dairy cattle. For this purpose, the in vivo studies used 15 cows distributed in three different groups with the same number of animals. Five cows remained untreated (Group A), representing the control group; other five cows were sprayed with TTO (at 5%) in its pure form (Group B); and five cows were sprayed with nanocapsules of TTO (at 0.75%) (Group C). On days 1 and 4 post-treatments (PT), all cows had their ticks counted. On day 1 PT, two ticks from each cow were collected to evaluate the effect of the treatment on ticḱs reproduction (in vitro assays). The pure form of TTO caused a significant reduction (P0.05). Treatment with TTO in nanocapsules (Group C) interfered with R. microplus reproduction, leading to lower oviposition by female ticks and hatchability (34.5% of efficacy). On the other hand, TTO oil (Group B) did not interfere on ticḱs reproduction, i.e. showed higher hatchability than the control group. Therefore, it is possible to conclude that pure TTO has an acaricidal effect in dairy cows, in addition to an effect on ticḱs reproduction when used its nanocapsulated form. PMID:27369577

  15. The known distribution and ecological preferences of the tick subgenus Boophilus (Acari : Ixodidae) in Africa and Latin America

    OpenAIRE

    2006-01-01

    A compilation of the known distribution of Boophilus ticks in Africa and Latin America is presented, together with details on climate preferences. B. annulatus is recorded mainly in the western part of a strip from the equator to parallel 20 degrees N. It associates with woodlands and forests (lowland rain forest and secondary grassland). This species is also present in the Mediterranean region, associated to woodland and open areas. B. decoloratus extends southern to parallel 20 degrees N, i...

  16. Injectable fipronil for cattle: Plasma disposition and efficacy against Rhipicephalus microplus.

    Science.gov (United States)

    Cid, Yara P; Ferreira, Thais P; Magalhães, Viviane S; Correia, Thais R; Scott, Fábio B

    2016-04-15

    Fipronil is a phenylpyrazole class insecticide. It is widely used as an insecticide in agriculture and in the control of ectoparasites in veterinary medicine. The application of fipronil in an injectable form (subcutaneously) becomes an innovation, since there is no commercially available preparation containing fipronil herein. The present study aimed at fipronil usage, applied subcutaneously in cattle, to control Rhipicephalus microplus. The assessing criteria used in the research have been the construction of the plasma concentration curve and efficacy studies. A method using High Performance Liquid Chromatograph with ultraviolet detection was developed for determination of fipronil in bovine plasma samples, providing a fast and simple process with good reproducibility and low limit of quantification. The validation of the analytical method showed linearity, selectivity, precision, accuracy, sensitivity and stability, thus proving it as suitable for routine analysis. This method showed to be an important investigative tool in the analysis of fipronil plasma concentration in cattle. Fipronil administered via subcutaneous in bovine reached the systemic circulation (Cmax=378.06±137.44 ng/mL), was quickly absorbed (t(max)=10±0.87 h), and its elimination occurred slowly (t(1/2)=12 days), while maintaining quantifiable blood plasma levels (23.79±12.16 ng/mL) for up to 21 days after the treatment with a 1 mg/kg dosage. The in vivo efficacy tests proved that fipronil applied subcutaneously in a single dose of 1 mg/kg in cattle exhibited a mean efficacy of 82.41% against R. microplus. The potential of subcutaneous injection as an alternative treatment route in cattle encourage the development of an injectable formulation of fipronil. PMID:26995714

  17. Cytotoxic effects of extract of Acmella oleraceae (Jambú) in Rhipicephalus microplus females ticks.

    Science.gov (United States)

    de Oliveira, Patrícia Rosa; de Carvalho Castro, Karina Neoob; Anholeto, Luis Adriano; Camargo Mathias, Maria Izabel

    2016-08-01

    The present study analyzed the effects of different concentrations of the hexane extract of A. oleraceae (HEAO) (Jambú) on the germ cells of semi-engorged Rhipicephalus microplus female ticks, through a morpho-histological study, evaluating the effectiveness of the extract in the genesis of the individuals. To perform this analysis, 100 semi-engorged females were divided into five groups with 20 individuals each: groups I and II, respectively constituted by distilled water control and 50% ethanol + 1% DMSO, and groups III, IV, and V constituted by treatment with HEAO in the concentrations of 12.5, 25.0 and 50.0 mg/mL, respectively. All the ticks were immersed in the different concentrations of the extract or in distilled water for 5 minutes, dried and conditioned in BOD incubator for 7 days. The individuals of the treatment groups revealed the action of this extract showing alterations in the germ cells of the females from the different groups when compared with those from the groups I and II (control groups). These alterations were mainly related to the size and shape of the oocytes; number of yolk granules; presence, number, size and location of vacuoles in the cytoplasm of all the germ cells; and the presence of nuclear alterations in these cells as well. Thus, it was demonstrated that the concentrations of HEAO affected the germ cells of R. microplus ticks. The effects of the extract are similar to those caused by renowned and efficient chemical products used to control these ticks. Microsc. Res. Tech. 79:744-753, 2016. © 2016 Wiley Periodicals, Inc. PMID:27271726

  18. Identification of Tropomyosin and Its Immunological Properties from Larvae of Cattle Tick, Boophilus Annulatus

    Directory of Open Access Journals (Sweden)

    S Nabian

    2013-06-01

    Full Text Available Background: Boophilus annulatus is an obligate blood feeder tick that can cause great losses in animals due to anemia and its ability to injure its host skin directly. The aim of this study was identification of cattle humoral immune response to some tick proteins during experimental infestation.Methods: Immune sera against tick were collected from experimentally infested cattle with ticks. One and two-dimensional electrophoresis and Western blotting methods were used for the detection of immunogenic proteins in larval tick extract and eight of these proteins were identified by MALDI-TOF and MALDI-TOF-TOF mass spectrometry.Results: In non-reducing one-dimensional SDS- PAGE, some bounds between 12 to more than 250-kDa appeared. In two-dimensional SDS-PAGE, numerous spot appeared and the identified immuno­genic proteins by parallel immunoblotting weighted between 14 and 97 kDa. Amino acid sequences of protein spot with 37-kDa molecular weight had identity to tropomyosin based on Mas­cot search in NCBI.Conclusion: Anti tropomyosin antibodies can be induced in experimentally infested hosts with ticks and it seems that tropomyosin can be useful for the development of anti tick vaccines.

  19. A model to simulate the effect of vaccination against Boophilus ticks on cattle.

    Science.gov (United States)

    Lodos, J; Boue, O; de la Fuente, J

    2000-02-01

    This paper describes a vaccination model to simulate the effect of cattle vaccination with concealed antigens on Boophilus tick spp. The model considers the vaccination effect in three parts: antibody titer, accumulation of damaging vaccination effects by parasite stages, and the effect of accumulated damage on all tick life stages. Biological parameters for ticks and hosts, as well as parameters describing tick-host interaction, were included. The validity of this model, integrated with the TICKSIM simulation program, was demonstrated for the Bm86-containing vaccine Gavac by comparing simulated and real data for several geographic locations in the Americas. All model parameters were estimated using field data collected in the different geographic locations. The model sensitivity to changes in antibody titer level and titer half-life was studied, and the impact on tick population density of changes in these parameters was evaluated. Simulation results showed that to achieve a higher level of tick control, an increase in the maximum antibody titer levels was more important than extending titer half-life in geographical locations with short seasonal peaks of tick infestation. The TICKSIM program, integrated with the new vaccination model, proved to be a framework for designing and evaluating tick control strategies, including vaccination with GavacTM. PMID:10669101

  20. Immunity against Boophilus annulatus induced by the Bm86 (Tick-GARD) vaccine.

    Science.gov (United States)

    Pipano, Eugene; Alekceev, Eugene; Galker, Felicia; Fish, Lea; Samish, Michael; Shkap, Varda

    2003-01-01

    Friesian cattle were immunized with two inoculations of anti-tick Bm86 (Tick-GARD) vaccine and were challenged 30 or 90 d later with Boophilus annulatus larvae derived from 1.2 g of eggs. No nymphs or adult ticks were found on the immunized cattle during four weeks after challenge. Repeated infestations (2 to 4) with larvae on three other calves during a period of 160 and 390 d after the immunization did not result in development of nymphal and adult stages. In control, non-immunized cattle infested with corresponding batches of larvae 1380 to 4653 replete adult female ticks were collected. Larvae issued from Babesia bovis-infected female ticks transmitted the infection to Bm86-immunized cattle, but the progeny of B. bigemina-infected females did not. Since B. bigemina is transmitted exclusively by nymphal stages of Bo. annulatus these results support the observation that immunity induced by Bm86 affects the larval stage of this tick. PMID:14580066

  1. 微小牛蜱Bm86基因的原核表达与表达条件的优化%Prokaryotic Expression of Bm86 Gene of Boophilus microplus and Optimization of the Expression Condition

    Institute of Scientific and Technical Information of China (English)

    马米玲; 关贵全; 李有全; 刘爱红; 任巧云; 牛庆丽; 殷宏; 罗建勋

    2009-01-01

    根据微小牛蜱Bin86基因序列设计引物,在重组质粒pMD18-T-Bin86中克隆,并将其定向亚克隆入原核表达载体pGEX-4T-1,转化至大肠埃希菌BL21(DE3)株,用不同浓度异丙基-β-D-硫代半乳糖苷(IPTG)在不同时间进行诱导表达.十二烷基硫酸钠-聚丙烯酰胺凝胶电泳(SDS-PAGE)检测结果表明,37℃条件下经1 mmol/L IPTG诱导8 h后,目的 重组蛋白表达量最大,表达相对分子质量(Mr)约为94000的包涵体蛋白,与预期大小一致,目的 蛋白约占蛋白总量的29%.蛋白质印迹(Western blotting)分析表明,该重组蛋白可被兔抗微小牛蜱全蜱阳性血清所识别.

  2. Cloning of Bm86 gene of Boophilus microplus and construction of recombinant expression vector%微小牛蜱Bm86基因的克隆及真核表达载体的构建

    Institute of Scientific and Technical Information of China (English)

    李文卉; 任巧云; 殷宏; 罗建勋; 刘磊; 党志胜; 高金亮; 关贵全; 刘志杰; 刘爱红; 马米玲

    2005-01-01

    为了克隆微小牛蜱Bm86基因及构建该基因的表达载体,以微小牛蜱饥饿幼蜱的破解物提取的总RNA为模板,参照已发表的微小牛蜱Bm86基因的核苷酸序列,设计了1对引物,采用 RT-PCR技术获得微小牛蜱Bm86基因;将Bm86基因克隆入载体,并进行序列分析,结果证明,克隆的Bm86基因序列与GenBank上登录的Bm86基因序列的同源性达97.4%,而且该序列包含完整的开放阅读框.将该基因克隆入真核表达载体pPIC9K,构建并获得了重组真核表达载体pPIC9K-Bm86.

  3. Cloning and expression of Bm86 gene of Boophilus microplus in E.coli%微小牛蜱Bm86基因的克隆与原核表达

    Institute of Scientific and Technical Information of China (English)

    樊瑞泉; 任巧云; 刘爱红; 罗建勋; 杨孝朴; 殷宏; 高金亮; 关贵全; 刘志杰; 党志胜; 马米玲

    2007-01-01

    根据已发表的Bm86基因序列,设计表达型引物,利用RT-PCR技术,从微小牛蜱饥饿幼蜱的研磨物中扩增Bm86基因,将PCR产物连入pGEM-T Easy载体,构建重组克隆载体pGEM-T easy-Bm86.测序分析表明:克隆的微小牛蜱Bm86基因序列与GenBank上登录的Bm86基因的核苷酸和氨基酸序列的同源性分别为97 %和95.6 %.然后对重组克隆载体pGEM-T easy-Bm86进行双酶切,获得带有粘性末端的Bm86基因片段,并将此片段定向亚克隆入原核表达载体pGEX-4T-1,构建重组原核表达载体pGEX-4T-1-Bm86,将其转化到BL21宿主菌中,用IPTG进行诱导表达.SDS-PAGE检测表明表达产物为分子量为88Ku的融合蛋白,目的蛋白约占蛋白总量的39 %,表达量约为1.08mg/mL.Western blot分析表明此表达产物能被兔抗微小牛蜱阳性血清所识别.

  4. Toxicity of Neem Seed Oil against the Larvae of Boophilus decoloratus, A One-Host Tick In Cattle

    OpenAIRE

    Choudhury, M. K.

    2009-01-01

    The in vitro toxicity of neem seed oil (Azadirachta indica A. Juss, family: Meliaceae, Dogon yaro in Hausa language in Nigeria) was tested against the larvae of a one-host tick, Boophilus decoloratus (family: Ixodidae or hard tick, commonly known as blue tick) parasitic mainly to cattle generally found in savannas of tropical equatorial Africa. The 20, 40, 60, 80 and 100% concentrations of neem seed oil were found to kill all (100% mortality) the larvae after 27, 27, 27, 27 and 24 h respectiv...

  5. Toxicity of neem seed oil against the larvae of Boophilus decoloratus, a one-host tick in cattle

    Directory of Open Access Journals (Sweden)

    Choudhury M

    2009-01-01

    Full Text Available The in vitro toxicity of neem seed oil (Azadirachta indica A. Juss, family: Meliaceae, Dogon yaro in Hausa language in Nigeria was tested against the larvae of a one-host tick, Boophilus decoloratus (family: Ixodidae or hard tick, commonly known as blue tick parasitic mainly to cattle generally found in savannas of tropical equatorial Africa. The 20, 40, 60, 80 and 100% concentrations of neem seed oil were found to kill all (100% mortality the larvae after 27, 27, 27, 27 and 24 h respectively.

  6. Toxicity of Neem Seed Oil against the Larvae of Boophilus decoloratus, A One-Host Tick In Cattle.

    Science.gov (United States)

    Choudhury, M K

    2009-09-01

    The in vitro toxicity of neem seed oil (Azadirachta indica A. Juss, family: Meliaceae, Dogon yaro in Hausa language in Nigeria) was tested against the larvae of a one-host tick, Boophilus decoloratus (family: Ixodidae or hard tick, commonly known as blue tick) parasitic mainly to cattle generally found in savannas of tropical equatorial Africa. The 20, 40, 60, 80 and 100% concentrations of neem seed oil were found to kill all (100% mortality) the larvae after 27, 27, 27, 27 and 24 h respectively. PMID:20502579

  7. EFICACIA DE LA MEZCLA DE DOS CEPAS DE Metarhizium anisopliae (Deuteromycotina: Hyphomycetes) PARA EL CONTROL DE Rhipicephalus microplus EN INFESTACIONES NATURALES EN BOVINOS

    OpenAIRE

    Uriel Jesús Rodríguez-Alcocer; Roger Iván Rodríguez-Vivas; Melina Maribel Ojeda-Chi; Edelmira Galindo-Velasco; Roberto Lezama-Gutiérrez

    2014-01-01

    El objetivo del presente estudio fue evaluar la eficacia de Metarhizium anisopliae para el control de Rhipicephalus microplus en ganado bovino infestado naturalmente. El estudio se realizó en una unidad de producción de ganado bovino ubicada en el trópico Mexicano. Se formaron dos grupos de 10 bovinos basado en el número de garrapatas R. microplus adultas y fases juveniles (larvas y ninfas). Los animales del grupo tratado (promedio de 73.4 y 27.5 garrapatas adultas y juveniles respectivamente...

  8. Control de Rhipicephalus microplus (Acari: Ixodidae) mediante el uso del hongo entomopatógeno Metarhizium anisopliae (Hypocreales: Clavicipitaceae). Revisión

    OpenAIRE

    Melina Maribel Ojeda-Chi; Roger Ivan Rodríguez-Vivas; Edelmira Galindo-Velasco; Roberto Lezama-Gutiérrez; Carlos Cruz-Vázquez

    2011-01-01

    Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocan importantes pérdidas económicas en la producción de carne, leche y pieles, además incrementan los gastos derivados de los programas de control, y son capaces de transmitir Babesia bovis, B. bigemina y Anaplasma marginale. El control de R. microplus se basa principalmente en el uso de ixodicidas, sin embargo, su uso...

  9. The host status of African buffaloes, Syncerus caffer, for Rhipicephalus (Boophilus decoloratus

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2006-09-01

    Full Text Available The objective of this study was to assess the host status of African buffaloes, Syncerus caffer, for the one-host tick Rhipicephalus (Boophilus decoloratus. To this end the R. (B. decoloratus burdens of ten buffaloes examined in three north-eastern KwaZulu-Natal Province (KZN nature reserves were compared with those of medium-sized to large antelope species in these reserves and in the southern Kruger National Park (KNP, Mpumalanga Province. The R. (B. decoloratus burdens of the buffaloes were considerably smaller than those of the antelopes in the KNP, but not those in the KZN reserves. The life-stage structure of the R. (B. decoloratus populations on the buffaloes, in which larvae predominated, was closer to that of this tick on blue wildebeest, Connochaetes taurinus, a tick-resistant animal, than to that on other antelopes. A single buffalo examined in the KNP was not infested with R. (B. decoloratus, whereas a giraffe, Giraffa camelopardalis, examined at the same locality and time, harboured a small number of ticks. In a nature reserve in Mpumalanga Province adjacent to the KNP, two immobilized buffaloes, from which only adult ticks were collected, were not infested with R. (B. decoloratus, whereas greater kudus, Tragelaphus strepsiceros, examined during the same time of year in the KNP harboured large numbers of adult ticks of this species. African buffaloes would thus appear to be resistant to infestation with R. (B. decoloratus, and this resistance is expressed as the prevention of the majority of tick larvae from developing to nymphs.

  10. Non-Classical Gluconeogenesis-Dependent Glucose Metabolism in Rhipicephalus microplus Embryonic Cell Line BME26

    Directory of Open Access Journals (Sweden)

    Renato Martins da Silva

    2015-01-01

    Full Text Available In this work we evaluated several genes involved in gluconeogenesis, glycolysis and glycogen metabolism, the major pathways for carbohydrate catabolism and anabolism, in the BME26 Rhipicephalus microplus embryonic cell line. Genetic and catalytic control of the genes and enzymes associated with these pathways are modulated by alterations in energy resource availability (primarily glucose. BME26 cells in media were investigated using three different glucose concentrations, and changes in the transcription levels of target genes in response to carbohydrate utilization were assessed. The results indicate that several genes, such as glycogen synthase (GS, glycogen synthase kinase 3 (GSK3, phosphoenolpyruvate carboxykinase (PEPCK, and glucose-6 phosphatase (GP displayed mutual regulation in response to glucose treatment. Surprisingly, the transcription of gluconeogenic enzymes was found to increase alongside that of glycolytic enzymes, especially pyruvate kinase, with high glucose treatment. In addition, RNAi data from this study revealed that the transcription of gluconeogenic genes in BME26 cells is controlled by GSK-3. Collectively, these results improve our understanding of how glucose metabolism is regulated at the genetic level in tick cells.

  11. High resolution predictive mapping of Rhipicephalus microplus and R. annulatus in south Texas after vaccination with the anti-tick vaccine Gavac

    Science.gov (United States)

    Conventional anti-tick vaccines based on the tick gut antigen Bm86 exist commercially (TickGARD and Gavac) and could serve as an alternative to the use of acaricides to eradicate ticks, but their level of efficacy against R. microplus is too low for eradication if used alone. Therefore, the current ...

  12. Influence of grooming on Rhipicephalus microplus tick infestation and serum cortisol rates

    Directory of Open Access Journals (Sweden)

    Fernanda Ferreira Pessoa

    2012-12-01

    Full Text Available Grooming is an important factor on animal resistance to ticks. Rhipicephalus microplus is the most pathogenic cattle tick in Brazil causing death in susceptible animals. Cortisol is the hormone of stress. The influence of grooming on tick infestation and serum cortisol level was studied in 16 Holstein heifers from fifth to eight-month-old. They were infested with 10,000 larvae in June/20/2011. Half of them used a necklace made of wood strips and had an infestation chamber made by cotton cloth covering about 50 cm diameter of the shaved flank, fixed at the skin in both sides with adhesive to prevent larvae to escape from the infestation chamber and the amount of larvae was divided into the two chambers. Such artifacts had the purpose to avoid grooming. The heifers remained all the tick parasitic life cycle in individual pens inside a closed shed at Instituto de Zootecnia, in Nova Odessa, São Paulo State. Tick females bigger than 4.5 mm were counted in the right side from day 20 to 22 after the artificial infestation. The tick recovery rate was calculated by adding and multiplying by two the number of ticks counted, assuming that 5,000 female larvae had infested the cattle. Immediately before infestation (day 0 and in day2, day8, and day17 after infestation, blood samples were collected using vacuum tubes, in the morning (8:30 – 10:00 A.M.. Cortisol was measured by immunoassay (EIA and the D.O. (optical density at 420 nm was converted in ng of cortisol/mL of serum sample. The experimental design was randomized with 8 replications. Data from serum cortisol were analyzed using the General linear models of the SPSS® statistical package (version 12.0 using the presence of the artifacts (necklace and chamber and sampling day as independent variables and serum cortisol as the dependent variable. In the analyse of tick recovery rate, the presence of artifacts was the independent variable and tick recovery rate the dependent variable. The presence of

  13. In Vitro Evaluation of Ethanolic Extracts of Ageratum conyzoides and Artemisia absinthium against Cattle Tick, Rhipicephalus microplus

    Directory of Open Access Journals (Sweden)

    S. Parveen

    2014-01-01

    Full Text Available In vitro efficacy of ethanolic extracts obtained from the aerial parts of Ageratum conyzoides and Artemisia absinthium was assessed on Rhipicephalus microplus using adult immersion test (AIT. Five concentrations of the extract (1.25%, 2.5%, 5%, 10%, and 20% with three replications for each concentration were used in the bioassay. In AIT, the maximum mortality was recorded as 40% and 66.7% at 20% concentration for A. conyzoides and A. absinthium, respectively. Acaricidal activity was found to be higher in the extract of A. absinthium with LC50 and LC95 values of 11.2% and 61.7%, respectively. Egg mass weight of the live ticks treated with different concentrations of the extracts was significantly (P<0.05 lower than that of control ticks; consequently, the reproductive index and oviposition values of the treated ticks were reduced significantly (P<0.05. The A. conyzoides inhibited 90% hatching of eggs at the 20% concentration, whereas A. absinthium showed 100% inhibition at 5%, 10%, and 20% concentrations. The results show that A. absinthium has better acaricidal properties than A. conyzoides and could be useful in controlling R. microplus.

  14. Characterisation of divergent flavivirus NS3 and NS5 protein sequences detected in Rhipicephalus microplus ticks from Brazil

    Directory of Open Access Journals (Sweden)

    Sandra Regina Maruyama

    2014-02-01

    Full Text Available Transcripts similar to those that encode the nonstructural (NS proteins NS3 and NS5 from flaviviruses were found in a salivary gland (SG complementary DNA (cDNA library from the cattle tick Rhipicephalus microplus. Tick extracts were cultured with cells to enable the isolation of viruses capable of replicating in cultured invertebrate and vertebrate cells. Deep sequencing of the viral RNA isolated from culture supernatants provided the complete coding sequences for the NS3 and NS5 proteins and their molecular characterisation confirmed similarity with the NS3 and NS5 sequences from other flaviviruses. Despite this similarity, phylogenetic analyses revealed that this potentially novel virus may be a highly divergent member of the genus Flavivirus. Interestingly, we detected the divergent NS3 and NS5 sequences in ticks collected from several dairy farms widely distributed throughout three regions of Brazil. This is the first report of flavivirus-like transcripts in R. microplus ticks. This novel virus is a potential arbovirus because it replicated in arthropod and mammalian cells; furthermore, it was detected in a cDNA library from tick SGs and therefore may be present in tick saliva. It is important to determine whether and by what means this potential virus is transmissible and to monitor the virus as a potential emerging tick-borne zoonotic pathogen.

  15. Toxicity of neem seed oil against the larvae of Boophilus decoloratus, a one-host tick in cattle

    OpenAIRE

    Choudhury M

    2009-01-01

    The in vitro toxicity of neem seed oil (Azadirachta indica A. Juss, family: Meliaceae, Dogon yaro in Hausa language in Nigeria) was tested against the larvae of a one-host tick, Boophilus decoloratus (family: Ixodidae or hard tick, commonly known as blue tick) parasitic mainly to cattle generally found in savannas of tropical equatorial Africa. The 20, 40, 60, 80 and 100% concentrations of neem seed oil were found to kill all (100% mortality) the larvae after 27, 27, 27, 27 and ...

  16. Distribution of cattle fever tick infestations detected in the U.S. along the Texas/Mexico border

    Science.gov (United States)

    Species identification and coordinates of geographical premises for infestations of cattle fever ticks, Rhipicephalus (Boophilus) annulatus (Say) and R. (B.) microplus (Canestrini) were determined for 782 specimens submitted to the National Veterinary Services Laboratory during the eleven years betw...

  17. Dicty_cDB: Contig-U01650-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.g Rhipicephalus (boophilus) microplus B... 34 2.0 3 ( FG285891 ) 1108770704094 New World Screwworm Egg 926...nosize Bicyclus anynan... 30 2.6 4 ( FG294764 ) 1108770717863 New World Screwworm

  18. Filiform papilla of holstein’s tongue and its relation with the Rhipicephalus microplus tick resistance

    Directory of Open Access Journals (Sweden)

    Cecília José Veríssimo

    2012-12-01

    Full Text Available Several studies describe anatomical, morphological and histological analysis of domestic and wild animals tongue. The tongue is an extendable muscular organ that performs gripping, chewing, and swallowing food actions and executes tasting and mechanical body self-cleaning functions (grooming. The distribution of these tongue characteristics may vary, according to different species, but studies made with different animals classes reveal the filiform papilla acting in mechanical body cleaning function. In order to evaluate these mechanical functions, especially the self-cleaning one, we proposed to investigate filiform papillae length or its base dimensions would be related to the heifers resistance to Rhipicephalus microplus tick. Biopsies were performed in eight (8 Holstein heifers’ tongues, with a 6 mm diameter punch, in the anterior third of tongues, at the distance of 3 cm from its tip. The animals were anesthetized with xylazine hydrochloride 2%, a sedative, analgesic and muscle relaxant and received local anesthetic, hydrochloride 2.0 g lidocaine. After tissue removal, the local lesions received an ointment of triamcinolone acetonide, 1.0 mg g-1. The Holstein heifers were one year and half old and naturally infested with ticks in a paddock situated at “Instituto de Zootecnia”. We monitored their natural infestation by counting females ticks, greater than 4.5 mm, presents in every animal, in four weekly evaluations (from 8 to 28 December – 2011. These samples were submitted to technical process of fixation and dehydration (as required by in the scanning electron microscope study, in the laboratory NAP/MEPA - ESALQ-USP. The papillae were visualized and measured with the aid of the measurement tool between two points of the software in the scanning electron microscope Zeiss LEO 435VP. Statistically analyses were performed by the SPSSP 12.0 program in a complete randomized design. We employed the Oneway method for variance analysis to

  19. First report of fluazuron resistance in Rhipicephalus microplus: a field tick population resistant to six classes of acaricides.

    Science.gov (United States)

    Reck, José; Klafke, Guilherme Marcondes; Webster, Anelise; Dall'Agnol, Bruno; Scheffer, Ramon; Souza, Ugo Araújo; Corassini, Vivian Bamberg; Vargas, Rafael; dos Santos, Julsan Silveira; Martins, João Ricardo de Souza

    2014-03-17

    The control of the cattle tick Rhipicephalus microplus is based mainly on the use of chemical acaricides, which has contributed to the emerging problem of selection of resistant tick populations. Currently, there are six main classes of acaricides commercially available in Brazil to control cattle ticks, with fluazuron, a tick growth regulator with acaricidal properties, being the only active ingredient with no previous reports of resistance. Ticks (designated the Jaguar strain) were collected in a beef cattle ranch located at Rio Grande do Sul state, Southern Brazil, after a complaint of fluazuron treatment failure. To characterise the resistance of this strain against acaricides, larval tests were performed and showed that the Jaguar strain was resistant to all of the drugs tested: cypermethrin (resistance ratio, RR=31.242), chlorpyriphos (RR=103.926), fipronil (RR=4.441), amitraz (RR=11.907) and ivermectin (3.081). A field trial was conducted to evaluate the efficacy of fluazuron treatment in heifers that had been experimentally infested with the Jaguar or a susceptible strain. Between 14 and 28 days after treatment, the average efficacy in cattle experimentally infested with the susceptible strain was 96%, while for the Jaguar strain the efficacy was zero. Additionally, the Jaguar strain response to fluazuron was evaluated in vitro using a modified adult immersion test (AIT) and the artificial feeding assay (AFA). With the AIT, 50 ppm of fluazuron inhibited 99% of larvae hatching in the susceptible strain (POA) and less than 50% in the Jaguar strain. Results of the AFA showed a larval hatching rate of 67% at 2.5 ppm of fluazuron with the Jaguar strain; conversely, only 3% of larvae of the susceptible strain hatched at the same fluazuron concentration. The results showed here demonstrated the first case of fluazuron resistance in R. microplus and the first tick population resistant to six classes of acaricides in Brazil. PMID:24560364

  20. Evaluation of the Efficacy of Acaricides Used to Control the Cattle Tick, Rhipicephalus microplus, in Dairy Herds Raised in the Brazilian Southwestern Amazon.

    Science.gov (United States)

    Brito, Luciana G; Barbieri, Fábio S; Rocha, Rodrigo B; Oliveira, Márcia C S; Ribeiro, Elisana Sales

    2011-01-01

    The adult immersion test (AIT) was used to evaluate the efficacy of acaricide molecules used for control of Rhipicephalus microplus on 106 populations collected in five municipalities in the state of Rondônia in the Brazilian South Occidental Amazon region. The analysis of the data showed that the acaricide formulations had different efficacies on the tick populations surveyed. The synthetic pyrethroids (SPs) acaricides were the least effective (48.35-76.84%), followed by SP + organophosphate (OP) associations (68.91-81.47%) and amidine (51.35-100%). For the macrocyclic lactones (MLs), the milbemycin (94.84-100%) was the most effective, followed by spinosad (93.21-100%) and the avermectins (81.34-100%). The phenylpyrazole (PZ) group had similar efficacy (99.90%) to the MLs. Therefore, SP acaricides, including associations with OP, and formulations based on amidine presented low in vitro efficacy to control the R. microplus populations surveyed. PMID:21547224

  1. Evaluation of the Efficacy of Acaricides Used to Control the Cattle Tick, Rhipicephalus microplus, in Dairy Herds Raised in the Brazilian Southwestern Amazon

    OpenAIRE

    Luciana G. Brito; Barbieri, Fábio S.; Rocha, Rodrigo B.; Márcia C. S. Oliveira; Ribeiro, Elisana Sales

    2011-01-01

    The adult immersion test (AIT) was used to evaluate the efficacy of acaricide molecules used for control of Rhipicephalus microplus on 106 populations collected in five municipalities in the state of Rondônia in the Brazilian South Occidental Amazon region. The analysis of the data showed that the acaricide formulations had different efficacies on the tick populations surveyed. The synthetic pyrethroids (SPs) acaricides were the least effective (48.35–76.84%), followed by SP + organophosphate...

  2. Immunologic and molecular identification of Babesia bovis and Babesia bigemina in free-ranging white-tailed deer in northern Mexico

    Science.gov (United States)

    The suitability of white-tailed deer (Odocoileus virginianus) as hosts for the cattle ticks Rhipicephalus (Boophilus) microplus and Rhipicephalus (Boophilus) annulatus, has been well documented. These ticks have a wide host range, and both transmit Babesia bovis and Babesia bigemina, the agents resp...

  3. Acaricidal Activity of Petroleum Ether Extract of Leaves of Tetrastigma leucostaphylum (Dennst. Alston against Rhipicephalus (Boophilus annulatus

    Directory of Open Access Journals (Sweden)

    T. P. Adarsh Krishna

    2014-01-01

    Full Text Available The acaricidal activity of the petroleum ether extract of leaves of Tetrastigma leucostaphylum (Dennst. Alston (family: Vitaceae against Rhipicephalus (Boophilus annulatus was assessed using adult immersion test (AIT. The per cent of adult mortality, inhibition of fecundity, and blocking of hatching of eggs were studied at different concentrations. The extract at 10% concentration showed 88.96% inhibition of fecundity, 58.32% of adult tick mortality, and 50% inhibition of hatching. Peak mortality rate was observed after day 5 of treatment. Mortality of engorged female ticks, inhibition of fecundity, and hatching of eggs were concentration dependent. The LC50 value of the extract against R. (B. annulatus was 10.46%. The HPTLC profiling of the petroleum ether extract revealed the presence of at least seven polyvalent components. In the petroleum ether extract, nicotine was identified as one of the components up to a concentration of 5.4%. However, nicotine did not reveal any acaricidal activity up to 20000 ppm (2%. Coconut oil, used as diluent for dissolving the extract, did not reveal any acaricidal effects. The results are indicative of the involvement of synergistic or additive action of the bioactive components in the tick mortality and inhibition of the oviposition.

  4. Acaricidal activity of the organic extracts of thirteen South African plants against Rhipicephalus (Boophilus) decoloratus (Acari: Ixodidae).

    Science.gov (United States)

    Fouche, Gerda; Ramafuthula, Mary; Maselela, Vusi; Mokoena, Moses; Senabe, Jeremiah; Leboho, Tlabo; Sakong, Bellonah M; Adenubi, Olubukola T; Eloff, Jacobus N; Wellington, Kevin W

    2016-07-15

    The African blue tick, Rhipicephalus (Boophilus) decoloratus, is a common tick species found in South Africa and affects cattle production as well as vectoring pathogens in regions of Africa and Asia. In an attempt to develop a non-toxic, lower cost and environmentally friendly tick control method, twenty-six plant extracts were prepared from thirteen plant species using 99.5% acetone and 99% ethanol. The adapted Shaw Larval Immersion Test (SLIT) was used to test the efficacy of the extracts. A 1% solution of each of the plant extracts was prepared for efficacy testing and the ethanol extracts were found to have better acaricidal activity than the acetone extracts. The ethanol extract from the leaves and flowers of Calpurnia aurea had the best activity [corrected mortality (CM)=82.9%] which was followed by the stem extract of Cissus quadrangularis (CM=80.4%). The plant species were screened against Vero cells and were found to have low toxicity. From this study it is apparent that there is potential for the development of botanicals as natural acaricides against R. (B.) decoloratus. PMID:27270388

  5. Mitigation of Resistance Through Mixtures of Traditional Pesticides, Anti-tick Vaccines, and New Acaricides Developed by the Pharmaceutical Industry

    Science.gov (United States)

    Over the past 70 years, the southern cattle tick, Rhipicephalus (Boophilus) microplus, has developed resistance to every acaricide available for its control. Recently, populations of R. microplus have evolved simultaneous resistance to multiple classes of acaricides. These multi-resistant population...

  6. The effects of a pour-on formulation of fluazuron 2.5 % and flumethrin 1 % on populations of Rhipicephalus decoloratus and Rhipicephalus microplus both on and off bovine (Bonsmara breed) hosts.

    Science.gov (United States)

    Fourie, Josephus J; Liebenberg, Julian E; Nyangiwe, Nnkululeko; Austin, Clinton; Horak, Ivan G; Bhushan, Chandra

    2013-08-01

    The present study demonstrated the efficacy of a pour-on formulation of fluazuron 2.5 % and flumethrin 1 % (Drastic Deadline eXtreme®) against Rhipicephalus decoloratus and Rhipicephalus microplus on cattle on pasture previously grazed by experimentally infested animals. Six tick-free cattle were placed on the pasture and treated 7 days later (Day 0) with the pour-on. They were retreated on Days 63, 126 and 189 and monthly tick counts were done. Mean numbers of adult R. decoloratus and/or R. microplus decreased from 53 and 14 on Days 56 and 112 respectively to 2 or less on all other occasions including Day 254. Compared to the numbers of R. decoloratus and/or R. microplus larvae collected from vegetation in the previous year, larval numbers declined by 40.7 % on Day 28, and thereafter reduction remained between 84 % and 100 %. Pairs of tracer calves placed on the pasture for 7 days each month were then held in pens and adult ticks that detached collected. Reduction in the numbers of R. decoloratus collected from tracer animals was 75 % on Day 56 and remained above 93 % except for Day 224 when it temporarily decreased to 78.5 %. Reduction in the numbers of R. microplus was 97.5 % on Day 28 and remained above 98 % until the conclusion of the study on Day 254. Treatment with the pour-on formulation of fluazuron and flumethrin resulted in a marked decrease in the numbers of R. decoloratus and/or R. microplus on treated cattle followed by a reduction in the numbers of larvae questing on the vegetation and ticks picked up by tracer calves. No other potential host species for R. decoloratus and/or R. microplus were present in the camps. PMID:23749085

  7. Evaluation of the Efficacy of Acaricides Used to Control the Cattle Tick, Rhipicephalus microplus, in Dairy Herds Raised in the Brazilian Southwestern Amazon

    Directory of Open Access Journals (Sweden)

    Luciana G. Brito

    2011-01-01

    Full Text Available The adult immersion test (AIT was used to evaluate the efficacy of acaricide molecules used for control of Rhipicephalus microplus on 106 populations collected in five municipalities in the state of Rondônia in the Brazilian South Occidental Amazon region. The analysis of the data showed that the acaricide formulations had different efficacies on the tick populations surveyed. The synthetic pyrethroids (SPs acaricides were the least effective (48.35–76.84%, followed by SP + organophosphate (OP associations (68.91–81.47% and amidine (51.35–100%. For the macrocyclic lactones (MLs, the milbemycin (94.84–100% was the most effective, followed by spinosad (93.21–100% and the avermectins (81.34–100%. The phenylpyrazole (PZ group had similar efficacy (99.90% to the MLs. Therefore, SP acaricides, including associations with OP, and formulations based on amidine presented low in vitro efficacy to control the R. microplus populations surveyed.

  8. Loss of in vitro Efficacy of Topical Commercial Acaricides on Rhipicephalus microplus (Ixodida: Ixodidae) From Antioquian Farms, Colombia.

    Science.gov (United States)

    Puerta, Jonathan M; Chaparro, Jenny J; Lopez-Arias, Anderson; Arroyave, Sara Arias; Villar, David

    2015-11-01

    In Antioquia, the problems to control Rhipicephalus microplus (Canestrini, 1888) tick infestations have spread and ranchers claim conventional treatments are no longer effective. In this study, the in vitro efficacy of commercial topical products was tested with ticks obtained from two dairy farms in Antioquia with severe repeated infestations. About 800 engorged ticks were collected directly from animals in two separate visits at the beginning and end of the same month. The adult immersion test was used, which exposed groups of 40 ticks from each collection at the recommended concentration for five commercial products and combinations for 5 min. Efficacy was determined by comparing the reproductive index (fecundity × fertility) of each treated group to that of the control group. The values of all reproductive parameters obtained with ticks from the two collection dates were very similar. Cypermethrin (150 ppm) and amitraz (208 ppm) separately showed very low efficacies of only 10-20% at one farm, and zero at the other. The combination of chlorpyrifos + cypermethrin was the only product with an efficacy >50% at both farms and field observations corroborated to be still capable of eliminating infestations. Exposure to fluazuron at concentrations ranging from 0.05 to 500 ppm for 1 min reduced fertility in all groups by ≥99%, as would be expected for very susceptible strains. However, reduction of oviposition only occurred at the 500 ppm concentration. In conclusion, there is a high degree of resistance to all products tested except for fluazuron. PMID:26336268

  9. Partial selective treatment of Rhipicephalus microplus and breed resistance variation in beef cows in Rio Grande do Sul, Brazil.

    Science.gov (United States)

    Molento, Marcelo Beltrão; Fortes, Fernanda Silva; Buzatti, Andréia; Kloster, Fernando Staude; Sprenger, Lew Kan; Coimbra, Eliane; Soares, Luis Dorneles

    2013-02-18

    Rhipicephalus microplus infestation causes heavy losses in cattle. The majority of farmers control the cattle tick by using long-acting drugs throughout the year, which evidently increases selection pressure for drug resistance. Partial selective treatment (PST) may be used to directly reduce selection pressure by treating only the portion of the herd that is most infested. The objective of this work was to determine the effect of PST in two herds of beef cows and the effect of breed tolerance. The Santiago (n=306 animals) and the São Francisco de Assis (n=204 animals) herds were composed of up to eight pure breeds of Bos taurus and Bos indicus and their crosses and were evaluated during the first and second (8 months) tick generations. Ticks larger than 4.5mm were counted on one side of the animal, and the animals were treated when numbers exceeded 20 ticks per host. On both farms, the tick-tolerant breeds with a high proportion of B. indicus (Braford, Brangus, and Nellore) consistently carried fewer ticks than Charolais. The economical evaluation showed an average profit margin in the use of PST of 674.25% and 1394.5% on the Santiago and São Francisco de Assis farms, respectively, in comparison to all-herd treatment. These results indicate that PST is a reliable tool for health management and may be used as a standard protocol for tick control with significant economic benefits on farms. In addition, the maintenance of the highest possible tolerant/resilient breeds is also an essential factor that should be considered in today's more sustainable animal production systems. PMID:23219046

  10. 新疆南疆微小牛蜱Bm86/Bm91双基因原核表达载体的构建%Construction of Prokaryotic Expression Vector of Bm86 and Bm91 Dual Genes of Boophilus microplus in South Xinjiang

    Institute of Scientific and Technical Information of China (English)

    代艳艳; 赵丽; 周桐; 罗福江; 周玉琴; 王帅; 刘永宏

    2014-01-01

    为构建微小牛蜱Bm86和Bm91双基因原核表达载体,以新疆生产建设兵团塔里木畜牧科技重点实验室获得的Bm86和Bm91克隆基因阳性菌或质粒DNA为模板,参照GenBank登录的微小牛蜱Bm86和Bm91基因序列和所用载体序列,设计可以扩增Bm86和Bm91基因完整阅读框架的引物,然后对新疆南疆微小牛蜱Bm86和Bm91基因进行PCR扩增、纯化、酶切后连接,构建双基因重组质粒pET-32a-Bm并鉴定.结果显示,成功构建Bm86和Bm91双基因重组质粒pET-32a-Bm,经测序鉴定和初始获得的Bm86和Bm91基因序列一致,未发生变异.

  11. Bm86 homologues and novel ATAQ proteins with multiple epidermal growth factor (EGF)-like domains from hard and soft ticks ☆

    OpenAIRE

    Nijhof, Ard M; Balk, Jesper A.; Postigo, Milagros; Rhebergen, Anne Marie; Taoufik, Amar; Jongejan, Frans

    2010-01-01

    Tick control on livestock relies principally on the use of acaricides but the development of acaricide resistance and concerns for environmental pollution underscore the need for alternative control methods, for instance through the use of anti-tick vaccines. Two commercial vaccines based on the recombinant Bm86 protein from Rhipicephalus (Boophilus) microplus ticks were developed. Partial protection of the Bm86 vaccine against other Rhipicephalus (Boophilus) and Hyalomma tick species suggest...

  12. Report on ticks collected in the Southeast and Mid-West regions of Brazil: analyzing the potential transmission of tick-borne pathogens to man

    OpenAIRE

    Figueiredo Luiz Tadeu Moraes; Badra Soraya Jabur; Pereira Luiz Eloy; Szabó Matias Pablo Juan

    1999-01-01

    Specimens of ticks were collected in 1993, 1996, 1997, and 1998, mostly from wild and domestic animals in the Southeast and Mid-West regions of Brazil. Nine species of Amblyommidae were identified: Anocentor nitens, Amblyomma cajennense, Amblyomma ovale, Amblyomma fulvum, Amblyomma striatum, Amblyomma rotundatum, Boophilus microplus, Boophilus annulatus, and Rhipicephalus sanguineus. The potential of these tick species as transmitters of pathogens to man was analyzed. A Flaviviridade Flavivir...

  13. Evidence for the role of white-tailed deer(Artiodactyla:Cervidae)in the epidemiology of cattle ticks and southern cattle ticks (Acari:Ixodidae)in reinfestations along the Texas/Mexico border in South Texas-A review and update

    Science.gov (United States)

    From 1907 when the fever tick eradication campaign began until 1933 the tick eradication methods of dipping cattle in an acaricide or "pasture vacation" were enormously successful in eradicating southern cattle ticks [SCT, Rhipicephalus (Boophilus) microplus (Canestrini)], until failures began to oc...

  14. Integration of ecologically-based approaches to re-eradicate cattle fever ticks from the U.S.

    Science.gov (United States)

    Here we summarize highlights of research conducted as part of a NIFA-AFRI funded grant. Cattle fever ticks, Rhipicephalus (Boophilus) microplus and R. (B.) annulatus, have been found on white-tailed deer (Odocoileus virginianus) complicating eradication efforts of the USDA’s Cattle Fever Tick Eradic...

  15. Bm86 midgut protein sequence variation in south Texas cattle fever ticks

    Science.gov (United States)

    Cattle fever ticks, Rhipicephalus (Boophilus) microplus and R. (B.) annulatus, vector bovine and equine babesiosis, and have significantly expanded beyond the permanent quarantine zone established in South Texas. Currently, there are no vaccines approved for use within the United States for controll...

  16. Immunization of cattle with Ra86 impedes Rhipicephalus appendiculatus nymphal-to-adult molting

    NARCIS (Netherlands)

    Olds, C.; Mwaura, S.; Crowder, D.; Odongo, D.; Oers, van M.M.; Owen, J.; Bishop, R.; Daubenberger, C.

    2012-01-01

    Commercial vaccines based on the tick gut protein Bm86 have been successful in controlling the one-host tick Rhipicephalus (Boophilus) microplus and provide heterologous protection against certain other non-target ixodid tick species. This cross protection, however, does not extend to the three-host

  17. Developing Novel Technology for the Control of Ticks of Veterinary and Human Importance

    Science.gov (United States)

    Among approximately 670 tick species in the world, the southern cattle tick Rhipicephalus (Boophilus) microplus and the black-legged tick Ixodes scapularis received the most attention in the United States due to their roles as the vectors of disease agents affecting cattle and humans, respectively. ...

  18. Efeito do extrato aquoso do algodão de seda (Calotropis procera Aiton sobre a eficiência reprodutiva do carrapato bovino Effect of aqueous extract of silk cotton (Calotropis procera Ait. R.Br. on the reproductive performance of Rhipicephalus microplus

    Directory of Open Access Journals (Sweden)

    S.F Lázaro

    2012-01-01

    Full Text Available O carrapato Rhipicephalus microplus é um dos principais parasitos dos rebanhos bovinos. Diferentes grupos de carrapaticidas sintéticos têm sido empregados para o controle desse ácaro, contudo, o uso constante desses produtos tem selecionado populações resistentes. Na tentativa de minimizar esses impactos tem-se buscado avaliar fitoterápicos para o controle desse parasito. Assim, objetivou-se analisar a eficácia in vitro do extrato aquoso do algodão de seda em diferentes concentrações no controle da postura e eclodibilidade dos ovos do R. microplus. Foram avaliados os efeitos das concentrações 1, 5, 10, 25, 50, 75 e 100% do extrato aquoso obtido juntamente com controles com água destilada ou com cipermetrina, 12,5 mg L-1, associada a organofosforado, 150 mg L-1, sobre a eficiência reprodutiva do carrapato. Foi realizado o biocarrapaticidograma sendo que a eficácia acaricida das concentrações 5, 25 e 100% foram superiores àquela observada para o produto comercial utilizado, que correspondeu a 93,98%, indicando a importância de futuras pesquisas para avaliar o potencial toxigênico e a eficácia in vivo dessa planta para o controle do R. microplus .The tick Rhipicephalus microplus is one of the main parasites of bovine herds. Different groups of synthetic acaricides have been used to control this mite; however, the constant use of these products has selected resistant populations. In an attempt to minimize these impacts, researchers have tried to evaluate herbal remedies to control this parasite. Therefore, the aim of this study was to analyze the in vitro efficacy of aqueous extract of silk cotton at different concentrations to control the hatchability of R. microplus eggs. The effects of the concentrations 1, 5, 10, 25, 50, 75 and 100% aqueous extract together with controls with distilled water or with cypermethrin, 12.5 mg L-1, associated with organophosphate, 150 mg L-1, were assessed on the reproductive efficiency of the

  19. Protective efficacy of bacterial membranes containing surface-exposed BM95 antigenic peptides for the control of cattle tick infestations.

    Science.gov (United States)

    Canales, Mario; Labruna, Marcelo B; Soares, João F; Prudencio, Carlos R; de la Fuente, José

    2009-12-01

    The Rhipicephalus (Boophilus) microplus BM86 and BM95 glycoproteins are homologous proteins that protect cattle against tick infestations. In this study, we demonstrated that the recombinant chimeric protein comprising tick BM95 immunogenic peptides fused to the A. marginale MSP1a N-terminal region for presentation on the Escherichia coli membrane was protective against R. microplus infestations in rabbits. This system provides a novel and simple approach for the production of tick protective antigens by surface display of antigenic protein chimera on live E. coli and suggests the possibility of using recombinant bacterial membrane fractions for vaccination against cattle tick infestations. PMID:19835826

  20. ANTI-TICK EFFECT OBSERVED IN MATURE PLANTS O TROPICAL LEGUMES Stylosanthes humilis and Stylosanthes hamata

    OpenAIRE

    CARLOS CRUZ-VAZQUEZ; MANUEL FERNANDEZ-RUVALCABA; JAIME SOLANO-VERGARA; ZEFERINO GARCIA-VAZQUEZ

    1999-01-01

    ABSTRACT The anti-tick effect of Stylosanthes humilis and Stylosanthes hamata was evaluated for mature plants on plots experimentally infested with larvae of the cattle tick Boophilus microplus. Cenchurus ciliaris was used as control grass. The effect was evaluated counting the total number of live tick larvae recovered by the double flannel flag technique from the experimental plots during a four week period. The effect observed in both Stylosanthes species did not show significant differenc...

  1. In vitro Culture of a Novel Genotype of Ehrlichia sp from Brazil

    Czech Academy of Sciences Publication Activity Database

    Zweygarth, E.; Schol, H.; Lis, K.; Cabezas Cruz, Alejandro; Thiel, C.; Silaghi, C.; Ribeiro, M.F.B.; Passos, L.M.F.

    2013-01-01

    Roč. 60, NOV 2013 (2013), s. 86-92. ISSN 1865-1674 Grant ostatní: EU(XE) FP7-PEOPLE-ITN No.238511 Institutional support: RVO:60077344 Keywords : Ehrlichia * Rhipicephalus (Boophilus) microplus * in vitro culture * tick cell * DH82 * endothelial cell * cattle * 16S rRNA * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.116, year: 2013

  2. Antiectoparasitic activity of the gum resin, gum haggar, from the East African plant, Commiphora holtziana

    OpenAIRE

    Birkett, Michael A.; Al Abassi, Sate; Kröber, Thomas; Chamberlain, Keith; Hooper, Antony M.; Guerin, Patrick M.; Pettersson, Jan; Pickett, John A.; Slade, Robin; Wadhams, Lester J.

    2010-01-01

    The mechanism of ixodid tick (Acari: Ixodidae) repellency by gum haggar, a resin produced by Commiphora holtziana (Burseraceae), was investigated by evaluating activity against the cattle tick, Boophilus microplus. In an arena bioassay, a hexane extract of the resin of C. holtziana exhibited a repellent effect lasting up to 5 h. The hydrocarbon fraction of the resin extract was shown to account for the repellent activity, and was analysed by coupled gas chromatography–mass spectrometry (GC–MS...

  3. Hemelipoglycoprotein from the ornate sheep tick, Dermacentor marginatus: structural and functional characterization

    Czech Academy of Sciences Publication Activity Database

    Dupejová, J.; Štěrba, Ján; Vancová, Marie; Grubhoffer, Libor

    2011-01-01

    Roč. 4, January (2011), s. 4. ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA AV ČR KJB600960906 Institutional research plan: CEZ:AV0Z60220518 Keywords : ORNITHODOROS PARKERI * BOOPHILUS MICROPLUS * MASS-SPECTROMETRY * CATTLE TICK * SOFT TICK * DORIN M * PROTEINS * HEMOLYMPH * VITELLOGENIN * LIPOPROTEIN Subject RIV: EA - Cell Biology Impact factor: 2.937, year: 2011

  4. Growing hairs in shorn cattle

    OpenAIRE

    Cecília José Veríssimo; Selma D'Agostino; Fernanda Pessoa; Luciandra Macedo Toledo; Keila Maria Roncato Duarte

    2013-01-01

    The shearing operation can provide double benefits to the cattle: they can become more heat tolerant and the tick infestation decreases. The cattle tick Rhipicephalus (Boophilus) microplus causes great losses to dairy cattle, especially to the Holstein cattle because they are very susceptible to this tick. Its control is becoming each day more difficult, owing to the increasing resistance to acaricides they are acquiring. The objective of this work was to study the growing of haircoat followi...

  5. Integrated strategy for sustainable cattle fever tick eradication in USA is required to mitigate the impact of global change

    OpenAIRE

    AdalbertoA.Pérez de León; PeteD.Teel; AllanN.Auclair; MatthewT.Messenger; RobertJ.Miller; GretaSchuster

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain a...

  6. Integrated Strategy for Sustainable Cattle Fever Tick Eradication in USA is Required to Mitigate the Impact of Global Change

    OpenAIRE

    Pérez de León, Adalberto A.; Teel, Pete D.; Auclair, Allan N.; Messenger, Matthew T; Guerrero, Felix D; Schuster, Greta; Miller, Robert J.

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood-feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain a...

  7. Experimental vaccination of sheep and cattle against tick infestation using recombinant 5′-nucleotidase

    OpenAIRE

    Hope, M.; Jiang, X.; Gough, J.; CADOGAN, L; JOSH, P; Jonsson, N.; P. Willadsen

    2010-01-01

    Limited prior evidence suggests that 5′-nucleotidase, an ectoenzyme principally located in the Malpighian tubules of the tick Rhipicephalus (Boophilus) microplus, could be an effective antigen in an anti-tick vaccine. To assess this, recombinant 5′-nucleotidase was expressed in Escherichia coli and used in vaccination trials with both sheep and cattle. Vaccinated sheep were challenged with freshly moulted adult ticks. Those with high titres of anti-nucleotidase antibodies showed significant p...

  8. HA03 as an Iranian Candidate Concealed Antigen for Vaccination against Hyalomma anatolicum anatolicum: Comparative Structural and In silico Studies

    OpenAIRE

    Mohammadi, A.; Aghaiypour, K; Keywanfar, H.; Paykari, H.,; Tajbakhsh, H.; Jalali, A.H.,; Safavieh, S.; Foroghi, A.

    2013-01-01

    In the last decades researchers had focused on developing a vaccine against tick based on protective antigen. Recombinant vaccines based on concealed antigen from Boophilus microplus have been developed in Australia and Cuba by the name of TICKGARD and GAVAC (De La Fuente and Kocan, 2006). Further studies on this antigen have shown some extent of protection against other species (De Vos et al., 2001). In Iran most important species is Hyalomma anatolicum and limited information about its cont...

  9. Immunization and chemical conjugation of Bm95 obtained from Pichia pastoris enhances the immune response against vaccinal protein and Neisseria meningitidis capsular polysaccharide

    OpenAIRE

    Rodriguez Valle, Manuel

    2014-01-01

    Manuel Rodriguez-Valle,1 Leonardo Canan-Hadden,2 Olivia Niebla2 1Animal Biotechnology Division, 2Analytical Division, Centre for Genetic Engineering and Biotechnology, Havana, Cuba Abstract: The ectoparasite Rhipicephalus (Boophilus) microplus causes severe economic losses to the cattle industry in tropical and subtropical regions, and transmits endoparasites, such as Babesia bovis. The glycoprotein Bm95 is homologous to Bm86, a surface membrane protein of gut epithelial cells in R. microplu...

  10. Bm86 midgut protein sequence variation in South Texas cattle fever ticks

    OpenAIRE

    Kammlah Diane M; Kappmeyer Lowell S; Davey Ronald B; Freeman Jeanne M; Olafson Pia U

    2010-01-01

    Abstract Background Cattle fever ticks, Rhipicephalus (Boophilus) microplus and R. (B.) annulatus, vector bovine and equine babesiosis, and have significantly expanded beyond the permanent quarantine zone established in South Texas. Currently, there are no vaccines approved for use within the United States for controlling these vectors. Vaccines developed in Australia and Cuba based on the midgut antigen Bm86 have variable efficacy against cattle fever ticks. A possible explanation for this v...

  11. The evaluation of yeast derivatives as adjuvants for the immune response to the Bm86 antigen in cattle

    OpenAIRE

    Machado Héctor; Montero Carlos; Rodríguez Valle Manuel; Joglar Marisdania

    2001-01-01

    Abstract Background The Gavac™ vaccine against the cattle tick Boophilus microplus has proven its efficacy in a large number of controlled and field experiments. However, this vaccine could be further improved by searching for new alternative adjuvants that would induce a stronger long-lasting immune response. We conducted several experiments to assay the adjuvant effect of fractions of the recombinant yeast Pichia pastoris in mouse and cattle models. In previous experiments, the combination ...

  12. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    OpenAIRE

    Raquel Salazar B; Rolando Barahona-Rosales; María-Solange Sánchez P

    2016-01-01

    Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus) microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS) (Lucerna) or in grass pastures associated with sugarcane plantations (La Isabela). Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remain...

  13. Endectocide activity of a pour-on formulation containing 1.5 per cent ivermectin +0.5 per cent abamectin in cattle

    OpenAIRE

    Silva, Heloisa Cristina; Prette, Nancy; Lopes, Welber Daniel Zanetti; Sakamoto, Cláudio Alessandro M; Buzzulini, Carolina; dos Santos, Thais Rabelo; Cruz, Breno Cayeiro; Teixeira, Weslen F Pires; Felippelli, Gustavo; Carvalho, Rafael Silveira; Maciel, Willian Giquelin; Soares, Vando Edésio; da Costa, Alvimar José

    2015-01-01

    The present work aimed to evaluate, through ten different studies, the therapeutic efficacy of a new pour-on formulation, containing 1.5 per cent ivermectin +0.5 per cent abamectin, against parasites of cattle. Results obtained on trials against Rhipicephalus (Boophilus) microplus showed that the pour-on combination of 1.5 per cent ivermectin +0.5 per cent abamectin obtained superior efficacy indexes against this ectoparasite, when compared with formulations containing 0.5 per cent ivermectin...

  14. Proteomics Approach to the Study of Cattle Tick Adaptation to White Tailed Deer

    Directory of Open Access Journals (Sweden)

    Marina Popara

    2013-01-01

    Full Text Available Cattle ticks, Rhipicephalus (Boophilus microplus, are a serious threat to animal health and production. Some ticks feed on a single host species while others such as R. microplus infest multiple hosts. White tailed deer (WTD play a role in the maintenance and expansion of cattle tick populations. However, cattle ticks fed on WTD show lower weight and reproductive performance when compared to ticks fed on cattle, suggesting the existence of host factors that affect tick feeding and reproduction. To elucidate these factors, a proteomics approach was used to characterize tick and host proteins in R. microplus ticks fed on cattle and WTD. The results showed that R. microplus ticks fed on cattle have overrepresented tick proteins involved in blood digestion and reproduction when compared to ticks fed on WTD, while host proteins were differentially represented in ticks fed on cattle or WTD. Although a direct connection cannot be made between differentially represented tick and host proteins, these results suggested that differentially represented host proteins together with other host factors could be associated with higher R. microplus tick feeding and reproduction observed in ticks fed on cattle.

  15. Poderá o carrapato transmitir a lepra?: isolamento e cultura dum bacilo acido-álcool resistente de sedimento de "Amblyomma cajennense" capturado em leproso: 2ª nota May ticks transmit leprosy?: Second Note

    Directory of Open Access Journals (Sweden)

    H. C. Souza-Araujo

    1942-01-01

    Full Text Available In this 2nd note upon the possibility of transmission of human leprosy by ticks, the A. relates his stepps to obtain the collaboration of his colleagues working in leprosaria in various States of Brazil, Argentina and Paraguay in such studies. Firstly the A. describes the positive results of examination of sediment of ticks, the cattle tick Boophilus microplus (Canestrini, 1888, received from Paraná (Leprosário São Roque , which were put on active lepers, two of them sucking during 9 days and one during 7 days. Two out of three were killed for examination and were very strongly positive for acid-fast bacilli. A series of tubes of Loewenstein medium was smeared with the sediment of such ticks. Secondly the A. relates his personnal experiment, carried out in Rio de Janeiro, trying to infect normal ticks in lepers. The experiment with Boophilus microplus was negative and was twicely positive the experiment with Amblyomma cajennense Fabricius, 1794. The experiment is being in progress and will be continued in other places of Brazil. Finally, after being given the general characteristics of Boophilus microplus, the A. describes the non-chromogenic culture of a acid-fast bacillus isolated by him from sediment of ticks (Amblyomma cajennense captured in lepers from Colônia Santa Isabel (Minas gerais, which parasitism was spontaneous. The first isolation was obtained in Loewenstein medium after 62 days incubation at 37°C. The culture is pure and the bacillus is permanent acid-fast. The plate1, in full color, represents this culture in its four generations. The colonies are pearl-white in color, dry, elevated and rough, developing slowly and beginning as white pinhead points scattered upon the surface of the medium. The culture is not yet rich enough to be inoculated into laboratory animals, which will be done when possible.

  16. Report on ticks collected in the Southeast and Mid-West regions of Brazil: analyzing the potential transmission of tick-borne pathogens to man

    Directory of Open Access Journals (Sweden)

    Figueiredo Luiz Tadeu Moraes

    1999-01-01

    Full Text Available Specimens of ticks were collected in 1993, 1996, 1997, and 1998, mostly from wild and domestic animals in the Southeast and Mid-West regions of Brazil. Nine species of Amblyommidae were identified: Anocentor nitens, Amblyomma cajennense, Amblyomma ovale, Amblyomma fulvum, Amblyomma striatum, Amblyomma rotundatum, Boophilus microplus, Boophilus annulatus, and Rhipicephalus sanguineus. The potential of these tick species as transmitters of pathogens to man was analyzed. A Flaviviridade Flavivirus was isolated from Amblyomma cajennense specimens collected from a sick capybara (Hydrochaeris hydrochaeris. Amblyomma cajennense is the main transmitter of Rickettsia rickettsii (=R. rickettsi, the causative agent of spotted fever in Brazil. Wild mammals, mainly capybaras and deer, infested by ticks and living in close contact with cattle, horses and dogs, offer the risk of transmission of wild zoonosis to these domestic animals and to man.

  17. Evidence of a tick RNAi pathway by comparative genomics and reverse genetics screen of targets with known loss-of-function phenotypes in Drosophila

    Directory of Open Access Journals (Sweden)

    Kurscheid Sebastian

    2009-03-01

    Full Text Available Abstract Background The Arthropods are a diverse group of organisms including Chelicerata (ticks, mites, spiders, Crustacea (crabs, shrimps, and Insecta (flies, mosquitoes, beetles, silkworm. The cattle tick, Rhipicephalus (Boophilus microplus, is an economically significant ectoparasite of cattle affecting cattle industries world wide. With the availability of sequence reads from the first Chelicerate genome project (the Ixodes scapularis tick and extensive R. microplus ESTs, we investigated evidence for putative RNAi proteins and studied RNA interference in tick cell cultures and adult female ticks targeting Drosophila homologues with known cell viability phenotype. Results We screened 13,643 R. microplus ESTs and I. scapularis genome reads to identify RNAi related proteins in ticks. Our analysis identified 31 RNAi proteins including a putative tick Dicer, RISC associated (Ago-2 and FMRp, RNA dependent RNA polymerase (EGO-1 and 23 homologues implicated in dsRNA uptake and processing. We selected 10 R. microplus ESTs with >80% similarity to D. melanogaster proteins associated with cell viability for RNAi functional screens in both BME26 R. microplus embryonic cells and female ticks in vivo. Only genes associated with proteasomes had an effect on cell viability in vitro. In vivo RNAi showed that 9 genes had significant effects either causing lethality or impairing egg laying. Conclusion We have identified key RNAi-related proteins in ticks and along with our loss-of-function studies support a functional RNAi pathway in R. microplus. Our preliminary studies indicate that tick RNAi pathways may differ from that of other Arthropods such as insects.

  18. Efectos garrapaticidas de algunos aceites esenciales

    OpenAIRE

    Juan F. Gil; Burillo Alquézar, Jesús; Pastor, Ana; Ringuelet, Jorge; Elder, Heriberto; Echeverri, Fernando

    2013-01-01

    Soluciones acuo-etanólicas de aceites esenciales de Lippia (3 quimiotipos), Schinus molle, Tagetes, Lavandina (dos quimiotipos), Hisopo, Romero y Ciprés, fueron sometidas a ensayos in Vitro para evaluar sus efectos sobre le supervivencia y reproducción de las garrapata Rhipicephalus (Boophilus) microplus. Los aceites de Lippia, Tagetes e Hisopo mostraron buenos niveles de inhibición de la oviposición y de mortalidad superiores al 50%, a una concentración del 1%; no obstante, a concentracio...

  19. Efeito do óleo de eucalipto (Corymbia citriodora) no controle do carrapato bovino Effect of eucalyptus oil (Corymbia citriodora) on the control of cattle ticks

    OpenAIRE

    Clair Jorge Olivo; Carlos Alberto Agnolin; Carla Lieda Cezimbra Parra; Fernanda Silveira Flores Vogel; Neila Silvia Pereira dos Santos Richards; Luiz Gustavo de Pellegrini; Augusto Webe; Felipe Pivoto; Luciana Araujo

    2013-01-01

    Esta pesquisa foi conduzida com o objetivo de avaliar o efeito in vitro e in vivo do óleo de eucalipto (Corymbia citriodora) sobre o carrapato bovino (Rhipicephalus (Boophilus) microplus). Na experimentação in vitro, foi utilizado o grupo controle negativo e oito concentrações de óleo de eucalipto (0,5; 1; 2; 5; 10; 20; 50; 100%), em fêmeas ingurgitadas de carrapato. A eficácia de controle foi de 0; 30,5; 75,5; 91; 100; 100; 100; 100 e 100%, respectivamente. Para a experimentação in vivo, for...

  20. Cysteine proteases from bloodfeeding arthropod ectoparasites

    Czech Academy of Sciences Publication Activity Database

    Sojka, Daniel; Francischetti, I.M.B.; Calvo, E.; Kotsyfakis, Michalis

    2011-01-01

    Roč. 712, - (2011), s. 177-191. ISSN 0065-2598 R&D Projects: GA AV ČR IAA600960910; GA AV ČR IAA600960811; GA AV ČR KJB600960911; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : TICK HAEMAPHYSALIS-LONGICORNIS * PROLIXUS STAL HEMIPTERA * YELLOW - FEVER MOSQUITO * BLOOD-MEAL DIGESTION * L-LIKE ENZYME * BOOPHILUS-MICROPLUS * RHODNIUS-PROLIXUS * CATHEPSIN-B * ASPARAGINYL ENDOPEPTIDASES/LEGUMAINS * PROTEOLYTIC ACTIVATION Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.093, year: 2011

  1. Prevalência de carrapatos em cães de áreas rurais da região norte do Estado do Paraná Prevalence of ticks on dogs from rural areas at northern region of Paraná

    OpenAIRE

    Labruna, M. B.; S.L.P. Souza; J.S. Guimarães Jr.; R.C. Pacheco; Pinter, A; Gennari, S.M.

    2001-01-01

    During January and February, 2000, 133 dogs from 21 farms located in eight diferent counties at the northern region of Paraná, Brazil, were examined for ticks. Ticks found on dogs were collected and identified. Information about dog rearing system was also obtained. Fifty-five ticks were collected on 19 dogs (14.3%) from 11 farms (52.4%). Four species were identified: Rhipicephalus sanguineus (20 ticks on nine dogs from seven farms), Boophilus microplus (15 ticks on five dogs from five farms)...

  2. Large-scale production in Pichia pastoris of the recombinant vaccine Gavac against cattle tick.

    Science.gov (United States)

    Canales, M; Enríquez, A; Ramos, E; Cabrera, D; Dandie, H; Soto, A; Falcón, V; Rodríguez, M; de la Fuente, J

    1997-03-01

    A gene coding for the Bm86 tick protein was recently cloned, expressed in Pichia pastoris and shown to induce an inmunological response in cattle against ticks. Moreover, the Gavac vaccine (Heber Biotec S.A., Havana, Cuba), which contains this recombinant protein, has proved to control the Boophilus microplus populations under field conditions. This paper reviews the development and large-scale production of this vaccine, the efficacy of the resulting product and the strategy followed in designing its production plant. The production plant fulfills biosafety requirements and GMP. PMID:9141213

  3. Desarrollo de vacunas para el control de garrapatas.

    OpenAIRE

    Canales García-Menocal, Mario Manuel

    2010-01-01

    Las garrapatas Rhipicephalus (Boophilus) spp. afectan a la ganadería de los países de zonas tropicales y subtropicales provocando perdidas millonarias a la industria. Los métodos de control para combatirlas emplean baños garrapaticidas que contaminan el medio ambiente, la carne y la leche, y seleccionan garrapatas cada vez más resistentes. La vacunación, empleando la proteína rBm86 aislada del intestino de Rhipicephalus microplus como antígeno, controló eficazmente infestaciones por R. microp...

  4. Isotermas de adsorción y cinética de secado de ciertas hortalizas y aromáticas cultivadas en Misiones

    OpenAIRE

    S. V García; M.E Schmalko; A. Tanzariello

    2007-01-01

    Se realizó un estudio para conocer los acaricidas y las técnicas de aplicación utilizadas para el control de Rhipicephalus (Boophilus) microplus en el área favorable o intermedia para el desarrollo de esta garrapata del vacuno. Para ello se efectuaron 438 encuestas en establecimientos ganaderos del norte argentino donde se constató que el 81,5% de los establecimientos destinados a la producción bovina se dedican a la actividad de cría y el resto a la invernada o ciclo completo. Los acaricidas...

  5. Seroprevalencia de babesiosis bovina en la hacienda Vegas de la Clara, Gómez Plata (Antioquia), 2008

    OpenAIRE

    Richard Zapata Salas; Natasha Lara Ramírez; Armando Baena Zapata; Julián Reyes Vélez; Leonardo Alberto Ríos Osorio

    2011-01-01

    La babesiosis es una enfermedad del ganado bovino transmitida por la garrapata Rhipicephalus (Boophilus) microplus y causada por los parásitos protozoarios Babesia bovis y B. bigemina. Una zona se considera epizootiológicamente estable frente a Babesia spp, cuando el 75% de los bovinos entre las edades de 3 a 9 meses son serorreactivos (IgG) frente a Babesia bovis y Babesia bigemina y no hay evidencia de signos clínicos. El objetivo de esta investigación fue determinar la seroprevalencia de B...

  6. Control of tick infestations in cattle vaccinated with bacterial membranes containing surface-exposed tick protective antigens.

    Science.gov (United States)

    Almazán, Consuelo; Moreno-Cantú, Orlando; Moreno-Cid, Juan A; Galindo, Ruth C; Canales, Mario; Villar, Margarita; de la Fuente, José

    2012-01-01

    Vaccines containing the Rhipicephalus (Boophilus) microplus BM86 and BM95 antigens protect cattle against tick infestations. Tick subolesin (SUB), elongation factor 1a (EF1a) and ubiquitin (UBQ) are new candidate protective antigens for the control of cattle tick infestations. Previous studies showed that R. microplus BM95 immunogenic peptides fused to the Anaplasma marginale major surface protein (MSP) 1a N-terminal region (BM95-MSP1a) for presentation on the Escherichia coli membrane were protective against R. microplus infestations in rabbits. In this study, we extended these results by expressing SUB-MSP1a, EF1a-MSP1a and UBQ-MSP1a fusion proteins on the E. coli membrane using this system and demonstrating that bacterial membranes containing the chimeric proteins BM95-MSP1a and SUB-MSP1a were protective (>60% vaccine efficacy) against experimental R. microplus and Rhipicephalus annulatus infestations in cattle. This system provides a novel, simple and cost-effective approach for the production of tick protective antigens by surface display of antigenic protein chimera on the E. coli membrane and demonstrates the possibility of using recombinant bacterial membrane fractions in vaccine preparations to protect cattle against tick infestations. PMID:22085549

  7. Epidemiologia e controle da tristeza parasitária bovina na região sudeste do Brasil Epidemiology and control of bovine babesiosis and anaplasmosis in Southeast region of Brazil

    Directory of Open Access Journals (Sweden)

    Patrícia Macêdo Gonçalves

    2000-03-01

    Full Text Available A babesiose bovina e a anaplasmose (Tristeza Parasitária Bovina são enfermidades transmitidas pelo carrapato Boophilus microplus e por moscas hematófagas, respectivamente, ocorrendo em caráter endêmico no Brasil, acarretando elevadas perdas econômicas na pecuária. Nesse país, observa-se uma grande variedade de fatores epidemiológicos influenciando sua ocorrência, tais como: variação climática, práticas de manejo, controle de carrapato e introdução de bovinos susceptíveis. Assim, esta revisão aborda aspectos epidemiológicos do controle da anaplasmose e da babesiose bovina do Brasil, com ênfase na região sudeste. Fatores que influenciam a instabilidade e a estabilidade enzoótica de ambas as espécies também são discutidos. As medidas de controle empregadas atualmente são: quimioprofilaxia, o uso de acaricidas para o controle do carrapato vetor B. microplus, a premunição e a vacinação.Bovine babesiosis and anaplasmosis are diseases transmitted by Boophilus microplus and haematophagous diptera, respectively, occurring in endemic character in Brazil, resulting in high economic loss on livestock production. In this country a wide range of epidemiological factors influencing their occurrence, such as climate variations, husbandry practices, tick control and susceptible purebreed cattle that are regularly imported to upgrade local stocks have been described. This review focuses the epidemiological control and some aspects of bovine babesiosis and anaplasmosis in Brazil, with emphasis in southeast region. Factors influencing enzootic stability and instability of both species are also discussed. The control measures employed at present are chemoprophylaxis, use of acaricides for B. microplus, premunition and vaccination.

  8. Cold storage and cryopreservation of tick cell lines

    Directory of Open Access Journals (Sweden)

    Lallinger Gertrud

    2010-04-01

    Full Text Available Abstract Background Tick cell lines are now available from fifteen ixodid and argasid species of medical and veterinary importance. However, some tick cell lines can be difficult to cryopreserve, and improved protocols for short- and long-term low temperature storage will greatly enhance their use as tools in tick and tick-borne pathogen research. In the present study, different protocols were evaluated for cold storage and cryopreservation of tick cell lines derived from Rhipicephalus (Boophilus decoloratus, Rhipicephalus (Boophilus microplus, Ixodes ricinus and Ixodes scapularis. For short-term cold storage, cells were kept under refrigeration at 6°C for 15, 30 and 45 days. For cryopreservation in liquid nitrogen, use of a sucrose-phosphate-glutamate freezing buffer (SPG as cryoprotectant was compared with dimethylsulfoxide (DMSO supplemented with sucrose. Cell viability was determined by the trypan blue exclusion test and cell morphology was evaluated in Giemsa-stained cytocentrifuge smears. Results Cold storage at 6°C for up to 30 days was successful in preserving R. (B. microplus, R. (B. decoloratus, I. ricinus and I. scapularis cell lines; lines from the latter three species could be easily re-cultivated after 45 days under refrigeration. While cell lines from all four tick species cryopreserved with 6% DMSO were successfully resuscitated, the R. (B. decoloratus cells did not survive freezing in SPG and of the other three species, only the R. (B. microplus cells resumed growth during the observation period. Conclusions This constitutes the first report on successful short-term refrigeration of cells derived from R. (B. decoloratus, R. (B. microplus, and I. ricinus, and use of SPG as an alternative to DMSO for cryopreservation, thus making an important contribution to more reliable and convenient tick cell culture maintenance.

  9. Babesia bovis and B. bigemina DNA detected in cattle and ticks from Zimbabwe by polymerase chain reaction

    Directory of Open Access Journals (Sweden)

    I. Smeenk

    2000-07-01

    Full Text Available From blood collected from 94 cattle at 12 locations in the eastern and northeastern areas of Zimbabwe, DNA was extracted and analysed by polymerase chain reaction with primers previously reported to be specific for Babesia bigemina and Babesia bovis. Overall, DNA of Babesia bigemina was detected in the blood of 33/94 (35 % cattle and DNA from B. bovis was detected in 27/58 (47 % of cattle. The prevalence of DNA of B. bigemina was significantly higher in young animals (<2 years (23/46 than in animals over 2 years of age (10/48; (chi2 = 8.77; P < 0.01 %. Although tick sampling was not thorough, Boophilus decoloratus could be collected at 7/9 sites sampled and Boophilus microplus at 4/9 sites. Of the 20 B. decoloratus allowed to oviposit before PCR analysis, 1 (5 % contained DNA that could be amplified with primers for B. bigemina while 12 (60 % were positive with primers for B. bovis. Of the B. microplus allowed to oviposit, 11/16 (69 % were positive for B. bovis DNAby PCR and 2/16 (12 % were positive for B. bigemina.

  10. Recombinant Rhipicephalus appendiculatus gut (Ra86 and salivary gland cement (Trp64 proteins as candidate antigens for inclusion in tick vaccines: protective effects of Ra86 on infestation with adult R. appendiculatus

    Directory of Open Access Journals (Sweden)

    Saimo M

    2011-11-01

    Full Text Available Margaret Saimo1,2,*, David O Odongo3,4,*, Stephen Mwaura3, Just M Vlak1, Anthony J Musoke5, George W Lubega2, Richard P Bishop3, Monique M van Oers11Laboratory of Virology, Wageningen University, Wageningen, The Netherlands; 2School of Veterinary Medicine, Makerere University, Kampala, Uganda; 3International Livestock Research Institute, Nairobi, Kenya; 4School of Biological Sciences, University of Nairobi, Nairobi, Kenya; 5Onderstepoort Veterinary Institute, Onderstepoort, Pretoria, South Africa *These two authors made an equal contribution to this workAbstract: Rhipicephalus appendiculatus gut protein Ra86 (variants Ra85A and Ra92A and the salivary gland cement protein (Trp64 were expressed in the baculovirus-insect cell system. The recombinant gut proteins expressed as soluble proteins and the recombinant cement protein, as insoluble inclusion bodies, were used to immunize rabbits, which were then challenged with larval, nymphal, and adult stages of R. appendiculatus ticks. High tick mortality (23.3% occurred on adult ticks that fed on rabbits vaccinated with the gut proteins, compared with 1.9% mortality in ticks that fed on unvaccinated naïve control rabbits. The mean weight of engorged female ticks was significantly reduced by 31.5% in rabbits vaccinated with the Ra86 recombinant protein compared with controls, as was egg production. Marked effects on these parameters were also observed in adult ticks as a result from vaccination using Trp64, but these were not statistically significant. For both antigens, there was no demonstrable effect on larval or nymphal ticks. This study demonstrates for the first time the protective efficacy of a homolog of Boophilus microplus Bm86 in reducing tick infestation by the adult stage of the three-host tick R. appendiculatus. The results demonstrate the potential of Ra86 for vaccine development against this tick and for the control of East Coast fever.Keywords: baculovirus, Ra85A, Ra92A, Boophilus

  11. Characterization of ferritin 2 for the control of tick infestations.

    Science.gov (United States)

    Hajdusek, Ondrej; Almazán, Consuelo; Loosova, Gabriela; Villar, Margarita; Canales, Mario; Grubhoffer, Libor; Kopacek, Petr; de la Fuente, José

    2010-04-01

    Ixodes ricinus is one the most abundant tick species in Europe and these ticks transmit pathogens causing human and animal diseases. The cattle ticks, Rhipicephalus (Boophilus) spp., affect cattle production in tropical and subtropical regions of the world. Development of vaccines directed against tick proteins may reduce tick infestations and the transmission of tick-borne pathogens. However, a limiting step in tick vaccine development has been the identification of tick protective antigens. Herein, the tick iron metabolism pathway was targeted in an effort to identify new tick protective antigens. Recombinant I. ricinus (IrFER2) and Rhipicephalus microplus (RmFER2) ferritin 2 proteins were expressed in Escherichia coli and used to immunize rabbits and cattle, respectively. Vaccination with IrFER2 reduced I. ricinus tick numbers, weight and fertility in rabbits with an overall vaccine efficacy (E) of 98%. Control of cattle tick, R. microplus and Rhipicephalus annulatus infestations was obtained in vaccinated cattle with overall E of 64% and 72%, respectively. Notably, the efficacy of the RmFER2 vaccine was similar to that obtained with Bm86 against R. microplus. These collective results demonstrated the feasibility of using ferritin 2 to develop vaccines for the control of tick infestations. PMID:20171306

  12. Óleo de citronela no controle do carrapato de bovinos Citronella oil on the control of catle ticks

    OpenAIRE

    Clair Jorge Olivo; Nelcy Madruga de Carvalho; José Henrique Souza da Silva; Fernanda Flores Vogel; Péricles Massariol; Gilmar Meinerz; Carlos Agnolin; Ademir Farias Morel; Luiz Volnei Viau

    2008-01-01

    O objetivo deste estudo foi avaliar o efeito in vivo e in vitro do óleo de citronela (Cymbopogon nardus (L.) Rendle) no carrapato de bovinos (Boophilus microplus). O óleo foi obtido de folhas frescas pelo processo de destilação e o rendimento foi de 0,7%. Para as experimentações in vitro foram usadas sete (0; 0,5; 1,0; 10,0; 25,0; 50,0; 100,0%) e nove (0,1; 0,25; 0,5; 1,0; 2,0; 10,0; 25,0; 50,0; 100%) concentrações de óleo de citronela, sendo testadas em fêmeas ingurgitadas. A eficácia observ...

  13. Integrated tick and tick-borne disease control trials in crossbred dairy cattle in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Whiteland, A. P.; Mfitilodze, M. W.;

    1996-01-01

    Crossbred dairy heifers on a farm in an East Coast fever (ECF) endemic area in Malawi were immunised against Theileria parva, Anaplasma spp., Babesia bigemina, Babesia bovis and Cowdria ruminantium. They were treated at infrequent intervals with chlorfenvinphos to limit infestation with adult ticks......, without providing complete tick control. In one trial, which tested a threshold dipping regimen, 20 heifers were dipped only once in 6 months to control a flush of Boophilus microplus. Unimmunised controls showed serological evidence of exposure to T. parva and B. bigemina, and one died of ECF, but there...... were no incidents of tick-borne disease in the immunised group. In a second trial, which tested a strategic dipping regimen, 107 animals were dipped 9 times over a 6 month period. Despite heavy challenge by B. bovis and moderate challenge by B. bigemina and Anaplasma spp, demonstrated serologically...

  14. Estudo comparativo do aspecto da hemolinfa de algumas espécies de carrapatos (Acari, Ixodidae: descrição da variação hemocitária de adultos de Amblyomma cajennense (Fabricius Koch Comparative study of the hemolymph aspect from a few ticks species (Acari, Ixodidae: description of the hemocyte variation of adults of Amblyomma cajennense (Fabricius Koch

    Directory of Open Access Journals (Sweden)

    Maria Elisa Carneiro

    2002-07-01

    Full Text Available The hemocyte composition of adults of Amblyomma cajennense (Fabricius, 1787 Koch, 1844 adults consisted of three basic cellular types: prahemocyte I (PR I, plasmatocyte (PL and spherulocyte (ES II. Among the ixodids observed (A. cajennense; A. dissimile Koch, 1844; Rhipicephalus sanguineus Latreille, 1806; Anocentor nitens (Neumann, 1897 Schulze, 1937; Boophilus microplus Canestrini, 1887 and Haemaphysalis sp. only A. cajennense was different in the adult hemolymph colour. It changed from amber to deep blue as the ixodid age advanced. This fact could be associated with the presence of hemocyanin in the hemolymph and points out the need to develop further investigations about the Ixodidae hemolymph pratein composition as well as the function of all the types found in it. This information could aid the studies on ticks control.

  15. Laboratory Scale Production of Recombinant Haa86 Tick Protein in Pichia pastoris and in Escherichia coli System.

    Science.gov (United States)

    Kumar, Binod; P, Azhahianambi; Ghosh, Srikant

    2016-01-01

    The commercial recombinant Bm86-based vaccines against Rhipicephalus (Boophilus) microplus in Australia (TickGARD™, TickGARD plus™) and in Cuba (Gavac™) provided significant impetus to researchers globally to work on anti-tick vaccines. The Bm86 homologue of Hyalomma anatolicum anatolicum Izatnagar isolate, rHaa86, is considered a potent vaccine candidate against Hyalomma tick species, transmitting animal and human diseases. The two expression systems, prokaryotic, using bacterial expression plasmid vectors and Escherichia coli, and eukaryotic, using methylotrophic yeast Pichia pastoris and yeast expression plasmid vectors, are used in the laboratory level production of rHaa86. Unlike proteins expressed in prokaryotic system, eukaryotic system-expressed proteins are glycosylated and may be a requisite for proper immunogenicity. Here, the protocol for laboratory scale expression of rHaa86 antigen in E. coli and P. pastoris for development of an anti-Hyalomma tick vaccine is described. PMID:27076316

  16. Differential transcription of two highly divergent gut-expressed Bm86 antigen gene homologues in the tick Rhipicephalus appendiculatus (Acari: Ixodida).

    Science.gov (United States)

    Kamau, L; Skilton, R A; Odongo, D O; Mwaura, S; Githaka, N; Kanduma, E; Obura, M; Kabiru, E; Orago, A; Musoke, A; Bishop, R P

    2011-02-01

    The transcriptional control of gene expression is not well documented in the Arthropoda. We describe transcriptional analysis of two exceptionally divergent homologues (Ra86) of the Bm86 gut antigen from Rhipicephalus appendiculatus. Bm86 forms the basis of a commercial vaccine for the control of Rhipicephalus (Boophilus) microplus. The R. appendiculatus Ra86 proteins contain 654 and 693 amino acids, with only 80% amino acid sequence identity. Reverse-transcription PCR of gut cDNA showed transcription of only one genotype in individual female ticks. PCR amplification of 3' untranslated sequences from genomic DNA indicated that both variants could be encoded within a single genome. When both variants were present, one of the two Ra86 genotypes was transcriptionally dominant. PMID:20854482

  17. Vaccination against ticks and the control of ticks and tick-borne disease

    International Nuclear Information System (INIS)

    Economic losses due to ticks and tick-borne disease of livestock fall disproportionately on developing countries. Currently, tick control relies mostly on pesticides and parasite-resistant cattle. Release of a commercial recombinant vaccine against Boophilus microplus in Australia in 1994 showed that anti-tick vaccines are a feasible alternative. For vaccines, it is important to understand the efficacy needed for a beneficial outcome. In this, it is relevant that some tick antigens affect multiple tick species; that existing vaccines could be improved by the inclusion of additional tick antigens; and that vaccination against ticks can have an impact on tick-borne disease. Practically, although recombinant vaccine manufacture involves relatively few steps, issues of intellectual property rights (IPR) and requirements for registration of a product may affect economic viability of manufacture. Hence practical vaccines for the developing world will require both successful science and a creative 'business solution' for delivery in a cost-effective way. (author)

  18. Characterization of Gut-associated Cathepsin D Hemoglobinase from Tick Ixodes ricinus (IrCD1)

    Czech Academy of Sciences Publication Activity Database

    Sojka, Daniel; Franta, Zdeněk; Frantová, Helena; Bartošová, Pavla; Horn, Martin; Váchová, Jana; O’Donoghue, A. J.; Eroy-Reveles, A. A.; Craik, C. S.; Knudsen, G. M.; Caffrey, C. R.; McKerrow, J. H.; Mareš, Michael; Kopáček, Petr

    2012-01-01

    Roč. 287, č. 25 (2012), s. 21152-21163. ISSN 0021-9258 R&D Projects: GA AV ČR IAA600960910; GA MŠk(CZ) LC06009; GA AV ČR KJB600960911; GA ČR GPP502/11/P682; GA AV ČR IAA400550705; GA ČR(CZ) GAP207/10/2183 Institutional research plan: CEZ:AV0Z60220518 Institutional support: RVO:61388963 Keywords : RHIPICEPHALUS BOOPHILUS MICROPLUS * HARD TICK * ORNITHODOROS-MOUBATA * ASPARTIC PROTEINASE * RECOGNITION DOMAIN * MOLECULAR- CLONING * ACTIVE-SITE * EXPRESSION * INHIBITOR * PROTEASE Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.651, year: 2012

  19. ANTI-TICK EFFECT OBSERVED IN MATURE PLANTS O TROPICAL LEGUMES Stylosanthes humilis and Stylosanthes hamata

    Directory of Open Access Journals (Sweden)

    CARLOS CRUZ-VAZQUEZ

    1999-01-01

    Full Text Available ABSTRACT The anti-tick effect of Stylosanthes humilis and Stylosanthes hamata was evaluated for mature plants on plots experimentally infested with larvae of the cattle tick Boophilus microplus. Cenchurus ciliaris was used as control grass. The effect was evaluated counting the total number of live tick larvae recovered by the double flannel flag technique from the experimental plots during a four week period. The effect observed in both Stylosanthes species did not show significant differences (p > 0.05 between them and the larval survival percentage was 5.1 % for S. humilis and 7.5 % for S. hamata. In the first specie the anti-tick effect was lower than the one reported for young plants, but in S. hamata this effect was similar in young and mature plants. Further studies are necessary to complement the knowledge about this plant and to establish their use in field conditions..RESUMEN El efecto anti-garrapata de plantas maduras de las leguminosas tropicales Stylosanthes humilis y Stylosanthes hamata , fue evaluado en parcelas experimentalmente infestadas con larvas de garrapata Boophilus microplus, utilizando al pasto Cenchurus ciliaris como tratamiento testigo. El efecto fue evaluado contando el número total de larvas vivas recuperadas de las parcelas experimentales por la técnica de bandera de doble recorrido durante un periodo de cuatro semanas. El efecto anti-garrapata observado en ambas especies de Stylosanthes no mostró diferencias entre ellas (p<0.05, el porcentaje de sobrevivencia de larvas fue del 5.1% para S. humilis y 7.5% para S. hamata. En la primera especie el efecto anti-garrapata fue menor que el reportado en plantas jóvenes, pero en S. hamata este efecto fue similar en plantas maduras y jóvenes. Es necesario realizar más estudios para complementar el conocimiento que se tiene acerca de estas plantas y establecer su uso en condiciones de campo

  20. Bm86 homologues and novel ATAQ proteins with multiple epidermal growth factor (EGF)-like domains from hard and soft ticks☆

    Science.gov (United States)

    Nijhof, Ard M.; Balk, Jesper A.; Postigo, Milagros; Rhebergen, Anne Marie; Taoufik, Amar; Jongejan, Frans

    2010-01-01

    Tick control on livestock relies principally on the use of acaricides but the development of acaricide resistance and concerns for environmental pollution underscore the need for alternative control methods, for instance through the use of anti-tick vaccines. Two commercial vaccines based on the recombinant Bm86 protein from Rhipicephalus (Boophilus) microplus ticks were developed. Partial protection of the Bm86 vaccine against other Rhipicephalus (Boophilus) and Hyalomma tick species suggests that the efficacy of a Bm86-based vaccine may be enhanced when based on the orthologous recombinant Bm86 antigen. We therefore identified and analysed the Bm86 homologues from species representing the main argasid and ixodid tick genera, including two from the prostriate Ixodes ricinus tick species. A novel protein from metastriate ticks with multiple epidermal growth factor (EGF)-like domains which is structurally related to Bm86 was identified by using a 3′ rapid amplification of cDNA ends (3′-RACE) method with a degenerate primer based on a highly conserved region of Bm86 and its orthologues. This second protein was named ATAQ after a part of its signature peptide. Quantitative reverse transcriptase-PCR showed that ATAQ proteins are expressed in both midguts and Malpighian tubules, in contrast to Bm86 orthologues which are expressed exclusively in tick midguts. Furthermore, expression of this protein over the life stages of R. microplus and Rhipicephalus appendiculatus was more continuous compared with Bm86. Although a highly effective vaccine antigen, gene silencing of Bm86 by RNA interference (RNAi) produced only a weak phenotype. Similarly the RNAi phenotype of Rhipicephalus evertsi evertsi females in which the expression of Ree86, ReeATAQ or a combination of both genes was silenced by RNAi did not differ from a mock-injected control group. The vaccine potential of ATAQ proteins against tick infestations is yet to be evaluated. PMID:20647015

  1. Bm86 homologues and novel ATAQ proteins with multiple epidermal growth factor (EGF)-like domains from hard and soft ticks.

    Science.gov (United States)

    Nijhof, Ard M; Balk, Jesper A; Postigo, Milagros; Rhebergen, Anne Marie; Taoufik, Amar; Jongejan, Frans

    2010-12-01

    Tick control on livestock relies principally on the use of acaricides but the development of acaricide resistance and concerns for environmental pollution underscore the need for alternative control methods, for instance through the use of anti-tick vaccines. Two commercial vaccines based on the recombinant Bm86 protein from Rhipicephalus (Boophilus) microplus ticks were developed. Partial protection of the Bm86 vaccine against other Rhipicephalus (Boophilus) and Hyalomma tick species suggests that the efficacy of a Bm86-based vaccine may be enhanced when based on the orthologous recombinant Bm86 antigen. We therefore identified and analysed the Bm86 homologues from species representing the main argasid and ixodid tick genera, including two from the prostriate Ixodes ricinus tick species. A novel protein from metastriate ticks with multiple epidermal growth factor (EGF)-like domains which is structurally related to Bm86 was identified by using a 3' rapid amplification of cDNA ends (3'-RACE) method with a degenerate primer based on a highly conserved region of Bm86 and its orthologues. This second protein was named ATAQ after a part of its signature peptide. Quantitative reverse transcriptase-PCR showed that ATAQ proteins are expressed in both midguts and Malpighian tubules, in contrast to Bm86 orthologues which are expressed exclusively in tick midguts. Furthermore, expression of this protein over the life stages of R. microplus and Rhipicephalus appendiculatus was more continuous compared with Bm86. Although a highly effective vaccine antigen, gene silencing of Bm86 by RNA interference (RNAi) produced only a weak phenotype. Similarly the RNAi phenotype of Rhipicephalus evertsi evertsi females in which the expression of Ree86, ReeATAQ or a combination of both genes was silenced by RNAi did not differ from a mock-injected control group. The vaccine potential of ATAQ proteins against tick infestations is yet to be evaluated. PMID:20647015

  2. The level of infestation with the vector of cattle babesiosis in Argentina

    Directory of Open Access Journals (Sweden)

    Alberto A. Guglielmone

    1992-01-01

    Full Text Available Studies were carried out to determine the differential aptitude to sustain the only vector of cattle babesiosis in Argentina, the tick Boophilus microplus, throughout the infested region of this country. Tick counts on Bos taurus cattle were used as the main criterion to classify favourable (F, intermediate (I and unfavourable (U areas for its development. The geographical limits of each area set up using data of non-parasitic tick stages, temperature, water balance and map recognition of flooded and unflooded zones. The F area contained 16.5 x 10 (elevado a sexta potência ha with a cattle population of 6 x 10 (elevado a sexta potência; the I and U areas had 25 x 10 (elevado a sexta potência ha with 2.7 x 10 (elevado a sexta potência cattle and 198 x 10 (elevado a sexta potência with population of 2.4 x 10(elevado a sexta potência cattle, respectively. Research on the relationship amongst Babesia-Boophilus-cattle is needed in the F area for tick development which coincides with the best region for cattle breeding.

  3. Performance of two Bm86 antigen vaccin formulation against tick using crossbreed bovines in stall test.

    Science.gov (United States)

    Andreotti, Renato

    2006-01-01

    Cattle tick control remains a serious problem for cattle farms in Brazil due to the limited success achieved with chemicals. In Brazil, the use of vaccines for tick control associated with the use of chemicals and pasture rotation may open possibilities for integrated control. However, it is important to know whether regional Boophilus microplus strains are sensitive to antibodies produced by the available antigens: antigen preparations Gavac™ and TickGard(PLUS). The aim of this research was to evaluate the performance of two Bm86 antigen vaccine formulation against tick using crossbred bovines in stall test antigen against a regional B. microplus strain. The experiment was carried out in central Brazil (20 degrees 27'S, 54 degrees 37'W). A trial was conducted in stall conditions on crossbred cattle under controlled infestation. Two groups of 16 animals each, homogeneous in weight and sex, were vaccinated with Gavac™ or TickGard(PLUS), two groups of eight animals as control. Challenge was performed on three alternate days, with 5,000 larvae each time, beginning 21 days after the second injection. The antibody response was measured by ELISA and vaccinated animals presented immune response considering IgG levels. The results showed 49.2% and 46.4% protection efficacy for Gavac™ and TickGard(PLUS), respectively. PMID:16978472

  4. The impact of 2 dipping systems on endemic stability to bovine babesiosis and anaplasmosis in cattle in 4 communally grazed areas in Limpopo Province, South Africa

    Directory of Open Access Journals (Sweden)

    B.O. Rikhotso

    2005-06-01

    Full Text Available A 12-month study was conducted in 4 communal grazing areas in the Bushbuckridge region, Limpopo Province, South Africa. The main objective was to investigate the impact of reduced acaricide application on endemic stability to bovine babesiosis (Babesia bigemina and Babesia bovis and anaplasmosis (Anaplasma marginale in the local cattle population. To this end 60 cattle in each communal grazing area were bled at the beginning and the conclusion of the experimental period and their sera were assayed for B. bovis, B. bigemina and Anaplasma antibodies. Cattle in the intensively dipped group were dipped 26 times and maintained on a 14-day dipping interval throughout the study, whereas cattle in the strategically dipped group were dipped only 13 times. Three cattle, from which adult ticks were collected, were selected from each village, while immature ticks were collected by drag-sampling the surrounding vegetation. During the dipping process, a questionnaire aimed at assessing the prevalence of clinical cases of tick-borne disease, abscesses and mortalities was completed by an Animal Health Technician at each diptank. An increase in seroprevalence to B. bovis and B. bigemina and a decrease in seroprevalence to Anaplasma was detected in the strategically dipped group while in the intensively dipped group the converse was true. Amblyomma hebraeum was the most numerous tick species on the cattle, and Rhipicephalus (Boophilus microplus was more plentiful than Rhipicephalus (Boophilus decoloratus. Drag samples yielded more immature stages of A. hebraeum than of Rhipicephalus (Boophilus spp. The incidence of clinical cases of tick-borne disease and of abscesses increased in the strategically dipped group at the start of the survey.

  5. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    Science.gov (United States)

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed. PMID:26310511

  6. Ixodidas brasileiros e de alguns paizes limitrophes

    Directory of Open Access Journals (Sweden)

    Henrique de Beaurepaire Aragão

    1936-01-01

    Full Text Available The knowledge of the Ixodidae becomes every day, more and more important owing to the fact of the increasing number of diseases of man and animals they can transmit. In Brasil besides transmitting treponemosis, piroplasmosis and anaplasmosis to several domestic animals, the ticks are also responsible fo the transmission of the brazilian rocky mountain spotted fever (A. cajennense and Amblyomma striatum and they can also harbour the virus of the yellow fever and even to transmit it in laboratory experiments (A. cajennense, O. rostratus. The Brazilian fauna of ticks is a small one and has no more than 45 well-established species belonging to the genus Argas, Ornithodoros, Ixodes, Haemaphysalis, Rhipicephalus, Boophilus, Amblyomma and Spaelaeorhynchus. The genus Amblyomma is the best represented one, with 67% of all species of ticks known in Brazil. One of the most important species in the Amblyomma cajennense owing to its abundance and its wide parasitism in many vertebrates: reptiles, birds and mammals, incluing man, who is much attacked by the larva, the nymph and the adult of this species. The other ticks who attack the man are the Amblyomma brasiliense (the pecari tick, in the forests, and the Ornithodoros, especially the species. O. rostratus and brasiliensis. Other species can bite the man, but only occasionally, like Amblyomma fossum, striatum, oblongogutatum etc. Argas persicus, Rhipicephalus sanguineus and Boophilus are very important species not only as parasites but specially because they transmit several diseases to animals. Some of the ticks of the brazilian wild animals are now also parasites of the domestic ones and vice-versa. Arga persicus var. dissimilis is very common among the poultry and transmits the Treponema anserinum (gallinarum. Boophilus microplus is very abundant on our domestic and wild ruminants (Bos, Cervus, Mazama etc. and can also ben found on horse, dogs, Felis onca, Felis concolor etc., and it transmits to cattle

  7. Eficiência in vitro de acaricidas sobre carrapatos de bovinos no Estado do Rio Grande do Sul, Brasil In vitro evaluation of acaricides efficiency to bovine's ticks of Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Giovana Camillo

    2009-04-01

    Full Text Available A infestação por carrapatos em bovinos é responsável por perdas econômicas significativas à indústria animal em várias regiões brasileiras, incluindo o Rio Grande do Sul. As perdas se devem ao stress, a perdas de peso e a injúrias na pele, bem como aos custos com tratamentos. O uso indiscriminado de carrapaticidas tem contribuído para o aparecimento da resistência genética dos ixodídeos a várias drogas, representando um sério problema no controle de carrapatos. O objetivo deste trabalho foi avaliar a susceptibilidade das diferentes espécies de campo de Rhipicephalus (Boophilus microplus aos acaricidas usados nos controles dos parasitas. Para tanto, amostras de carrapato foram coletadas em 42 propriedades localizadas em diferentes municípios do Estado para a realização do teste de imersão de teleóginas (biocarrapaticidograma. A associação do amitraz e do clorpirifós resultou na droga que apresentou maior eficácia em 100% das propriedades testadas (11/11. Associações com cipermethrina-clorpirifós-citronelol foram eficientes nos carrapatos em 61% das propriedades (25/41 e cipermetrina-ethion, em 37% (10/27. A cipermetrina foi eficiente em 20,7% (6/29 e o amitraz, um dos produtos mais utilizados nas propriedades, foi eficiente em 14,2% (6/42 das propriedades. Os resultados demonstraram que muitas drogas utilizadas no controle do R. (B. microplus no Estado apresentaram baixa eficácia, conforme os resultados dos testes in vitro. A baixa eficácia das drogas provavelmente se deve à resistência genética desenvolvida pelos parasitas devido ao uso indiscriminado dos carrapaticidas a campo.Infestation by ticks is responsible for significant economic losses to the cattle industry in several regions, including Rio Grande do Sul (RS state. Losses may be derived from animal stress, weight loss and skin damage, as well as from costs with treatment. The indiscriminated use of pesticides against these parasites has resulted in

  8. Prevalence of equine Piroplasmosis and its association with tick infestation in the State of São Paulo, Brazil Prevalência da Piroplasmose equina e sua associação com infestação por carrapatos no Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Claudia E. Kerber

    2009-12-01

    Full Text Available Serum samples were collected from 582 horses from 40 stud farms in the State of São Paulo and tick (Acari: Ixodidae infestations were evaluated on them. Serum samples were subjected to the complement fixation test (CFT and a competitive inhibition ELISA (cELISA for Babesia caballi and Theileria equi. Logistic regression analyses were performed to construct multivariate models that could explain the dependent variable (horses positive for B. caballi or T. equi as a function of the independent variables (presence or abundance of each one of the tick species found on the farms. A higher overall prevalence of B. caballi (54.1% than of T. equi (21.6% was found by the two tests. The ticks Dermacentor nitens Neumann, 1897, Amblyomma cajennense (Fabricius, 1787 and Rhipicephalus (Boophilus microplus (Canestrini, 1887 were present on horses on 38 (95%, 20 (50%, and 4 (10% farms, respectively. Infestations by D. nitens were statistically associated with B. caballi-positive horses on the farms by either the CFT or cELISA. Infestations by A. cajennense were statistically associated with T. equi-positive horses on the farms by either CFT or cELISA.Amostras de soro sanguineo foram coletadas de 582 equinos de 40 haras no estado de São Paulo, onde as infestações por carrapatos foram avaliadas nos animais. Os soros foram testados por reação de fixação do complemento (RFC e ELISA competitivo por inibição (cELISA com antígenos de Babesia caballi e Theileria equi. Análises de regressão logística foram realizadas para construir modelos multivariados que pudessem explicar as variáveis dependentes (equinos positivos para B. caballi ou T. equi em função de variáveis independentes (presença e abundância de cada uma das espécies de carrapatos encontradas nos equinos dos haras. Em geral, os dois testes sorológicos indicaram uma prevalência maior para B. caballi (54,1% do que para T. equi (21,6%. Os carrapatos Dermacentor nitens Neumann, 1897

  9. Extrato aquoso de fumo em corda no controle do carrapato de bovinos Rope tobacco aqueous extract on the control of cattle ticks

    Directory of Open Access Journals (Sweden)

    Clair Jorge Olivo

    2009-07-01

    Full Text Available Este estudo teve por objetivo avaliar a eficiência de várias formulações feitas com fumo em corda no controle do carrapato (Boophilus microplus de bovinos leiteiros da raça Holandesa naturalmente infestados. Os tratamentos foram constituídos por Amitraz a 0,025%; extrato aquoso de fumo em corda (EFC a 1,25% + detergente neutro a 0,5% (em três aspersões, com intervalos de 24 horas entre elas; EFC a 1,25% + cal extinta a 1,25% (três aspersões; EFC a 5,0% + cal extinta a 2,0%, (três aspersões; EFC a 3,75% + detergente neutro a 0,5% (uma aspersão, e pelo grupo controle. Para a avaliação, foram observadas fêmeas ingurgitadas do carrapato, com comprimento superior a 4,0mm, antes da aplicação e no 1°, 2°, 3°, 4°, 5°, 6°, 7° e 14° dias após a aplicação de cada tratamento. A eficácia média de controle do carrapato no 14° dia foi de 100,0; 77,5; 22,0; 63,80; 25,3 e 0,0%, respectivamente. Verificou-se diferença significativa (PThis study aimed to evaluate the effectiveness of severals concentrations of rope tobacco against the tick (Boophilus microplus naturally infested on Rolstein dairy cattle. The treatments used were Amitraz at 0.025%; rope tobacco aqueous extract (RT at 1.25% + neutral detergent at 0.5% (tree aspersions, with interval of 24 hours among them, RT at 1.75% + withewash at 0.5% (tree aspersions; RT at 5.0% + withewash at 2.0% (tree aspersions; RT at 3.75% + neutral detergent at 0.5% (one aspersion and the control group. Engorged ticks were evaluate with length superior to 4.0 mm, before and at 1st, 2nd, 3rd, 4th, 5th, 6th, 7th and 14th day after treatment. The mean efficacy was 100.0; 77.5; 22.0; 63.8; 25.3 and 0.0%, respectively. Differences (P<0.05 among treatments with chemical product and rope tobacco formulations were observed.

  10. Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

    Directory of Open Access Journals (Sweden)

    Rosângela A. Da Silva

    2007-09-01

    Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  11. Compatibilidade de isolados de Beauveria bassiana (Ascomycetes: Clavicipitaceae com carrapaticidas químicos utilizados no controle do carrapato dos bovinos Compatibility of Beauveria bassiana (Ascomycetes: Clavicipitaceae with chemicals acaricides used in the control of cattle tick

    Directory of Open Access Journals (Sweden)

    Leila A. G. Barci

    2009-12-01

    Full Text Available O presente trabalho teve como escopo avaliar a compatibilidade dos isolados IBCB66 e IBCB21 de Beauveria bassiana com os carrapaticidas a base de Flumetrina + Coumafós, Deltametrina, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis, Cipermetrina e Amitraz utilizados no controle do carrapato Rhipicephalus (Boophilus microplus em nosso país. O efeito dos produtos comerciais sobre os isolados foi verificado por meio da observação do crescimento vegetativo, produção de conídios e viabilidade das estirpes do fungo B. bassiana. Com referência ao isolado IBCB66, os produtos Deltametrina, Cipermetrina High Cis e Amitraz foram classificados como compatíveis, não interferindo no desenvolvimento do entomopatógeno. O produto Cipermetrina foi classificado como tóxico e os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós e Diclorvós + Cipermetrina High Cis, muito tóxicos. Em relação ao isolado IBCB21, os produtos Flumetrina + Coumafós, Diclorvós + Cipermetrina, Diclorvós + Clorpirifós, Cipermetrina High Cis, Diclorvós + Cipermetrina High Cis e Cipermetrina foram classificados como muito tóxicos e o produto Amitraz como tóxico. Entre os carrapaticidas avaliados, o produto Deltametrina foi o único que não produziu efeito tóxico sobre o entomopatógeno.The purpose of the present study was to assess compatibility between IBCB66 and IBCB21 isolates of Beauveria bassiana and acaricides: Flumethrin + Coumaphos, Deltamethrin, Dichlorvos + Cypermethrin, Dichlorvos + Chlorpyrifos, Cypermethrin High Cis, Dichlorvos + Cypermethrin High Cis, Cypermethrin and Amitraz, utilized on the control of Rhipicephalus (Boophilus microplus in our country. The effect of commercial products on the isolates was assayed according to observation of vegetative growth, conidia production, and viability of strains of B. bassiana fungus. With concerning about IBCB66

  12. Integrated strategy for sustainable cattle fever tick eradication in USA is required to mitigate the impact of global change

    Directory of Open Access Journals (Sweden)

    Adalberto A. Pérez de León

    2012-06-01

    Full Text Available The ticks Rhipicephalus (Boophilus annulatus and R. (B. microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain arthropod species as vectors of infectious agents is associated with the history of research on bovine babesiosis and R. annulatus. Together, R. microplus and R. annulatus are referred to as cattle fever ticks (CFT. Bovine babesiosis became a regulated foreign animal disease in the United States of America (U.S. through efforts of the Cattle Fever Tick Eradication Program (CFTEP established in 1906. The U.S. was declared free of CFT in 1943, with the exception of a permanent quarantine zone in south Texas along the border with Mexico. This achievement contributed greatly to the development and productivity of animal agriculture in the U.S. The permanent quarantine zone buffers CFT incursions from Mexico where both ticks and babesiosis are endemic. Until recently, the elimination of CFT outbreaks relied solely on the use of coumaphos, an organophosphate acaricide, in dipping vats or as a spray to treat livestock, or the vacation of pastures. However, ecological, societal, and economical changes are shifting the paradigm of systematically treating livestock to eradicate CFT. Keeping the U.S. CFT-free is a critical animal health issue affecting the economic stability of livestock and wildlife enterprises. Here, we describe vulnerabilities associated with global change forces challenging the CFTEP. The concept of integrated CFT eradication is discussed in reference to global change.

  13. Molecular epidemiological surveillance to assess emergence and re-emergence of tick-borne infections in tick samples from China evaluated by nested PCRs.

    Science.gov (United States)

    Yu, Pei-Fa; Niu, Qing-Li; Liu, Zhi-Jie; Yang, Ji-Fei; Chen, Ze; Guan, Gui-Quan; Liu, Guang-Yuan; Luo, Jian-Xun; Yin, Hong

    2016-06-01

    An investigation was performed to detect eight pathogens in ticks collected from grass tips or animals in the southern, central and northeast regions of China. DNA samples extracted from ticks were collected from ten different locations in eight provinces of China and subjected to screening for tick-borne pathogens, including Borrelia burgdorferi sensu lato, Ehrlichia spp., Rickettsia spp., Babesia/Theileria spp., Ehrlichia ruminantium, Coxiella burnetii, and Francisella tularensis, using nested PCR assays and sequencing analysis. The results indicated that Borrelia spp., Rickettsia spp., and Babesia/Theileria spp. were detected in all of the investigated provinces. Ehrlichia spp. was also found in all of the surveyed areas, except Guangxi, Luobei and Tonghe counties in Heilongjiang province. The average prevalence of these pathogens was 18.4% (95% CI=12.8-42.5), 60.3% (95% CI=18.2-65.3), 26.0% (95% CI=25.8-65.1), and 28.7% (95% CI=5.6-35.2), respectively. A sequencing analysis of the pCS20 gene of E. ruminantium revealed an E. ruminantium-like organism (1/849, 0.1%, 95% CI=0-0.3) in one tick DNA sample extracted from Rhipicephalus (Boophilus) microplus in Hunan. In addition, Borrelia americana in Ixodes persulcatus, Babesia occultans in Haemaphysalis qinghaiensis and both Rhipicephalus sanguineus and an Ehrlichia muris-like organism in R. (B.) microplus was detected, possibly for the first time in China. Four DNA sequences closely related to Borrelia carolinensis and/or Borrelia bissettii from Haemaphysalis longicornis, Candidatus Rickettsia principis from H. qinghaiensis, and I. persulcatus and Ehrlichia canis (named E. canis-like) from Haemaphysalis bispinosa were also detected in this work. PMID:26943995

  14. Integrated Strategy for Sustainable Cattle Fever Tick Eradication in USA is Required to Mitigate the Impact of Global Change.

    Science.gov (United States)

    Pérez de León, Adalberto A; Teel, Pete D; Auclair, Allan N; Messenger, Matthew T; Guerrero, Felix D; Schuster, Greta; Miller, Robert J

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood-feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain arthropod species as vectors of infectious agents is associated with the history of research on bovine babesiosis and R. annulatus. Together, R. microplus and R. annulatus are referred to as cattle fever ticks (CFT). Bovine babesiosis became a regulated foreign animal disease in the United States of America (U.S.) through efforts of the Cattle Fever Tick Eradication Program (CFTEP) established in 1906. The U.S. was declared free of CFT in 1943, with the exception of a permanent quarantine zone in south Texas along the border with Mexico. This achievement contributed greatly to the development and productivity of animal agriculture in the U.S. The permanent quarantine zone buffers CFT incursions from Mexico where both ticks and babesiosis are endemic. Until recently, the elimination of CFT outbreaks relied solely on the use of coumaphos, an organophosphate acaricide, in dipping vats or as a spray to treat livestock, or the vacation of pastures. However, ecological, societal, and economical changes are shifting the paradigm of systematically treating livestock to eradicate CFT. Keeping the U.S. CFT-free is a critical animal health issue affecting the economic stability of livestock and wildlife enterprises. Here, we describe vulnerabilities associated with global change forces challenging the CFTEP. The concept of integrated CFT eradication is discussed in reference to global change. PMID:22712018

  15. Vaccination with BM86, subolesin and akirin protective antigens for the control of tick infestations in white tailed deer and red deer.

    Science.gov (United States)

    Carreón, Diana; de la Lastra, José M Pérez; Almazán, Consuelo; Canales, Mario; Ruiz-Fons, Francisco; Boadella, Mariana; Moreno-Cid, Juan A; Villar, Margarita; Gortázar, Christian; Reglero, Manuel; Villarreal, Ricardo; de la Fuente, José

    2012-01-01

    Red deer (Cervus elaphus) and white-tailed deer (Odocoileus virginianus) are hosts for different tick species and tick-borne pathogens and play a role in tick dispersal and maintenance in some regions. These factors stress the importance of controlling tick infestations in deer and several methods such as culling and acaricide treatment have been used. Tick vaccines are a cost-effective alternative for tick control that reduced cattle tick infestations and tick-borne pathogens prevalence while reducing the use of acaricides. Our hypothesis is that vaccination with vector protective antigens can be used for the control of tick infestations in deer. Herein, three experiments were conducted to characterize (1) the antibody response in red deer immunized with recombinant BM86, the antigen included in commercial tick vaccines, (2) the antibody response and control of cattle tick infestations in white-tailed deer immunized with recombinant BM86 or tick subolesin (SUB) and experimentally infested with Rhipicephalus (Boophilus) microplus, and (3) the antibody response and control of Hyalomma spp. and Rhipicephalus spp. field tick infestations in red deer immunized with mosquito akirin (AKR), the SUB ortholog and candidate protective antigen against different tick species and other ectoparasites. The results showed that deer produced an antibody response that correlated with the reduction in tick infestations and was similar to other hosts vaccinated previously with these antigens. The overall vaccine efficacy was similar between BM86 (E=76%) and SUB (E=83%) for the control of R. microplus infestations in white-tailed deer. The field trial in red deer showed a 25-33% (18-40% when only infested deer were considered) reduction in tick infestations, 14-20 weeks after the first immunization. These results demonstrated that vaccination with vector protective antigens could be used as an alternative method for the control of tick infestations in deer to reduce tick populations

  16. Bm86 midgut protein sequence variation in South Texas cattle fever ticks

    Directory of Open Access Journals (Sweden)

    Kammlah Diane M

    2010-11-01

    Full Text Available Abstract Background Cattle fever ticks, Rhipicephalus (Boophilus microplus and R. (B. annulatus, vector bovine and equine babesiosis, and have significantly expanded beyond the permanent quarantine zone established in South Texas. Currently, there are no vaccines approved for use within the United States for controlling these vectors. Vaccines developed in Australia and Cuba based on the midgut antigen Bm86 have variable efficacy against cattle fever ticks. A possible explanation for this variation in vaccine efficacy is amino acid sequence divergence between the recombinant Bm86 vaccine component and native Bm86 expressed in ticks from different geographical regions of the world. Results There was 91.8% amino acid sequence identity in Bm86 among R. microplus and R. annulatus sequenced from South Texas infestations. When South Texas isolates were compared to the Australian Yeerongpilly and Cuban Camcord vaccine strains, there was 89.8% and 90.0% identity, respectively. Most of the sequence divergence was focused in one region of the protein, amino acids 206-298. Hydrophilicity profiles revealed that two short regions of Bm86 (amino acids 206-210 and 560-570 appear to be more hydrophilic in South Texas isolates compared to vaccine strains. Only one amino acid difference was found between South Texas and vaccine strains within two previously described B-cell epitopes. A total of 4 amino acid differences were observed within three peptides previously shown to induce protective immune responses in cattle. Conclusions Sequence differences between South Texas isolates and Yeerongpilly and Camcord strains are spread throughout the entire Bm86 sequence, suggesting that geographic variation does exist. Differences within previously described B-cell epitopes between South Texas isolates and vaccine strains are minimal; however, short regions of hydrophilic amino acids found unique to South Texas isolates suggest that additional unique surface exposed

  17. ATP Binding Cassette Transporter Mediates Both Heme and Pesticide Detoxification in Tick Midgut Cells.

    Directory of Open Access Journals (Sweden)

    Flavio Alves Lara

    Full Text Available In ticks, the digestion of blood occurs intracellularly and proteolytic digestion of hemoglobin takes place in a dedicated type of lysosome, the digest vesicle, followed by transfer of the heme moiety of hemoglobin to a specialized organelle that accumulates large heme aggregates, called hemosomes. In the present work, we studied the uptake of fluorescent metalloporphyrins, used as heme analogs, and amitraz, one of the most regularly used acaricides to control cattle tick infestations, by Rhipicephalus (Boophilus microplus midgut cells. Both compounds were taken up by midgut cells in vitro and accumulated inside the hemosomes. Transport of both molecules was sensitive to cyclosporine A (CsA, a well-known inhibitor of ATP binding cassette (ABC transporters. Rhodamine 123, a fluorescent probe that is also a recognized ABC substrate, was similarly directed to the hemosome in a CsA-sensitive manner. Using an antibody against conserved domain of PgP-1-type ABC transporter, we were able to immunolocalize PgP-1 in the digest vesicle membranes. Comparison between two R. microplus strains that were resistant and susceptible to amitraz revealed that the resistant strain detoxified both amitraz and Sn-Pp IX more efficiently than the susceptible strain, a process that was also sensitive to CsA. A transcript containing an ABC transporter signature exhibited 2.5-fold increased expression in the amitraz-resistant strain when compared with the susceptible strain. RNAi-induced down-regulation of this ABC transporter led to the accumulation of metalloporphyrin in the digestive vacuole, interrupting heme traffic to the hemosome. This evidence further confirms that this transcript codes for a heme transporter. This is the first report of heme transport in a blood-feeding organism. While the primary physiological function of the hemosome is to detoxify heme and attenuate its toxicity, we suggest that the use of this acaricide detoxification pathway by ticks may

  18. A review of the ticks (Acari, Ixodida of Brazil, their hosts and geographic distribution - 1. The State of Rio Grande do Sul, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Evans DE

    2000-01-01

    Full Text Available A review of the ticks (Acari, Ixodida of the State of Rio Grande do Sul, southern Brazil, was completed as a step towards a definitive list (currently indicated as 12 of such species, their hosts and distribution. The ticks: Argas miniatus (poultry, Ixodes loricatus (opossums, Amblyomma aureolatum (dogs, A. calcaratum (anteaters, A. cooperi (capybaras, A. nodosum (anteaters, A. tigrinum (dogs (Neotropical and Rhipicephalus sanguineus (dogs (introduced, cosmopolitan, Afrotropical were confirmed as present, in addition to the predominant, Boophilus microplus (cattle (introduced, pan-tropical, Oriental. Of the further 18 species thus far reported in the literature as present in the state, but unavailable for examination: only Ornithodoros brasiliensis (humans and their habitations (Neotropical, Ixodes affinis (deer (Nearctic/Neotropical and I. auritulus (birds (Nearctic/Neotropical/Afrotropical/ Australasian are considered likely; 13 species would benefit from corroborative local data but the majority appear unlikely; reports of A. maculatum (Nearctic/Neotropical, but circum-Caribbean are considered erroneous; the validity of A. fuscum is in doubt. The very recent, first known report of the tropical Anocentor nitens (horses(Nearctic/Neotropical, but still apparent absence of the tropical A. cajennense (catholic (Nearctic/Neotropical and the sub-tropical/temperate Ixodes pararicinus (cattle (Neotropical in Rio Grande do Sul are important for considerations on their current biogeographical distribution and its dynamics in South America. The state has relatively long established, introduced ("exotic", Old World tick species (B. microplus, R. sanguineus that continue to represent significant pests and disease vectors to their traditional, introduced domestic animal hosts, cattle and urban dogs. There are also indigenous, New World ticks (A. miniatus, O. brasiliensis, A. aureolatum, A. nitens, as both long established and possibly newly locally

  19. Tick fauna from two locations in the Brazilian savannah.

    Science.gov (United States)

    Szabó, Matias Pablo Juan; Olegário, Maria Marlene Martins; Santos, André Luiz Quagliatto

    2007-01-01

    The Cerrado is Brazil's tropical savannah, which is arguably under greater threat than the Amazon rainforest. The Cerrado Biome of tropical South America covers about 2 million km(2) and is considered a biodiversity hot spot which means that it is especially rich in endemic species and particularly threatened by human activities. The Cerrado is increasingly exposed to agricultural activities which enhance the likelihood of mixing parasites from rural, urban and wildlife areas. Information about ticks from the Cerrado biome is scarce. In this report tick species free-living, on domestic animals and on a few wild animals in two farms in the Cerrado biome (Nova Crixás and Araguapaz municipalities, Goiás State, Brazil) are described. Amblyomma cajennense was the first and Amblyomma parvum the second host-seeking tick species found. Only two other tick species were found free-living: one Amblyomma nodosum and three Amblyomma naponense nymphs. Cattle were infested with Boophilus microplus and A. cajennense. Buffalos were infested with B. microplus and A. parvum. Dogs were infested with A. cajennense, Amblyomma ovale, A. parvum and Rhipicephalus sanguineus ticks. Anocentor nitens, B. microplus, A. cajennense, and A. parvum were found on horses. Amblyomma auricularium were found attached to nine-banded armadillos and Amblyomma rotundatum to red-footed tortoise, cururu toads and a rattlesnake. The latter was also infested with an adult A. cajennense. No tick was found on a goat, a tropical rat snake and a yellow armadillo. Among the observations the infestation of several domestic animals with A. parvum seems be the main feature. It suggests that this species might become a pest. However, the life cycle of A. parvum in nature, as well as its disease vectoring capacity, are largely unknown. It would be important to determine if it is a species expanding its geographic range by adaptation to new hosts or if it has been maintained in high numbers at definite locations by

  20. Repellent effects of Melaleuca alternifolia (tea tree) oil against cattle tick larvae (Rhipicephalus australis) when formulated as emulsions and in β-cyclodextrin inclusion complexes.

    Science.gov (United States)

    Yim, Wei Tsun; Bhandari, Bhesh; Jackson, Louise; James, Peter

    2016-07-30

    Rhipicephalus australis (formerly Boophilus microplus) is a one host tick responsible for major economic loss in tropical and subtropical cattle production enterprises. Control is largely dependent on the application of acaricides but resistance has developed to most currently registered chemical groups. Repellent compounds that prevent initial attachment of tick larvae offer a potential alternative to control with chemical toxicants. The repellent effects of Melaleuca alternifolia oil (TTO) emulsions and two β-cyclodextrin complex formulations, a slow release form (SR) and a modified faster release form (FR), were examined in a series of laboratory studies. Emulsions containing 4% and 5% TTO applied to cattle hair in laboratory studies completely repelled ascending tick larvae for 24h whereas 2% and 3% formulations provided 80% protection. At 48h, 5% TTO provided 78% repellency but lower concentrations repelled less than 60% of larvae. In a study conducted over 15 days, 3% TTO emulsion applied to cattle hair provided close to 100% repellency for 2 days, but then protection fell to 23% by day 15. The FR formulation gave significantly greater repellency than the emulsion and the SR formulation from day 3 until the end of the study (Prepellency at day 3 (99.5%), then decreasing over the period of the study to 49% repellency at day 15. Proof of concept is established for the use of appropriately designed controlled-release formulations to extend the period of repellency provided by TTO against R. australis larvae. PMID:27369582

  1. HA03 as an Iranian Candidate Concealed Antigen for Vaccination against Hyalomma anatolicum anatolicum: Comparative Structural and In silico Studies

    Directory of Open Access Journals (Sweden)

    Mohammadi, A.

    2013-12-01

    Full Text Available In the last decades researchers had focused on developing a vaccine against tick based on protective antigen. Recombinant vaccines based on concealed antigen from Boophilus microplus have been developed in Australia and Cuba by the name of TICKGARD and GAVAC (De La Fuente and Kocan, 2006. Further studies on this antigen have shown some extent of protection against other species (De Vos et al., 2001. In Iran most important species is Hyalomma anatolicum and limited information about its control are available. This paper reports structural and polymorphic analysis of HA03 as an Iranian candidate concealed antigen of H. a. anatolicum deposited in Gen-Bank .(Aghaeipour et al. GQ228820. The comparison between this antigen and other mid gut concealed antigen that their characteristics are available in GenBank showed there are high rate of similarity between them. The HA03 amino acid sequence had a homology of around 89%, 64%, 56% with HA98, BM86, BM95 respectively. Potential of MHC class I and II binding region indicated a considerable variation between BM86 antigen and its efficiency against Iranian H. a. anatolicum. In addition, predicted major of hydrophobisity and similarity in N-glycosylation besides large amount of cystein and seven EGF like regions presented in protein structure revealed that value of HA03 as a new protective antigen and the necessity of the development, BM86 homolog of H. a. anatolicum HA03 based recombinant vaccine.

  2. Evaluation of an indirect ELISA for the diagnosis of Babesia bovis in Uruguay

    International Nuclear Information System (INIS)

    In initially establishing the FAO/IAEA indirect ELISA for the detection of antibodies to Babesia bovis, the optical density (OD) values of sera from known positive or negative local cattle were compared to the OD values obtained from the negative and positive reference sera provided with the ELISA kit. The percentage of false positive and negative sera were 2.53% and 2.97% respectively. The cut-off values for the negative reference serum in the kit were compared with those of a local negative population. These values were found to be similar. The specificity of the test was evaluated by testing 30 sera from animals experimentally infected with Anaplasma marginale and 30 sera from animals infected with Babesia bigemina. These were no cross-reaction either between A. marginale and B. bovis or between B. bigemina and B. bovis. A serological survey using this ELISA kit was carried out on animals from an enzootic area and an area free from the vecot Boophilus microplus. 53 out of 282 animals (18.8%) in the enzootic area were positive whilst all the animals (113) from the free area were negative. This study would indicate that the FAO/IAEA ELISA kit has a sensitivity of around 98% and specificity of 97%. (author). 8 refs, 2 figs, 2 tabs

  3. Evaluation of an ELISA kit in the serological diagnosis of Babesia bovis for epidemiological studies

    International Nuclear Information System (INIS)

    An enzyme linked immunosorbent assay (ELISA) kit for detect antibodies to Babesia bovis, an intraerytrocitic bovine parasite was evaluated using known negative and positive samples and the results were compared with an indirect immunofluorescent antibody test (IFAT). Results obtained with field samples were used to estimate seroprevalence of B. bovis in an endemic area to the cattle tick (Boophilus microplus) vector of bovine babesiosis. Percentage of positivity (PP) values (optical density of tested serum/mean optical density of positive control) on 274 negative samples, had major values ranged in the frequency of 4.0 to 7.0 PP. Comparison between ELISA and IFAT showed an agreement of 93.3% on field sera samples, collected in areas of low, good and high soil fertility in the region of Bage (31 degree 20 min 13 sec S, 54 degree 06 min 21 sec W), RS, Brazil. From 5,082 tested sera, 3,751 (73%) were positive for B. bovis antibodies. No significant difference (P>0.05) was observed between results from calves living in areas of low and good soil fertility (80 and 82% of seroprevalence, respectively). However, calves living in soil of high fertility showed a minor inoculation rate for B. bovis (63% of seroprevalence), indicating needs of measures to prevent losses due to babesiosis. (author)

  4. Seasonal Variation and Frequency Distribution of Ectoparasites in Crossbreed Cattle in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Maria do Socorro Ferraz da Costa

    2014-01-01

    Full Text Available The aims of this study were to evaluate the seasonal variation and frequency distribution of Rhipicephalus (Boophilus microplus, Haematobia irritans, and Dermatobia hominis on crossbred heifers under field conditions in the northeast of Minas Gerais state, southeastern Brazil. From November 2007 to September 2009 (23 months, 40 heifers aged 16.6±2.4 months were divided into groups A (1/4 Holstein × 3/4 Gir and B (1/2 Holstein × 1/2 Gir and had the monthly infestation estimated along with the climatic conditions. The mean maximum and minimum temperatures were 28.5 and 19°C, respectively. The ectoparasites were present on animals in all months of the year. The levels of ticks on the animals were low (3.0±0.2 ticks/animal, with the highest density in midwinter. The temperature was the climatic factor that most influenced the tick levels. The population of H. irritans (13.9±0.3 flies/animal and D. hominis (1.5±0.2 larvae/animal on heifers was more influenced by rainfall and exhibited two population peaks during the year. 1/2 Holstein heifers harbored significantly more H. irritans and D. hominis than 1/4 Holstein heifers. The results are discussed considering the most appropriate periods to apply ectoparasiticides and the genetic make-up of the animals.

  5. Reassessment of the potential economic impact of cattle parasites in Brazil.

    Science.gov (United States)

    Grisi, Laerte; Leite, Romário Cerqueira; Martins, João Ricardo de Souza; Barros, Antonio Thadeu Medeiros de; Andreotti, Renato; Cançado, Paulo Henrique Duarte; León, Adalberto Angel Pérez de; Pereira, Jairo Barros; Villela, Humberto Silva

    2014-01-01

    The profitability of livestock activities can be diminished significantly by the effects of parasites. Economic losses caused by cattle parasites in Brazil were estimated on an annual basis, considering the total number of animals at risk and the potential detrimental effects of parasitism on cattle productivity. Estimates in U.S. dollars (USD) were based on reported yield losses among untreated animals and reflected some of the effects of parasitic diseases. Relevant parasites that affect cattle productivity in Brazil, and their economic impact in USD billions include: gastrointestinal nematodes - $7.11; cattle tick (Rhipicephalus (Boophilus) microplus) - $3.24; horn fly (Haematobia irritans) - $2.56; cattle grub (Dermatobia hominis) - $0.38; New World screwworm fly (Cochliomyia hominivorax) - $0.34; and stable fly (Stomoxys calcitrans) - $0.34. The combined annual economic loss due to internal and external parasites of cattle in Brazil considered here was estimated to be at least USD 13.96 billion. These findings are discussed in the context of methodologies and research that are required in order to improve the accuracy of these economic impact assessments. This information needs to be taken into consideration when developing sustainable policies for mitigating the impact of parasitism on the profitability of Brazilian cattle producers. PMID:25054492

  6. Immunization of cattle with Ra86 impedes Rhipicephalus appendiculatus nymphal-to-adult molting.

    Science.gov (United States)

    Olds, Cassandra; Mwaura, Stephen; Crowder, David; Odongo, David; van Oers, Monique; Owen, Jeb; Bishop, Richard; Daubenberger, Claudia

    2012-06-01

    Commercial vaccines based on the tick gut protein Bm86 have been successful in controlling the one-host tick Rhipicephalus (Boophilus) microplus and provide heterologous protection against certain other non-target ixodid tick species. This cross protection, however, does not extend to the three-host tick R. appendiculatus, the vector of the protozoan parasite Theileria parva. When transmitted to cattle, T. parva causes the often fatal disease East Coast fever. Here, we used insect cell-expressed recombinant versions of the R. appendiculatus homologs of Bm86, named Ra86, to vaccinate cattle. We measured multiple fitness characteristics for ticks that were fed on cattle Ra86-vaccinated or unvaccinated. The Ra86 vaccination of cattle significantly decreased the molting success of nymphal ticks to the adult stage. Modeling simulations based on our empirical data suggest that repeated vaccinations using Ra86 could reduce tick populations over successive generations. Vaccination with Ra86 could thus form a component of integrated control strategies for R. appendiculatus leading to a reduction in use of environmentally damaging acaricides. PMID:22658857

  7. Anaplasma marginale major surface protein 1a directs cell surface display of tick BM95 immunogenic peptides on Escherichia coli.

    Science.gov (United States)

    Canales, Mario; Almazán, Consuelo; Pérez de la Lastra, José M; de la Fuente, José

    2008-07-31

    The surface display of heterologous proteins on live Escherichia coli using anchoring motifs from outer membranes proteins has impacted on many areas of biochemistry, molecular biology and biotechnology. The Anaplasma marginale major surface protein 1a (MSP1a) contains N-terminal surface-exposed repeated peptides (28-289 amino acids) that are involved in pathogen interaction with host cell receptors and is surface-displayed when the recombinant protein is expressed in E. coli. Therefore, it was predicted that MSP1a would surface display on E. coli peptides inserted in the N-terminal repeats region of the protein. The Rhipicephalus (Boophilus) microplus BM86 and BM95 glycoproteins are homologous proteins that protect cattle against tick infestations. In this study, we demonstrated that a recombinant protein comprising tick BM95 immunogenic peptides fused to the A. marginale MSP1a N-terminal region is displayed on the E. coli surface and is recognized by anti-BM86 and anti-MSP1a antibodies. This system provides a novel approach to the surface display of heterologous antigenic proteins on live E. coli and suggests the possibility to use the recombinant bacteria for immunization studies against cattle tick infestations. PMID:18582976

  8. The cattle tick antigen, Bm95, expressed in Pichia pastoris contains short chains of N- and O-glycans.

    Science.gov (United States)

    González, Luis J; Cremata, José A; Guanche, Yazmín; Ramos, Yassel; Triguero, Ada; Cabrera, Gleysin; Montesino, Raquel; Huerta, Vivian; Pons, Tirso; Boué, Oscar; Farnós, Omar; Rodríguez, Manuel

    2004-12-15

    Bm95 is an antigen isolated from Boophilus microplus strains with low susceptibility to antibodies developed in cattle vaccinated with the recombinant Bm86 antigen (Gavac, HeberBiotec S.A., Cuba). It is a Bm86-like surface protein, which by similarity contains seven EGF-like domains and a lipid-binding GPI-anchor site at the C-terminal region. The primary structure of the recombinant (rBm95) protein expressed in Pichia pastoris was completely verified by LC/MS. The four potential glycosylation sites (Asn 122, 163, 329, and 363) are glycosylated partially with short N-glycans, from Man(5)GlcNAc(2) to Man(9)GlcNAc(2) of which, Man(8-9)GlcNAc(2) were the most abundant. O-Glycopeptides are distributed mostly towards the protein N-terminus. While the first N-glycosylated site (Asn(122)) is located between EGF-like domains 2 and 3, where the O-glycopeptides were found, two other N-glycosylated sites (Asn(329) and Asn(363)) are located between EGF-like domains 5 and 6, a region devoid of O-glycosylated Ser or Thr. PMID:15542059

  9. Experimental vaccination of sheep and cattle against tick infestation using recombinant 5'-nucleotidase.

    Science.gov (United States)

    Hope, M; Jiang, X; Gough, J; Cadogan, L; Josh, P; Jonsson, N; Willadsen, P

    2010-02-01

    Limited prior evidence suggests that 5'-nucleotidase, an ectoenzyme principally located in the Malpighian tubules of the tick Rhipicephalus (Boophilus) microplus, could be an effective antigen in an anti-tick vaccine. To assess this, recombinant 5'-nucleotidase was expressed in Escherichia coli and used in vaccination trials with both sheep and cattle. Vaccinated sheep were challenged with freshly moulted adult ticks. Those with high titres of anti-nucleotidase antibodies showed significant protection against tick infestation, although protection was less than that found with the previously characterized antigen, Bm86. Cattle were vaccinated, in separate groups, with 5'-nucleotidase, Bm86 and both antigens combined. Cattle, as the natural host, were challenged with larval ticks. Although Bm86 showed typical efficacy, no significant protection was seen in cattle vaccinated with 5'-nucleotidase. Cattle receiving a dual antigen formulation were no better protected than those receiving Bm86 alone. One possible reason for the difference between host species, namely antibody titre, was examined and shown to be an unlikely explanation. This demonstrates a limitation of using a model host like sheep in vaccine studies. PMID:20070827

  10. Exposed and concealed antigens as vaccine targets for controlling ticks and tick-borne diseases.

    Science.gov (United States)

    Nuttall, P A; Trimnell, A R; Kazimirova, M; Labuda, M

    2006-04-01

    Tick vaccines derived from Bm86, a midgut membrane-bound protein of the cattle tick, Boophilus microplus, are currently the only commercially available ectoparasite vaccines. Despite its introduction to the market in 1994, and the recognized need for alternatives to chemical pesticides, progress in developing effective antitick vaccines (and ectoparasite vaccines in general) is slow. The primary rate-limiting step is the identification of suitable antigenic targets for vaccine development. Two sources of candidate vaccine antigens have been identified: 'exposed' antigens that are secreted in tick saliva during attachment and feeding on a host and 'concealed' antigens that are normally hidden from the host. Recently, a third group of antigens has been distinguished that combines the properties of both exposed and concealed antigens. This latter group offers the prospect of a broad-spectrum vaccine effective against both adults and immature stages of a wide variety of tick species. It also shows transmission-blocking and protective activity against a tick-borne pathogen. With the proliferation of molecular techniques and their application to vaccine development, there are high hopes for new and effective antitick vaccines that also control tick-borne diseases. PMID:16542317

  11. A ten-year review of commercial vaccine performance for control of tick infestations on cattle.

    Science.gov (United States)

    de la Fuente, José; Almazán, Consuelo; Canales, Mario; Pérez de la Lastra, José Manuel; Kocan, Katherine M; Willadsen, Peter

    2007-06-01

    Ticks are important ectoparasites of domestic and wild animals, and tick infestations economically impact cattle production worldwide. Control of cattle tick infestations has been primarily by application of acaricides which has resulted in selection of resistant ticks and environmental pollution. Herein we discuss data from tick vaccine application in Australia, Cuba, Mexico and other Latin American countries. Commercial tick vaccines for cattle based on the Boophilus microplus Bm86 gut antigen have proven to be a feasible tick control method that offers a cost-effective, environmentally friendly alternative to the use of acaricides. Commercial tick vaccines reduced tick infestations on cattle and the intensity of acaricide usage, as well as increasing animal production and reducing transmission of some tick-borne pathogens. Although commercialization of tick vaccines has been difficult owing to previous constraints of antigen discovery, the expense of testing vaccines in cattle, and company restructuring, the success of these vaccines over the past decade has clearly demonstrated their potential as an improved method of tick control for cattle. Development of improved vaccines in the future will be greatly enhanced by new and efficient molecular technologies for antigen discovery and the urgent need for a tick control method to reduce or replace the use of acaricides, especially in regions where extensive tick resistance has occurred. PMID:17692140

  12. Immunisation with recombinant proteins subolesin and Bm86 for the control of Dermanyssus gallinae in poultry.

    Science.gov (United States)

    Harrington, David; Canales, Mario; de la Fuente, José; de Luna, Carlos; Robinson, Karen; Guy, Jonathan; Sparagano, Olivier

    2009-06-19

    Dermanyssus gallinae has a worldwide distribution and is considered to be the most serious and economically significant ectoparasite affecting egg-laying poultry in Europe. Recombinant Bm86 and subolesin proteins derived from Boophilus microplus ticks and Aedes albopictus mosquitoes were used to immunise poultry in an attempt to control D. gallinaein vitro. Immunisation with subolesin and Bm86 stimulated different profiles of IgY response, whilst Bm86 but not subolesin was recognized by IgY on western blots. Orthologues for Bm86 were not found in D. gallinae by PCR, but a 150 bp fragment aligned with mammalian akirin 1 and a 300 bp fragment aligned with Amblyomma hebraeum were amplified by subolesin PCR. D. gallinae mortality after feeding was 35.1% higher (P=0.009) in the Subolesin group and 23% higher (not significant) in the Bm86 compared to the Control group. Thus it can be concluded that immunisation with recombinant subolesin can stimulate a protective response in laying hens against D. gallinae. PMID:19501789

  13. Adjuvant and immunostimulating properties of the recombinant Bm86 protein expressed in Pichia pastoris.

    Science.gov (United States)

    García-García, J C; Soto, A; Nigro, F; Mazza, M; Joglar, M; Hechevarría, M; Lamberti, J; de la Fuente, J

    1998-01-01

    The cattle tick Boophilus microplus has remained a latent problem to the cattle industry. The recombinant vaccine GAVAC against the cattle tick has proved its efficacy and, conveniently, combined with the use of chemicals could be the solution to this problem. As this vaccine is based in the recombinant concealed antigen Bm86, it has to be given periodically to the animal to maintain an adequate level of antibodies. Some other commercially available vaccines for cattle also have to be given periodically, which creates the possibility of combining vaccines for cattle. In an attempt to evaluate the possible interactions of the Bm86 with other vaccine antigens, a potent stimulatory effect was demonstrated of the recombinant Bm86 on the humoral immune response to the recombinant Hepatitis B surface antigen in mice, and to the inactivated Infectious Bovine Rhinothraqueitis virus in cattle. These results make the Bm86 antigen expressed in Pichia pastoris a good candidate for combining vaccines for cattle because of its dual role, immunogen and adjuvant. PMID:9682358

  14. The quest for a universal vaccine against ticks: cross-immunity insights.

    Science.gov (United States)

    Parizi, Luís F; Githaka, Naftaly W; Logullo, Carlos; Konnai, Satoru; Masuda, Aoi; Ohashi, Kazuhiko; da Silva Vaz, Itabajara

    2012-11-01

    As blood-sucking parasites, ticks inflict great damage to animals and humans in many parts of the world. The continued use of chemical acaricides is not sustainable due to increasing tick resistance, growing public concern over drug residues in food and in the environment, and the high cost of developing new acaricides. Therefore, an alternative control strategy is urgently needed. Vaccines against ticks have been shown to be functionally feasible, as highlighted by the success of Bm86 vaccines against Rhipicephalus (Boophilus) microplus and closely related tick species. However, a limited number of tick antigens with cross-protective epitopes have been characterized so far, limiting widespread deployment of the available vaccines, including those derived from Bm86. Therefore, identifying tick antigens with potential broad-spectrum protection against multiple tick species is subject of vigorous research at present. In this paper, progress towards effective anti-tick vaccines is reviewed in the light of emerging data from studies including heterologous tick challenge. Taken together, these studies indicate that the decades-long search for a universal tick vaccine is making progress, with such a vaccine likely to be based on multiple cross-reactive antigens. PMID:22766309

  15. Tick and tick borne protozoan diseases of livestock in the selected hilly areas of Bangladesh

    Directory of Open Access Journals (Sweden)

    U.K. Mohanta

    2011-12-01

    Full Text Available To study the tick and tick borne protozoan diseases of livestock in the hilly areas of Bangladesh, an attempt was made to collect tick and blood samples from cattle, goat and gayal (Bos frontalis from different areas of the three hill districts. In this study, two species of ticks namely, Boophilus microplus (92% and Amblyomma testudinarium (21.6% and two species of blood protozoa like Babesia bigemina (16.63% and Anaplasma marginale (14.94% were recorded. Seasonal prevalence of ticks was highest in summer (97% in comparison to rainy (95% and winter (86% season. On the other hand, the seasonal prevalence of blood protozoa was highest in rainy season (45.45% in comparison to summer (27.87% and winter (16.55%. Again, animals aged more than 2 (two years of age (52% found to be more susceptible to blood protozoan diseases than animals aged between 1-2 years of age (33.97%. But none of the animals under one year of age were found to be infected with blood protozoan diseases.

  16. Development of an enzyme-linked immunosorbent assay for detection of IgM antibodies to Babesia bigemina in cattle

    Directory of Open Access Journals (Sweden)

    Ruiz Patrícia M Gonçalves

    2001-01-01

    Full Text Available A crude antigenic preparation of Babesia bigemina was used to develop an ELISA for the detection of IgM antibodies. Optimal dilutions of the antigen, using positive and negative reference sera, were determined by checkerboard titrations. Negative sera from cattle imported from tick-free areas, serum samples collected from infected B. bigemina cattle were used to validate the test. The specificity was 94% and sensitivity of the Elisa 87.5%. Sera from 385 cattle deriving from areas free from tick-borne diseases, which were submitted to a preimmunization process, were screened by this technique. The Elisa detected seroconversion on the 14th day post-inoculation in animals either infested with Boophilus microplus ticks (infected with B. bigemina, or inoculated with B. bigemina infected blood. Antibody titers decreased after day 33; however, all animals remained positive until the end of the experiment (124 days. The ELISA described may prove to be an appropriate serological test for the detection of IgM antibodies against B. bigemina.

  17. Ticks (Acari: Ixodoidea: Argasidae, Ixodidae) of Chile.

    Science.gov (United States)

    González-Acuña, Daniel; Guglielmone, Alberto A

    2005-01-01

    The tick species recorded from Chile can be listed under the following headings: (1) endemic or established: Argas keiransi Estrada-Peña, Venzal and Gonzalez-Acuña, A. neghmei Kohls and Hoogstraal; Ornithodoros amblus Chamberlin; Otobius megnini (Dugès); Amblyomma parvitarsum Neumann; A. tigrinum Koch; Ixodes auritulus Neumann; I. chilensis Kohls; I. cornuae Arthur, I. sigelos Keirans, Clifford and Corwin; I. stilesi Neumann; I. uriae White; Rhipicephalus sanguineus Koch. (2) Probably established or endemic: Argas miniatus Koch; Ornithodoros spheniscus Hoogstraal, Wassef, Hays and Keirans; Ixodes abrocomae Lahille; I. neuquenensis Ringuelet; I. pararicinus Keirans and Clifford. (3) Doubtfully established: Argas reflexus Fabricius; Ornithodoros talaje (Guérin-Méneville). (4) Exotic: Amblyomma argentinae Neumann; A. latum Koch, Rhipicephalus (= Boophilus) microplus (Canestrini). (5) Erroneously identified as present in Chile: Amblyomma americanum (Linnaeus); A. maculatum Koch; A. varium Koch; Ixodes conepati Cooley and Kohls; I. frontalis (Panzer); I. ricinus (Linnaeus); Margaropus winthemi Karsch. (6) Nomina nuda: Argas reticulatus Gervais; Amblyomma inflatum Neumann; Ixodes lagotis Gervais. Hosts and localities (including new records) are presented. Argas neghmei, O. amblus, O. megnini, I. uriae and R. sanguineus may cause severe injury to their hosts, including humans. The Chilean Ixodes fauna is unique to the Neotropical Zoogeographic Region, and additional research is needed in order to understand the biological importance of these species. PMID:15777007

  18. The Panacea Plants for Environment and Humanity: Caper and Ritha

    Directory of Open Access Journals (Sweden)

    Fadim YEMİŞ

    2015-06-01

    Full Text Available Caper and Ritha are plants which have very important effects on both living beings and natural habitat. They are used in many areas like medicine, pharmacy, cosmetics and agriculture because of their positive features. Caper is compatible with the Mediterranean ecosystem and resistant to drought and high-salinity. When compared to the other most plants, it can remain green for a long time without water even in the summer season. Due to this magnificent property, this plant is effectively used for environmental protection. It has been reported that Caper contains biologically active compounds such as glucosinolates, alkoloids, phenolics, flavonoid, tocopherol and minerals such as sodium, potassium, phosphorus, calcium, magnesium, zinc and iron. Ritha grows in Asia’s tropical and sub-tropical regions. It contributes to the environment like Caper because, it has ability to capture the chemical pollution from the soil. So, it helps to improve the quality and efficiency of the land by holding heavy metals like mercury, iron and zinc in the leaves and grabbing lead and cadmium in its fruits. Moreover, it biologically decomposes injurious organic molecules such as hexachlorobenzene and naphthalene. Furthermore, the nectar of Ritha can kill the flies and larvae of Southern cattle mite’s species called Boophilus microplus.

  19. Haplotypes that include the integrin alpha 11 gene are associated with tick burden in cattle

    Directory of Open Access Journals (Sweden)

    Bunch Rowan J

    2010-06-01

    Full Text Available Abstract Background Infestations on cattle by the ectoparasite Boophilus (Rhipicephalus microplus (cattle tick impact negatively on animal production systems. Host resistance to tick infestation has a low to moderate heritability in the range 0.13 - 0.64 in Australia. Previous studies identified a QTL on bovine chromosome 10 (BTA10 linked to tick burden in cattle. Results To confirm these associations, we collected genotypes of 17 SNP from BTA10, including three obtained by sequencing part of the ITGA11 (Integrin alpha 11 gene. Initially, we genotyped 1,055 dairy cattle for the 17 SNP, and then genotyped 557 Brahman and 216 Tropical Composite beef cattle for 11 of the 17 SNP. In total, 7 of the SNP were significantly (P P P Conclusions These analyses confirm the location of a QTL affecting tick burden on BTA10 and position it close to the ITGA11 gene. The presence of a significant association in such widely divergent animals suggests that further SNP discovery in this region to detect causal mutations would be warranted.

  20. Tick resistance and heat tolerance characteristics in cattle. II. Rectal temperature and respiratory frequency

    Directory of Open Access Journals (Sweden)

    Cecília José Veríssimo

    2012-12-01

    Full Text Available The heat and Rhipicephalus microplus tick infestation are limiting factors to the livestock production in the tropics. Therefore, in a tropical sustainable livestock, cattle should be tick resistant and heat tolerant. The relationship between the Rhipicephalus (Boophilus microplus tick infestation and heat characteristics like rectal temperature and respiratory frequency was studied in 6 Nellore and 4 Holstein, seven-month-old steers. They were submitted to an artificial infestation (a.i. with 10,000 larvae (Holstein and 20,000 larvae (Nellore of Rhipicephalus (Boophilus microplus tick in 16/Apr/2011. Females ticks bigger than 4.0 mm were counted in the left side from day 19 to 27 after the artificial infestation. The infestation rate was calculated by summing and multiplying by two the number of ticks counted, assuming that females are half of infesting larvae (5,000 for Holstein and 10,000 for Nellore. In days 20, 23 and 24 after the infestation, the 10 bigger females ticks found in whole animal were weighed and put in a chamber (27 oC and 80% RH, weighing the egg mass of each female fourteen days after. The rectal temperature (RT, measured by a digital thermometer in the animal’s rectum and respiratory frequency (RF, respiratory movements per minute were measured on days 14/Apr (2 days before the a.i. and on day 05/May (19 days after the a.i.. The RT and RF were measured in the morning and in the afternoon, after they had been exposed to noon sun. The experimental design was a non-probability sample restricted to the 10 available animals. Analyses of variance for the random variables RT and RF to evaluate the effects of period of day, date and breed were performed using the SPSS 12.0. The RF was greater in the afternoon (64.82 ± 2.44 mov/min versus 38.42 ± 2.44 mov/min in the morning, P<0.001 and did not varied between dates; Nellore cattle had lower RF (41.50 ± 2.20 mov/min than Holstein (61.75 ± 2.70 mov/min, P<0.001. About RT, breed

  1. A systematic, functional genomics, and reverse vaccinology approach to the identification of vaccine candidates in the cattle tick, Rhipicephalus microplus.

    Science.gov (United States)

    Maritz-Olivier, Christine; van Zyl, Willem; Stutzer, Christian

    2012-06-01

    In the post-genomic era, reverse vaccinology is proving promising in the development of vaccines against bacterial and viral diseases, with limited application in ectoparasite vaccine design. In this study, we present a systematic approach using a combination of functional genomics (DNA microarrays) techniques and a pipeline incorporating in silico prediction of subcellular localization and protective antigenicity using VaxiJen for the identification of novel anti-tick vaccine candidates. A total of 791 candidates were identified using this approach, of which 176 are membrane-associated and 86 secreted soluble proteins. A preliminary analysis on the antigenicity of selected membrane proteins using anti-gut antisera yielded candidates with an IgG binding capacity greater than previously identified epitopes of Bm86. Subsequent vaccination trials using recombinant proteins will not only validate this approach, but will also improve subsequent reverse vaccinology approaches for the identification of novel anti-tick vaccine candidates. PMID:22521592

  2. Evaluación económica del control de garrapatas Rhipicephalus microplus en México

    OpenAIRE

    Domínguez García, D. I; Torres Agatón, F.; R Rosario-Cruz

    2016-01-01

    Se evaluó un programa de control integral en 15 ranchos con el fin de cuantificar los costos de producción asociados con el control químico de garrapatas. Bajo un programa combinado de control químico e inmunológico se inmunizaron 587 animales de 15 ranchos. El costo del control químico de las garrapatas en la región fue de $408.3 pesos mexicanos por animal, mientras que el programa combinado fue de $128 pesos por animal, lo que significó una reducción de 68.63 % por concepto de la comp...

  3. Evaluación económica del control de garrapatas Rhipicephalus microplus en México

    Directory of Open Access Journals (Sweden)

    Domínguez García, D. I

    2016-03-01

    Full Text Available Se evaluó un programa de control integral en 15 ranchos con el fin de cuantificar los costos de producción asociados con el control químico de garrapatas. Bajo un programa combinado de control químico e inmunológico se inmunizaron 587 animales de 15 ranchos. El costo del control químico de las garrapatas en la región fue de $408.3 pesos mexicanos por animal, mientras que el programa combinado fue de $128 pesos por animal, lo que significó una reducción de 68.63 % por concepto de la compra de ixodicidas. La extrapolación de estos datos a la ganadería nacional con un hato estimado en 30 millones de cabezas de ganado bovino, puede significar una pérdida que equivale a 12248.7 millones de pesos mexicanos. El uso de un programa combinado de control disminuiría estas pérdidas hasta 3843.7 millones, es decir, 68.63 % de las pérdidas en la ganadería nacional

  4. Assessment of Acute Oral and Dermal Toxicity of 2 Ethyl-Carbamates with Activity against Rhipicephalus microplus in Rats

    Directory of Open Access Journals (Sweden)

    María Guadalupe Prado-Ochoa

    2014-01-01

    Full Text Available The acute oral and dermal toxicity of two new ethyl-carbamates (ethyl-4-bromophenyl-carbamate and ethyl-4-chlorophenyl-carbamate with ixodicide activity was determined in rats. The oral LD50 of each carbamate was 300 to 2000 mg/kg, and the dermal LD50 of each carbamate was >5000 mg/kg. Clinically, the surviving rats that had received oral doses of each carbamate showed decreased weight gain (P<0.05 and had slight nervous system manifestations. These clinical signs were evident from the 300 mg/kg dose and were reversible, whereas the 2000 mg/kg dose caused severe damage and either caused their death or was motive for euthanasia. At necropsy, these rats had dilated stomachs and cecums with diffuse congestion, as well as moderate congestion of the liver. Histologically, the liver showed slight degenerative lesions, binucleated hepatocytes, focal coagulative necrosis, and congestion areas; the severity of the lesions increased with dosage. Furthermore, an slight increase in gamma-glutamyltransferase, lactate dehydrogenase, and creatinine was observed in the plasma. The dermal application of the maximum dose (5000 mg/kg of each carbamate did not cause clinical manifestations or liver and skin alterations. This finding demonstrates that the carbamates under study have a low oral hazard and low acute dermal toxicity.

  5. Ticks (Acari: Ixodida) on wild carnivores in Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; Jorge, Rodrigo S P; Sana, Dênis A; Jácomo, Anah Tereza A; Kashivakura, Cyntia K; Furtado, Mariana M; Ferro, Claudia; Perez, Samuel A; Silveira, Leandro; Santos, Tarcísio S; Marques, Samuel R; Morato, Ronaldo G; Nava, Alessandra; Adania, Cristina H; Teixeira, Rodrigo H F; Gomes, Albério A B; Conforti, Valéria A; Azevedo, Fernando C C; Prada, Cristiana S; Silva, Jean C R; Batista, Adriana F; Marvulo, Maria Fernanda V; Morato, Rose L G; Alho, Cleber J R; Pinter, Adriano; Ferreira, Patrícia M; Ferreira, Fernado; Barros-Battesti, Darci M

    2005-01-01

    species), Dermacentor (1 species), Rhipicephalus (1 species), and Boophilus (1 species). Additional 5 tick species (3 Amblyomma species and 1 species from each of the genera Ixodes and Ornithodoros) were reported in the literature. The most common ticks on Carnivora hosts were Amblyomma ovale (found on 14 host species), Amblyomma cajennense (10 species), Amblyomma aureolatum (10 species), Amblyomma tigrinum (7 species), Amblyomma parvum (7 species), and Boophilus microplus (7 species). PMID:16082932

  6. Immunization and chemical conjugation of Bm95 obtained from Pichia pastoris enhances the immune response against vaccinal protein and Neisseria meningitidis capsular polysaccharide

    Directory of Open Access Journals (Sweden)

    Rodriguez-Valle M

    2014-03-01

    Full Text Available Manuel Rodriguez-Valle,1 Leonardo Canan-Hadden,2 Olivia Niebla2 1Animal Biotechnology Division, 2Analytical Division, Centre for Genetic Engineering and Biotechnology, Havana, Cuba Abstract: The ectoparasite Rhipicephalus (Boophilus microplus causes severe economic losses to the cattle industry in tropical and subtropical regions, and transmits endoparasites, such as Babesia bovis. The glycoprotein Bm95 is homologous to Bm86, a surface membrane protein of gut epithelial cells in R. microplus, and has been shown to efficiently control this ectoparasite in regions of the Americas. The immunostimulant properties of Bm86 have already been demonstrated after its coinjection with hepatitis B surface antigen (HBsAg and the infectious bovine rhinotracheitis virus. This study evaluated the carrier and immunostimulant properties of Bm95 using low immunogenic Neisseria meningitidis capsular C polysaccharide (Men CpS and HBsAg. We produced two polysaccharide-Bm95 conjugates by carbodiimide (MenCpSBm-c and reductive amination (MenCpSBm-ra methods. These conjugates were characterized and evaluated in mice. Antibody titers against Men CpS were significantly higher in mice immunized with MenCpSBm-ra (2,350±250, P<0.01 than in those immunized with MenCpSBm-c (250±75 or Men CpS (570±104. The study data indicate effective immunological memory after booster inoculation in mice immunized with MenCpSBm-ra. Additionally, significant humoral immunity against HBsAg was documented in mice coimmunized via the intranasal route with recombinant Bm95 (11,400±345 and HBsAg (128,000±250 compared with mice immunized only with HBsAg (400±40 or Bm95 (5,461±150, P<0.01. In conclusion, the immunostimulatory properties of recombinant Bm95 make it a useful element for developing safer conjugated vaccines against bacterial pathogens and for evaluation against ticks and tick-borne diseases in the context of a polyvalent veterinary vaccine. Keywords: glycoconjugate, Bm86

  7. Endectocide activity of a pour-on formulation containing 1.5 per cent ivermectin +0.5 per cent abamectin in cattle.

    Science.gov (United States)

    Silva, Heloisa Cristina; Prette, Nancy; Lopes, Welber Daniel Zanetti; Sakamoto, Cláudio Alessandro M; Buzzulini, Carolina; Dos Santos, Thais Rabelo; Cruz, Breno Cayeiro; Teixeira, Weslen F Pires; Felippelli, Gustavo; Carvalho, Rafael Silveira; Maciel, Willian Giquelin; Soares, Vando Edésio; da Costa, Alvimar José

    2015-01-01

    The present work aimed to evaluate, through ten different studies, the therapeutic efficacy of a new pour-on formulation, containing 1.5 per cent ivermectin +0.5 per cent abamectin, against parasites of cattle. Results obtained on trials against Rhipicephalus (Boophilus) microplus showed that the pour-on combination of 1.5 per cent ivermectin +0.5 per cent abamectin obtained superior efficacy indexes against this ectoparasite, when compared with formulations containing 0.5 per cent ivermectin, 1 per cent ivermectin and the combination of 1 per cent abamectin +20 per cent levamisole. The results of efficacy of the ivermectin+abamectin and the 0.5 per cent ivermectin against Haematobia irritans were similar. Against Cochliomyia hominivorax larvae, all pour-on formulations tested (1.5 per cent ivermectin +0.5 per cent abamectin, 0.5 per cent ivermectin and 0.5 per cent abamectin), as well as 1 per cent doramectin administered subcutaneously, were considered ineffective. Cattle medicated with 1.5 per cent ivermectin +0.5 per cent abamectin, pour-on, remained free from parasitism by Dermatobia hominis larvae during 42 days (96 per cent efficacy), while values superior to 90 per cent were obtained by 0.5 per cent ivermectin (92 per cent) and 0.5 per cent abamectin (93 per cent) until the 42nd and 35th days post treatment, respectively. Against Haemonchus placei and Oesophagostomum radiatum, the pour-on of ivermectin+abamectin showed better efficacy than the 0.5 per cent ivermectin and 0.5 per cent abamectin. As to Cooperia punctata, there was no difference regarding efficacy results obtained by the avermectins combination and abamectin. The pour-on combination of 1.5 per cent ivermectin +0.5 per cent abamectin obtained high efficacy against R. (B.) microplus, D. hominis and some species of cattle gastrointestinal helminths when compared with formulations of 0.5 per cent ivermectin and 0.5 per cent abamectin administered through the same route. PMID:26392893

  8. Efeito do óleo de eucalipto (Corymbia citriodora no controle do carrapato bovino Effect of eucalyptus oil (Corymbia citriodora on the control of cattle ticks

    Directory of Open Access Journals (Sweden)

    Clair Jorge Olivo

    2013-02-01

    Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar o efeito in vitro e in vivo do óleo de eucalipto (Corymbia citriodora sobre o carrapato bovino (Rhipicephalus (Boophilus microplus. Na experimentação in vitro, foi utilizado o grupo controle negativo e oito concentrações de óleo de eucalipto (0,5; 1; 2; 5; 10; 20; 50; 100%, em fêmeas ingurgitadas de carrapato. A eficácia de controle foi de 0; 30,5; 75,5; 91; 100; 100; 100; 100 e 100%, respectivamente. Para a experimentação in vivo, foram constituídos três grupos (controle negativo; óleo de eucalipto a 3,5% - nível estimado mediante análise de regressão, correspondendo a 95% de eficácia de controle do carrapato da pesquisa in vitro e amitraz a 0,025%, com dezoito vacas da raça Holandesa. Antes (média dos dias -3, -2,-1 e após a aplicação do produto (1, 2, 3, 5, 7, 10, 14, 21dias, foram contadas fêmeas ingurgitadas de carrapato. A eficácia de controle foi de 0; 96,4 e 69%, respectivamente, 21 dias após o tratamento. Na 1ª e na 2ª ordenha após a aplicação dos tratamentos, foram avaliadas variáveis fisiológicas e coletadas amostras de leite para avaliar as propriedades organolépticas no leite e no iogurte (controle negativo x tratamento fitoterápico. O teste de aceitação sensorial do leite e das variáveis fisiológicas avaliadas foram similares entre os tratamentos.This research was aimed at evaluating in vitro and in vivo effects of eucalyptus (Corymbia citriodora oil on cattle ticks (Rhipicephalus (Boophilus microplus. Negative control group and eight concentrations of eucalyptus oil (0.5; 1; 2; 5; 10; 20; 50; 100%, were used on in vitro trials with engorged female ticks. The efficacy of control ticks was 0; 30.5; 75.5; 91; 100; 100; 100; 100 and 100%, respectively. At the in vivo trial eighteen Holstein cows were allocated to three groups (negative control, eucalyptus oil at 3.5% - level estimated by regression analysis, accounting for 95% efficacy of

  9. Environmentally associated ticks (Acari: Ixodidae in Campo Grande, Mato Grosso do Sul, Brazil Carrapatos (Acari: Ixodidae associados com o ambiente em Campo Grande, Mato Grosso do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Marcos Valério Garcia

    2013-03-01

    Full Text Available Herein, we report tick species found on wild and domestic animals and in the environment during a one-year sampling period at the Brazilian Farming Research Company beef cattle unit (Embrapa Beef Cattle, which is located within the urban area of Campo Grande, Mato Grosso do Sul, Brazil. From 55 wild hosts including six different species (Nasua nasua, Cebus spp., Cerdocyon thous, Myrmecophaga tridactyla, Tamandua tetradactyla and Dasyprocta aguti, 323 ticks were collected. Amblyomma ovale ticks were found solely on coatis, and Amblyomma nodosum was identified solely on anteaters. No ticks were found on capuchin monkeys. However, Amblyomma cajennense was found on all parasitized host species with the exception of capuchin monkeys. Giant anteaters displayed the highest infestation abundance, with a mean of 53 ticks∕animal. Environmental sampling yielded 166 adult A. cajennense ticks. The tick species found on domestic animals (Rhipicephalus (Boophilus microplus, R. sanguineus, Dermacentor nitens and A. cajennense were those typically found on these hosts in Brazil. The most prevalent tick species, A. cajennense, was found on both wild and domestic animals and was also prevalent in the environment. Thus, this tick species is the primary vector that allows pathogens to bridge wild and domestic animals in the Cerrado.Neste trabalho são descritas as espécies de carrapatos de animais selvagens e domésticos e do ambiente coletados por um ano na EMBRAPA Gado de Corte localizado na área urbana de Campo Grande, Mato Grosso do Sul, Brasil. Dos 55 hospedeiros selvagens de seis espécies diferentes (Nasua nasua, Cebus spp., Cerdocyon thous, Myrmecophaga tridactyla, Tamandua tetradactyla e Dasyprocta aguti foram coletados 323 carrapatos. Amblyomma ovale foi encontrado apenas em quatis e Amblyomma nodosum apenas sobre tamanduás. Nenhum carrapato foi encontrado sobre macacos-prego. Por outro lado, Amblyomma cajennense foi encontrado em todos os hospedeiros

  10. Caracterização da população de ectoparasitos em cães de núcleos de expansão urbana de Juiz de Fora, Minas Gerais, Brasil Characterization of ectoparasites on dogs in the nucleus of urban expansion of Juiz de Fora, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Denise F. Rodrigues

    2008-12-01

    Full Text Available No presente trabalho caracterizou-se a população de ectoparasitos em cães de núcleo de expansão urbana de Juiz de Fora, MG. As coletas foram realizadas de julho a setembro de 2003, examinando-se 101 cães SRD (sem raça definida. Os ectoparasitos foram coletados através de inspeção visual e tátil dos animais e acondicionados em frascos com etanol 70°GL e identificados sob estereoscopia. Espécimes foram clarificados e montados para análise em microscopia fotônica. Dentre os sifonápteros, Ctenocephalides felis foi mais prevalente (64,35% com intensidade média de 6,12 ± 5,37 sifonápteros/cão, seguido por Rhopalopsyllus lutzi (3,96%, híbrida C. felis X C. canis (1,98%, Tunga penetrans (1,98%. Aúnica espécie de fitiráptero encontrada foi Trichodectes canis (7,92% com 1,3 ± 0,51 fitiráptero/cão. Dentre os ixodídeos, Rhipicephalus sanguineus foi a espécie mais prevalente (49,50% com intensidade média de 6,44 ± 10,2 ixodídeos/ cão, seguido por Amblyomma cajennense (3,96%, Boophilus microplus (2,97%, A. ovale (1% e A. aureolatum (1%. As ninfas de ixodídeos foram separadas em ninfas de Amblyomminae (58,41% com 10,11 ± 10,09 ninfas/cão e ninfas Rhipicephalinae (24,75% com 2,64 ± 3,25 ninfas/cão. Em 3,96 % dos cães foram encontradas larvas de ixodídeo.The present work studied the characterization of ectoparasites on dogs in the nucleus of expansão urbana of Juiz de Fora, Minas Gerais, Brazil. The collections were conducted from July to September 2003, examining 101 dogs of no defined breed. The ectoparasites were collected through visual and tactile inspection of the animals' bodies, and were then placed in bottles with 70° GL ethanol and identified under a stereomicroscope. Specimens were clarified and mounted on slides for analysis under a photonic microscope. Among the siphonaptera, Ctenocephalides felis was the most prevalent (64.35%, with mean intensity of 6.12 ± 5.37 siphonaptera/dog, followed by Rhopalopsyllus

  11. Perceptions and attitudes among milk producers in Minas Gerais regarding cattle tick biology and control Percepções e atitudes entre produtores de leite em Minas Gerais relacionado a biologia e controle de carrapatos em bovinos

    Directory of Open Access Journals (Sweden)

    Maria Alice Zacarias do Amaral

    2011-09-01

    Full Text Available This study evaluates milk producers' knowledge regarding cattle ticks and practices for controlling them. Ninety-three dairymen in Minas Gerais were interviewed. These producers had no information regarding acaricide efficiency tests. To analyze the information, open responses were categorized through "content analysis", and descriptive analysis consisting of extracting the profile highlighted by the highest frequencies. The association between schooling level and knowledge was tested by means of chi-square trend tests. It was observed that 92.3% had no knowledge of the non-parasitic period. For 96.4%, what determined the time to apply treatment was the degree of tick infestation; 93.3% used spray guns to apply the acaricide. In seeking to cross-correlate the biological and control variables with education, cooperative action, length of experience and herd size, it was found that there was a linear association between schooling level and implementation of acaricide solution preparation. The other factors didn't show any significant association. These data demonstrated the need to instruct the producers in relation to the biology and control of Rhipicephalus (Boophilus microplus. It was concluded that the majority of milk producers were unaware of cattle tick biology and the factors that influence choosing an acaricide, which makes it difficult to implement strategic control.Este estudo teve como objetivo avaliar o conhecimento dos produtores de leite sobre o carrapato dos bovinos e seu controle. Foram entrevistados 93 produtores de leite de Minas Gerais. Estes produtores não tinham informação sobre testes de eficiência de carrapaticidas e controle de carrapatos. Foi testada associação entre a escolaridade e as práticas e conhecimento sobre os carrapatos e constatou-se que 92,3% dos produtores nada sabiam sobre o período não-parasitário. Para 96,4%, o que determinava o momento do tratamento era o grau de infestação de carrapatos; e 93

  12. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Camp

  13. Lesions in cattle leather caused by the main ectoparasites in Northwest of Paraná State and Southwest of Mato Grosso state / Lesões no couro bovino causadas pelos principais ectoparasitas nas regiões noroeste do estado do Paraná e sudoeste do estado do Mato Grosso

    Directory of Open Access Journals (Sweden)

    Milton Hissashi Yamamura

    2000-04-01

    Full Text Available This work evaluates the lesions caused by ectoparasites like Boophilus microplus, Dermatobia hominis, Haematobia irritans in cattle leather, in tanning industry. Such material came from the Northwest of Parana State and Southwest of Mato Grosso State. The evaluation of leather occured in August, 1999 and February, 2000. In August, 1999, 15,530 samples from Northwest of Parana State and 11, 289 samples from the Southwest of Mato Grosso State were analysed. The result obtained showed that the main damage was caused by ticks bites, representing 63% in Parana and 67% in Mato Grosso of cattle leather infected by tick. It was followed by D. hominis (Tropical warble infection, where 34% of the cattle in Parana and 19% in Mato Grosso showed larvae infection and 3% in Parana and 14%> of the remaining cattle presented lesions by horn fly. In February, 2000 9,690 samples from Northwest of Parana State and 16,271 samples from the Southwest of Mato Grosso State were analyzed. Again the highest incidence of damage was caused by the ticks where 60% of cattle leather in Paranaand 65% in Mato Grosso were infected. It was also followed by tropical warble infection, where 35,5% of cattle in Parana and 20% in Mato Grosso presented larvae infection and 4,5% in Parana and 15% of the remaining cattle showed lesions by horn fly. Although tick caused greater leather lesions, the larvae ofD. hominis was responsible for the low quality of the material because such damage is irreversible. The Parana obtained the lowest score for leather due to the high incidence of larvae od D. hominis.Este trabalho avalia as lesões causadas pelos ectoparasitas Boophilus microplus, Dermatobia hominis, Haematobia irritans no couro de bovinos procedentes da região Noroeste do Estado do Paraná e Sudoeste do Estado do Mato Grosso, nos meses de agosto de 1999 e fevereiro de 2000. No mês de agosto de 1999, foram analisados 15530 couros bovinos provenientes da região Noroeste do Estado do

  14. Soroepidemiologia da babesiose em rebanho de bovinos da raça Curraleiro Seroepidemiology of babesiosis in Curraleiro cattle

    Directory of Open Access Journals (Sweden)

    Raquel Soares Juliano

    2007-10-01

    Full Text Available A babesiose bovina é uma hemoparasitose causada, no Brasil, pelos protozoários B. bovis e B. bigemina, as quais apresentam como único vetor biológico o carrapato Boophilus microplus. Foram avaliadas amostras dos animais da Estação Experimental de Estudos de Bovinos Curraleiros (EEEC colhidas nos anos de 2001 (n=117 e 2003 (n=113. A detecção de anticorpos anti-B. bovis e anti-B. bigemina foi realizada pelo ELISA-indireto. O objetivo deste trabalho foi estudar a soroepidemiologia da babesiose bovina em rebanho Curraleiro, obter informações sobre a situação da doença na população e relacionar os resultados obtidos com informações edafoclimáticas e de manejo disponíveis. A taxa de ocorrência em 2001 foi de 92,3% para B. bovis e de 83,8% para B. bigemina e, em 2003, foi de 92,9 e 66,4%, respectivamente. Houve diferença significativa na freqüência de soropositivos em relação à faixa etária no ano de 2003, ocorrendo uma diminuição com o avançar da idade. Sendo assim, foi possível concluir que, apesar das condições edafoclimáticas e do controle químico realizado no combate a ectoparasitas, os animais foram expostos à Babesia spp e encontravam-se em situação de estabilidade enzoótica para babesiose.Bovine babesiosis is a blood parasitic disease. In Brazil it is caused by B. bovis and B. bigemina protozoa, both of which reveal the Boophilus microplus tick as the only biological vector. Animal samples were collected at Experimental Study Farm of Curraleiro Cattle (ESFC in 2001 (n=117 and 2003 (n=113. The detection of antibodies against B. bovis and B. bigemina was carried out by ELISA-indirect method. This research was aimed at studing seroepidemiological aspects of bovine babesiosis in a Curraleiro herd, as well as obtain information about babesiosis stability in this population and relate the results with available climactic and management information. The occurrence rate of positive animals was 92.3% for B. bovis

  15. Biological parameters of cattle ticks fed on rabbits Parâmetros biológicos de carrapatos bovinos alimentados em coelhos

    Directory of Open Access Journals (Sweden)

    Maria Alice Zacarias do Amaral

    2012-03-01

    Full Text Available With the objective of encouraging the use of rabbits as alternative hosts for the cattle tick, four rabbits were infested on the ears and back. From the second day of infestation the developmental stages were observed. e duration of larval engorgement and changes were estimated between six and eight days in the region of the back and between 've and seven days in the pinna. e nymphal engorgement and changes occurred at approximately 10.80 ± 2.65 days in the dorsal and 11.00 ± 2.52 days in the ear, with the engorgement of adults and copulation occurring at 7.03 ± 2.45 days, on the dorsal region and 8.55 ± 1.82 days in the region of the pinna. e parasitic period ranged from 21 to 29 days (back and from 23 to 30 days (pinna. e engorged females of the back and ear weighed on average 34.43 ± 18.73 and 36.30 ± 18.10 mg, respectively. e nutritional and reproductive e/ciency indexes were 17.38 ± 14.27 and 26.85 ± 17.13% (back and 17.42 ± 12.22% and 30.70 ± 19.80% (pinna. Although not appropriate to maintain successive generations of Rhipicephalus (Boophilus microplus, rabbits can be used for di:erent stages of engorgement of the ixodid, allowing experimental studies.Com objetivo de viabilizar o uso de coelhos como hospedeiros alternativos do carrapato bovino, foram infestados quatro coelhos nas orelhas e no dorso. A partir do segundo dia da infestação, foram observados os estágios de desenvolvimento dos carrapatos. A duração do ingurgitamento e muda larval foi estimada entre seis e oito dias na região do dorso e entre cinco e sete dias no pavilhão auricular. O ingurgitamento e muda ninfal ocorreram em aproximadamente, 10,80 ± 2,65 dias na região dorsal e 11,00 ± 2,52 dias no pavilhão auricular; e o ingurgitamento e cópula dos adultos ocorreu em 7,03 ± 2,45 dias, na região do dorso e em 8,55 ± 1,82 dias na região do pavilhão auricular . O período parasitário variou de 21 a 29 dias (dorso e de 23 a 30 dias (pavilhão auricular

  16. Acaricidal properties of the formulations based on essential oils from Cymbopogon winterianus and Syzygium aromaticum plants.

    Science.gov (United States)

    de Mello, Valéria; Prata, Márcia Cristina de Azevedo; da Silva, Márcio Roberto; Daemon, Erik; da Silva, Luciane Santos; Guimarães, Flávia del Gaudio; de Mendonça, Alessandra Esther; Folly, Evelize; Vilela, Fernanda Maria Pinto; do Amaral, Lilian Henriques; Cabral, Lucio Mendes; do Amaral, Maria da Penha Henriques

    2014-12-01

    The cattle tick, Rhipicephalus (Boophilus) microplus, has caused serious harm to livestock raising in Brazil, considering the costs of controlling it, loss of revenue due to smaller production of milk and meat, and damage to leather, in addition to transmitting diseases. The use of medicinal plants is considered an alternative to the recurring resistance to chemicals. Due to the need for efficient alternatives with less environmental impact, this study aimed to develop contact formulations with essential oils from the Java citronella (Cymbopogon winterianus) and clove (Syzygium aromaticum) plants and to assess in vitro the effects in different stages of the tick cycle. In the present study, concentrations from 0.5-15.0% of the essential oils incorporated in the formulations were used. The ticks from different geographical areas were treated with those formulations, and their effects on the production levels of eggs, on the larvae hatching, and their efficiency on ticks were assessed. The obtained results were compared with other commercial acaricidal products. After the 20th day of treatment, the formulations with citronella essential oil had 2.09-55.51% efficiency, depending on the concentration of the oil incorporated. The efficiency of the treatment with formulations containing clove essential oil was higher, from 92.47-100%. The results showed the acaricidal effects of the formulations tested when compared to commercial chemical products. In vivo studies should be performed in order to assess the efficiency of those formulations in the fields, aiming to use these products as an alternative for controlling cattle ticks. PMID:25199555

  17. Cattle experimentally infected by Anaplasma marginale: Influence of splenectomy on disease pathogenesis, oxidative profile, and antioxidant status.

    Science.gov (United States)

    Doyle, Rovaina L; França, Raqueli T; Oliveira, Camila B; Rezer, João F P; Klafke, Guilherme M; Martins, João R; Santos, Andrea P; do Nascimento, Naíla C; Mesick, Joanne B; Lopes, Sonia T A; Leal, Daniela B R; Da Silva, Aleksandro S; Andrade, Cinthia M

    2016-06-01

    Bovine anaplasmosis is caused by the obligate intraerythrocytic bacteria Anaplasma marginale. These bacteria are transmitted by tick species such as Rhipicephalus (Boophilus) microplus, blood-sucking insects, and fomites (needles, clippers, and other blood contaminated equipment). During the acute phase of infection, animals may develop fever, anemia, jaundice, and hepatosplenomegaly. The aims of this study are to quantify the bacteremia by quantitative PCR in eight naïve calves experimentally infected by A. marginale [splenectomized (n = 4), and intact/non-splenectomized (n = 4)], and to correlate these findings with markers of oxidative stress on days 0, 8, 15, 21 and 23 post-infection. Complete blood counts (CBC) were performed in both groups. Lipid peroxidation was estimated by quantifying thiobarbituric acid reactive substances (TBARS); and non-enzymatic antioxidants were assessed by erythrocyte content of non-protein thiols (NPSH). There were no significant differences in complete blood counts (CBC) between the two groups. However, both groups had a slight decrease on packet cell volume (PCV), erythrocytes and hemoglobin concentration, as well as an increase in total leukocyte counts due to elevated lymphocytes when comparing pre and post-infection with A. marginale. Progressive increase on TBARS levels and concomitant decrease on NPSH content were observed in all animals, without significant differences between splenectomized and intact animals. A positive correlation between bacteremia and TBARS, and a negative correlation between bacteremia and NPSH were observed in both groups with higher correlation for NPSH in splenectomized animals. A negative correlation between TBARS and NPSH levels was observed in both groups indicating lipid peroxidation without a non-enzymatic antioxidant response. The results of experimental infection by A. marginale in cattle showed that bacteremia has an impact on lipid peroxidation regardless of the splenectomy. PMID

  18. THE INCIDENCE OF PARASITIC DISEASES IN LIVESTOCK IN BALI

    Directory of Open Access Journals (Sweden)

    N. A. Suratma

    2012-09-01

    Full Text Available The population of livestock in Bali has continuously increased from year to year. However, some problems are encountered with parasitic infections in livestock. Parasitic infections may be caused by worms, protozoa or ectoparasites. In cattle, the most common infections are those caused by Oesophagostomum sp, Ostertagia sp, Haemonchus sp, Mecistocirrus sp, and Cooperia sp which is the most dominant. Neoascaris vitulorum was reported to be as high as 29.1% in calves. Fascioliasis in cattle was found highly prevalent, between 34.9 to 56.7% and was caused by Fasciola gigantica. Also Paramphistomum infection was reported to be highly prevalent (50.1%. In addition, Boophilus microplus was recorded as high as 36.9%. In goat and sheep, the incidence of Haemonchus contortus was 27.7% and 53.6% respectively. Infestation of Paramphistomum sp in goat was 9.27%. Concerning ectoparasites, Sarcoptes scabiei was reported to be the cause of death of 67% of young goats and up to 11% of older gats in Br. Penginuman, Gilimanuk Negara. Parasitic infections in pigs were caused by Cysticercus tenuicollis (11% and Ascaris suum (24.2% and 21.1% showed Metastrongylus apri and also Sarcoptes scabiei was reported to be the cause of skin disease in pigs. In poultry, parasitic infection were caused by Raillietina (96%, Heterakis gallinae (66.7%, Capillaria sp (6.6%, Ascardia galli (56.7%, Oxyspirura mansoni (50%, Acuaria spiralis (13.3% and Syngamus trachea (3.3%. Multiple infections are common.

  19. Parasite vaccines--a reality?

    Science.gov (United States)

    Dalton, J P; Mulcahy, G

    2001-07-12

    Over the last decade, the anti-parasitics market has been the fastest growing sector of the overall $18 billion animal health market. While drugs for the treatment of parasites of livestock still dominate this sector and will continue to be developed or re-formulated, because of consumer demands for chemical-free food and of concerns regarding the environment and animal welfare there is a growing interest in the development of safe and effective vaccines. There is also a call for vaccines in the lucrative $3 billion-plus companion animal market. These demands for vaccines will add a greater impetus to an area that has seen tremendous success in the last 15 years. A number of anti-parasite vaccines have been developed, e.g. the recombinant 45w and EG95 oncosphere proteins against Taenia ovis and Echinococcus granulosis, respectively, and the Bm86 vaccine against Boophilus microplus. In addition, the cathepsin L vaccines against the liver fluke, Fasciola hepatica, and the H11 vaccine against Haemonchus contortus are progressing well. There are also many additional vaccine candidates for H. contortus and for other nematodes such as Ostertagia and Trichostrongylus spp. that may ultimately lead to broad-spectrum gastrointestinal worm vaccines. Live or attenuated-live vaccines are available for the control of avian coccidiosis, toxplasmosis in sheep and anaplasmosis in cattle, although molecular vaccines against protozoans are still proving elusive. The wealth of information in genomics, proteomics and immunology that has been forthcoming together will new methods of vaccine production and delivery should see many new vaccines reach the marketplace in the near future. PMID:11516584

  20. The evaluation of yeast derivatives as adjuvants for the immune response to the Bm86 antigen in cattle

    Directory of Open Access Journals (Sweden)

    Machado Héctor

    2001-05-01

    Full Text Available Abstract Background The Gavac™ vaccine against the cattle tick Boophilus microplus has proven its efficacy in a large number of controlled and field experiments. However, this vaccine could be further improved by searching for new alternative adjuvants that would induce a stronger long-lasting immune response. We conducted several experiments to assay the adjuvant effect of fractions of the recombinant yeast Pichia pastoris in mouse and cattle models. In previous experiments, the combination of the yeast membrane with saponin was the most effective formulation in stimulating the humoral immune response in mice, eliciting a response higher than Montanide 888. The response was predominantly of the IgG1 isotype. Here, we evaluated the response in cattle and compared the results with that obtained in mice. Results Bm86 on the membrane of P. pastoris plus saponin produced high antibody titers in cattle, though the protection level against tick infestations was lower when compared to Gavac™, probably due to a decrease in the IgG1/IgG2 ratio. The predictive value of the mouse model was studied through correlation analysis between the isotype levels in mice and the efficacy of formulations in cattle. Good correlation was established between the level of antibodies in mice and cattle, and between the amount of anti -Bm86 IgG1 in mice and the degree of protection in cattle. Conclusion Mouse model have the potential to predict immunogenicity and efficacy of formulations in cattle. These results also support the use of the yeast expression system for recombinant vaccine formulations, enabling the prediction of more cost - effective formulations.

  1. Genetic diversity and molecular characterization of Babesia motasi-like in small ruminants and ixodid ticks from China.

    Science.gov (United States)

    Niu, Qingli; Liu, Zhijie; Yang, Jifei; Yu, Peifa; Pan, Yuping; Zhai, Bintao; Luo, Jianxun; Yin, Hong

    2016-07-01

    Ovine babesioses, an important tick-borne disease of sheep and goats in China, is caused by the reproduction of intraerythrocytic protozoa of the Babesia genus. Babesia motasi-like is a Babesia parasite that infects small ruminant in China, and two sub-groups of B. motasi-like can be subdivided based on differences in the rhoptry-associated-protein-1 gene. This study aimed to characterize the distribution, epidemiology and genetics of B. motasi-like in animals and ticks. A molecular investigation was carried out from 2009 to 2015 in 16 provinces in China. In total, 1081 blood samples were collected from sheep and goats originating from 27 different regions, and 778 ixodid tick samples were collected from 8 regions; the samples were tested for the presence of B. motasi-like using a specific nested PCR assay based on the rap-1b gene. The results indicated that 139 (12.9%), 91 (8.4%), 48 (4.4%) and 6 (0.7%) of the blood samples were positive for general B. motasi-like, Babesia sp. BQ1 (Lintan and Ningxian), Babesia sp. Tianzhu and Babesia sp. Hebei sub-groups, mixed infections, respectively. Among the collected 778 ixodid ticks (including Haemaphysalis longicornis, Haemaphysalis qinghaiensis, Dermacentor silvarum, Ixodes persulcatus, Rhipicephalus sanguineus and Rhipicephalus (Boophilus) microplus), the most frequently infected with Babesia were D. silvarum and I. persulcatus (35.7%), followed by H. longicornis (26.8%), H. qinghaiensis (24.8%) and R. sanguineus (9.3%). The PCR results were confirmed by DNA sequencing. The positive rates of B. motasi-like infection in ticks were found to be higher in China, compared with previous studies in other countries. B. motasi-like infections have not previously been reported in D. silvarum, I. persulcatus or R. sanguineus. The findings obtained in this study could be used for planning effective control strategies against babesiosis in China. PMID:26976477

  2. Seroprevalencia de babesiosis bovina en la hacienda Vegas de la Clara, Gómez Plata (Antioquia, 2008

    Directory of Open Access Journals (Sweden)

    Richard Zapata Salas

    2011-06-01

    Full Text Available La babesiosis es una enfermedad del ganado bovino transmitida por la garrapata Rhipicephalus (Boophilus microplus y causada por los parásitos protozoarios Babesia bovis y B. bigemina. Una zona se considera epizootiológicamente estable frente a Babesia spp, cuando el 75% de los bovinos entre las edades de 3 a 9 meses son serorreactivos (IgG frente a Babesia bovis y Babesia bigemina y no hay evidencia de signos clínicos. El objetivo de esta investigación fue determinar la seroprevalencia de Babesia bovis y Babesia bigemina en el ganado bovino de la hacienda Vegas de la Clara (Universidad de Antioquia, Gómez Plata, Antioquia, por medio de inmunofluorescencia indirecta. Se diseñó un estudio descriptivo prospectivo con análisis de corte transversal. Fue evaluada toda la población bovina de la hacienda Vegas de la Clara (n = 118. Las muestras fueron evaluadas por inmunofluorescencia indirecta para la detección de anticuerpos tipo IgG específicos contra Babesia bovis y B. bigemina. La serorreactividad obtenida en los bovinos evaluados, para al menos una especie de Babesia fue del 89,8%, para Babesia bovis del 83,8%, mientras que para B. bigemina del 61%. Se obtuvo una relación estadísticamente significativa entre la serorreactividad para B. bigemina y la frecuencia del tratamiento garrapaticida. La serorreactividad indica estabilidad enzoótica en el hato para B. bovis, mientras que para B. bigemina se encontró que la frecuencia del tratamiento garrapaticida interrumpe su ciclo de transmisión.

  3. In Vitro Mode of Action and Anti-thrombotic Activity of Boophilin, a Multifunctional Kunitz Protease Inhibitor from the Midgut of a Tick Vector of Babesiosis, Rhipicephalus microplus.

    Directory of Open Access Journals (Sweden)

    Teresa C Assumpção

    2016-01-01

    Full Text Available Hematophagous mosquitos and ticks avoid host hemostatic system through expression of enzyme inhibitors targeting proteolytic reactions of the coagulation and complement cascades. While most inhibitors characterized to date were found in the salivary glands, relatively few others have been identified in the midgut. Among those, Boophilin is a 2-Kunitz multifunctional inhibitor targeting thrombin, elastase, and kallikrein. However, the kinetics of Boophilin interaction with these enzymes, how it modulates platelet function, and whether it inhibits thrombosis in vivo have not been determined.Boophilin was expressed in HEK293 cells and purified to homogeneity. Using amidolytic assays and surface plasmon resonance experiments, we have demonstrated that Boophilin behaves as a classical, non-competitive inhibitor of thrombin with respect to small chromogenic substrates by a mechanism dependent on both exosite-1 and catalytic site. Inhibition is accompanied by blockade of platelet aggregation, fibrin formation, and clot-bound thrombin in vitro. Notably, we also identified Boophilin as a non-competitive inhibitor of FXIa, preventing FIX activation. In addition, Boophilin inhibits kallikrein activity and the reciprocal activation, indicating that it targets the contact pathway. Furthermore, Boophilin abrogates cathepsin G- and plasmin-induced platelet aggregation and partially affects elastase-mediated cleavage of Tissue Factor Pathway Inhibitor (TFPI. Finally, Boophilin inhibits carotid artery occlusion in vivo triggered by FeCl3, and promotes bleeding according to the mice tail transection method.Through inhibition of several enzymes involved in proteolytic cascades and cell activation, Boophilin plays a major role in keeping the midgut microenvironment at low hemostatic and inflammatory tonus. This response allows ticks to successfully digest a blood meal which is critical for metabolism and egg development. Boophilin is the first tick midgut FXIa anticoagulant also found to inhibit thrombosis.

  4. Parasites of cattle in the trans-boundary areas of Ogun State, Nigeria

    International Nuclear Information System (INIS)

    Amblyomma variegatum, 739 (19.68%) were Boophilus decoloratus, 487 (12.97%) were Boophilus microplus, 473 (12.59%) were Amblyomma hebraeum, 41 (1.09%) were Hyalomma spp. and 19 (0.51%) were Amblyomma Haematopinus was the only louse specie identified in this study. They were found on the upper eyelid, inner commissure of the pinna and tip of the tail in 16 animals. Demodex bovis was seen in all the 18 skin nodules, while Dermatophilus congolensis was isolated from all 15-skin scabs collected. The very high parasitic load observed in the animal population in this study is an indication that many parasites enter the country on daily basis via animate vectors. These animals may be carriers of a wide range of economic important diseases, the control of which may be very expensive. This may also result in additional cost of production to the owners of in-contact animals. Since the potential for increasing livestock production in Nigeria can only be fully realized if the animals are adequately protected against major diseases, the animals in border areas should be regularly monitored and screened for diseases of economic and/ or epizootic importance to minimize spread of trans-boundary diseases to the national herd. (author)

  5. Factors that influence the prevalence of acaricide resistance and tick-borne diseases.

    Science.gov (United States)

    Foil, L D; Coleman, P; Eisler, M; Fragoso-Sanchez, H; Garcia-Vazquez, Z; Guerrero, F D; Jonsson, N N; Langstaff, I G; Li, A Y; Machila, N; Miller, R J; Morton, J; Pruett, J H; Torr, S

    2004-10-28

    This manuscript provides a summary of the results presented at a symposium organized to accumulate information on factors that influence the prevalence of acaricide resistance and tick-borne diseases. This symposium was part of the 19th International Conference of the World Association for the Advancement of Veterinary Parasitology (WAAVP), held in New Orleans, LA, USA, during August 10-14, 2003. Populations of southern cattle ticks, Boophilus microplus, from Mexico have developed resistance to many classes of acaricide including chlorinated hydrocarbons (DDT), pyrethroids, organophosphates, and formamidines (amitraz). Target site mutations are the most common resistance mechanism observed, but there are examples of metabolic mechanisms. In many pyrethroid resistant strains, a single target site mutation on the Na(+) channel confers very high resistance (resistance ratios: >1000x) to both DDT and all pyrethroid acaricides. Acetylcholine esterase affinity for OPs is changed in resistant tick populations. A second mechanism of OP resistance is linked to cytochrome P450 monooxygenase activity. A PCR-based assay to detect a specific sodium channel gene mutation that is associated with resistance to permethrin has been developed. This assay can be performed on individual ticks at any life stage with results available in a few hours. A number of Mexican strains of B. microplus with varying profiles of pesticide resistance have been genotyped using this test. Additionally, a specific metabolic esterase with permethrin-hydrolyzing activity, CzEst9, has been purified and its gene coding region cloned. This esterase has been associated with high resistance to permethrin in one Mexican tick population. Work is continuing to clone specific acetylcholinesterase (AChE) and carboxylesterase genes that appear to be involved in resistance to organophosphates. Our ultimate goal is the design of a battery of DNA- or ELISA-based assays capable of rapidly genotyping individual ticks to

  6. Óleo de citronela no controle do carrapato de bovinos Citronella oil on the control of catle ticks

    Directory of Open Access Journals (Sweden)

    Clair Jorge Olivo

    2008-04-01

    Full Text Available O objetivo deste estudo foi avaliar o efeito in vivo e in vitro do óleo de citronela (Cymbopogon nardus (L. Rendle no carrapato de bovinos (Boophilus microplus. O óleo foi obtido de folhas frescas pelo processo de destilação e o rendimento foi de 0,7%. Para as experimentações in vitro foram usadas sete (0; 0,5; 1,0; 10,0; 25,0; 50,0; 100,0% e nove (0,1; 0,25; 0,5; 1,0; 2,0; 10,0; 25,0; 50,0; 100% concentrações de óleo de citronela, sendo testadas em fêmeas ingurgitadas. A eficácia observada foi de 0; 44,2; 92,1; 85,6; 87,8; 87,0; 88,9 e de 0,7; 2,8; 51,6; 79,3; 81,0; 87,1; 86,7; 89,5%, respectivamente. Os resultados sugerem que o óleo de citronela pode ser usado no controle do carrapato bovino.This research was aimed at evaluating in vitro and in vivo effects of citronella (Cymbopogon nardus (L. Rendle oil on catle ticks. The volatile oil was obtained from de fresh leaves of citronella grass by steam destilation and the yelds was 0.7%. Seven (0; 0.5; 1.0; 10.0; 25.0; 50.0; 100.0% and nine (0.1; 0.25; 0.5; 1.0; 2.0; 10.0; 25.0; 50.0; 100.0% concentrations of citonella oil were used on in vitro trials with engorged female ticks. The efficacy control ticks was 0; 44.2; 92.1; 85.6; 87.8; 87.0; 88.9 and 0; 0.7; 2.8; 51.6; 79.3; 81.0; 87.1; 86.7 89.5 %, respectively. These sugest that the citronella oil can be practical used for controlling of catle ticks.

  7. Microepidemia de histoplasmose na zona rural de Brasília - DF - 1967: II - Estudos Epidemiológico e Parasitológico da Fonte de Infecção

    Directory of Open Access Journals (Sweden)

    Sydney Schmidt

    1973-04-01

    Full Text Available Neste trabalho são relatadas pesquisas parasitológicas e epiâemiológicas realizadas numa provável fonte de infecção de Histoplasmose da área rural do D. F. - Brasília, onde 14 pessoas contraíram a doença. Os estudos clínico, imunológico e radiológico foram anteriormente descritos. Os autores conseguiram isolar o H. capsulatum do solo da caverna e das vísceras e do sangue de morcegos (Phyllostomus hastatus hastatus, Pallas 1767 que nela habitavam. Resultaram negativas as tentativas de isolamento do fungo de animais sentinelas (cobaios, assim como não se obteve neles a viragem dos testes intradérmicos com histoplasmina. Em impressões de vísceras dos morcegos, constataram-se formas semelhantes as do T. gondii que posteriormente foram isoladas, em camundongos jovens, por inoculação de vísceras maceradas e sangue. Foram encontrados 2 ectoparasitos nos morcegos: Boophilus microplus e um díptero da família Streblidae. O ácaro albergava tripomastigotos do tipo cruzi, não sendo porém conseguido seu isolamento. No tubo digestivo dos quirópteros, foram retirados nematódeos (Histiostrongylus octaeantus e cestódeos do gênero Mathevotaenia. Foram capturados, em torno da entrada da caverna, 2 exemplares de Cercomys cunicularis apereoide não sendo examinados sob o ponto de vista parasitológico. Testes intradérmicos realizados em 826 habitantes da área resultaram positivos em 184 (22,27%. A gruta, fonte da infecção, está localizada em uma formação calcárea, pertencente à série Bambuí, acreditando-se, pelos aspectos tectônicos, ser da idade siluriana. No Brasil, o isolamento de H. capsulatum de solo, guanos de morcegos e vísceras de roedores já tinham sido realizados; contudo, esta foi a primeira vez que se conseguiu isolá-lo do solo de uma caverna, fonte de infecção, e das vísceras e sangue de morcegos. Os resultados obtidos com os testes intradérmicos com histoplasmina demonstraram a prevalência de

  8. Parasiticide resistance in flies, lice and ticks in New Zealand and Australia: mechanisms, prevalence and prevention.

    Science.gov (United States)

    Heath, Acg; Levot, G W

    2015-07-01

    This review outlines the history of parasiticide resistance in the principal ectoparasites of sheep and cattle in New Zealand and Australia, blowflies, buffalo fly (Haematobia irritans exigua), sheep biting louse (Bovicola ovis) and cattle ticks, and discusses recent changes in their response to insecticides and acaricides. Mechanisms of resistance and evaluation methods are described, with ways in which insecticide resistance can be avoided or ameliorated also discussed. Resistance in sheep blowflies (Lucilia cuprina; L. sericata) to organophosphates and benzoylphenyl urea compounds is widespread in Australia and New Zealand, but there are lesser concerns about a pyrimidine carbonitrile product as well as cyromazine and macrocyclic lactone actives which still offer the promise of long-term protection. In Australia the effectiveness of synthetic pyrethroid and benzoylphenyl urea products against the biting louse of sheep have been reduced by widespread resistance but effective temephos, macrocyclic lactone, imidacloprid and spinosyn-based products are now available. Pyrethroid-resistant sheep lice are also present in New Zealand. Buffalo fly remains a significant problem in Australia and control relies heavily on insecticide use. Resistance to synthetic pyrethroids is widespread and organophosphate resistance common, but less evenly distributed. There is no evidence of resistance to acaricides used against the New Zealand cattle tick, Haemaphysalis longicornis and experience in Japan with the most commonly available active, flumethrin (a synthetic pyrethroid), suggests that this three-host tick is, in the short term, likely to remain susceptible. The same cannot be said for Rhipicephalus australis (formerly Boophilus microplus) which, in some strains, is highly resistant to many of the active ingredients in the acaricides used against it. A formamidine, a benzoylphenyl urea and macrocyclic lactones still show efficacy although some resistance is being detected to

  9. Tick repellents and acaricides of botanical origin: a green roadmap to control tick-borne diseases?

    Science.gov (United States)

    Benelli, Giovanni; Pavela, Roman; Canale, Angelo; Mehlhorn, Heinz

    2016-07-01

    Arthropods are dangerous vectors of agents of deadly diseases, which may hit as epidemics or pandemics in the increasing world population of humans and animals. Among them, ticks transmit more pathogen species than any other group of blood-feeding arthropods worldwide. Thus, the effective and eco-friendly control of tick vectors in a constantly changing environment is a crucial challenge. A number of novel routes have been attempted to prevent and control tick-borne diseases, including the development of (i) vaccines against viruses vectored by ticks; (ii) pheromone-based control tools, with special reference to the "lure and kill" techniques; (iii) biological control programmes relying on ticks' natural enemies and pathogens; and (iv) the integrated pest management practices aimed at reducing tick interactions with livestock. However, the extensive employment of acaricides and tick repellents still remains the two most effective and ready-to-use strategies. Unfortunately, the first one is limited by the rapid development of resistance in ticks, as well as by serious environmental concerns. On the other hand, the exploitation of plants as sources of effective tick repellents is often promising. Here, we reviewed current knowledge concerning the effectiveness of plant extracts as acaricides or repellents against tick vectors of public health importance, with special reference to Ixodes ricinus, Ixodes persulcatus, Amblyomma cajennense, Haemaphysalis bispinosa, Haemaphysalis longicornis, Hyalomma anatolicum, Hyalomma marginatum rufipes, Rhipicephalus appendiculatus, Rhipicephalus (Boophilus) microplus, Rhipicephalus pulchellus, Rhipicephalus sanguineus and Rhipicephalus turanicus. Eighty-three plant species from 35 botanical families were selected. The most frequent botanical families exploited as sources of acaricides and repellents against ticks were Asteraceae (15 % of the selected studies), Fabaceae (9 %), Lamiaceae (10 %), Meliaceae (5 %), Solanaceae (6

  10. Microepidemia de histoplasmose na zona rural de Brasília - DF - 1967: II - Estudos Epidemiológico e Parasitológico da Fonte de Infecção

    Directory of Open Access Journals (Sweden)

    Sydney Schmidt

    1973-04-01

    Full Text Available Neste trabalho são relatadas pesquisas parasitológicas e epiâemiológicas realizadas numa provável fonte de infecção de Histoplasmose da área rural do D. F. - Brasília, onde 14 pessoas contraíram a doença. Os estudos clínico, imunológico e radiológico foram anteriormente descritos. Os autores conseguiram isolar o H. capsulatum do solo da caverna e das vísceras e do sangue de morcegos (Phyllostomus hastatus hastatus, Pallas 1767 que nela habitavam. Resultaram negativas as tentativas de isolamento do fungo de animais sentinelas (cobaios, assim como não se obteve neles a viragem dos testes intradérmicos com histoplasmina. Em impressões de vísceras dos morcegos, constataram-se formas semelhantes as do T. gondii que posteriormente foram isoladas, em camundongos jovens, por inoculação de vísceras maceradas e sangue. Foram encontrados 2 ectoparasitos nos morcegos: Boophilus microplus e um díptero da família Streblidae. O ácaro albergava tripomastigotos do tipo cruzi, não sendo porém conseguido seu isolamento. No tubo digestivo dos quirópteros, foram retirados nematódeos (Histiostrongylus octaeantus e cestódeos do gênero Mathevotaenia. Foram capturados, em torno da entrada da caverna, 2 exemplares de Cercomys cunicularis apereoide não sendo examinados sob o ponto de vista parasitológico. Testes intradérmicos realizados em 826 habitantes da área resultaram positivos em 184 (22,27%. A gruta, fonte da infecção, está localizada em uma formação calcárea, pertencente à série Bambuí, acreditando-se, pelos aspectos tectônicos, ser da idade siluriana. No Brasil, o isolamento de H. capsulatum de solo, guanos de morcegos e vísceras de roedores já tinham sido realizados; contudo, esta foi a primeira vez que se conseguiu isolá-lo do solo de uma caverna, fonte de infecção, e das vísceras e sangue de morcegos. Os resultados obtidos com os testes intradérmicos com histoplasmina demonstraram a prevalência de

  11. Doenças parasitárias em ruminantes no semi-árido brasileiro Parasitic diseases in ruminants in the Brazilian semiarid

    Directory of Open Access Journals (Sweden)

    Valéria Medeiros de M. Costa

    2009-07-01

    -árido o Rhipicephalus (Boophilus microplus não sobrevive durante o período de seca, mas, tristeza parasitária pode ocorrer quando no início do período chuvoso bovinos com carrapatos são introduzidos e esses se multiplicam durante o mesmo.Clinical cases and diagnostic specimens from ruminants received by the Veterinary Hospital of the University of Campina Grande in Patos, Paraíba, Brazil, from January 2000 to August 2007, were reviewed to evaluate some epidemiological aspects of parasitic diseases of ruminants in the semiarid region of Paraíba and neighboring states. The region has an annual rainfall of about 800mm, with irregular rains concentrated in a 3 to 4-month-period, and an average annual temperature of 26°C. During those years, 163 (5.31% out of 3,064 ruminants were affected by some parasitic disease. The most important parasitosis in goats and sheep was gastrointestinal helminthiasis, mainly hemonchosis; goats were more affected (6.24% of cases in this species than sheep (4.7% of cases. The higher frequency of the disease in goats may be associated with higher susceptibility or due to treatment mistakes, i.e. use of the same dose for both species, which for most anti-antihelmintics is insufficient for goats. Cattle have a low rate of gastrointestinal helminthiasis (1 out of 1,113 cases. This low frequency is probably due to the farming system in the semiarid, with low stocking rate, up to one adult bovine for every 13-16 ha, and permanence of calves (susceptible with their mothers (resistant for nearly one year before weaning. The occurrence of eimeriosis in goats and sheep was observed in 0.76% of the cases, involving only young animals. The main cattle disease was tick fever with 14 outbreaks. Outbreaks of tick fever occur, mainly at the end of the raining season in areas of the semiarid which are marginal for tick, like plateaus and mountains of the Borborema region, irrigated areas, and areas of the basins of two rivers of the region. In the drier

  12. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave

  13. Lesões da mosca dos chifres (Haematobia irritans Linnaeus,1758 na pele de bovinos e impacto na indústria do couro Lesions of the horn fly (Haematobia irritans Linnaeus, 1758 on the bovine skin and their impact in leather industry

    Directory of Open Access Journals (Sweden)

    Luciana Viero da Silva

    2002-12-01

    ,09% tipo "C". Após a aplicação de pastas especiais por profissionais especializados evidenciou-se que as áreas afetadas pela mosca dos chifres onde se observara um grande numero de lesões passaram a ter um aspecto homogêneo e sem marcas. Deve-se salientar que estes couros, mesmo provenientes de animais tratados apresentavam lesões características de outros parasitas como Dermatobia hominis e Boophilus microplus e também lesões provavelmente adquiridas durante o processamento no frigorífico. Estes resultados sugerem que a mosca dos chifres não representa um fator econômico importante para a industria do couro.Twenty two male 2- year- old Ibagé bovines at the beginning of the experiment were selected. They were divided into two groups of 11 bovines each. One group was treated with insecticide at 14 days intervals and the other remained as control. After that the animals were slaughtered and the respective leather sent to the tannery where they were tanned and evaluated in two stages, the Wet-Blue (leather treated in chromium, still humid and bluish and the total tanning. Animals weight, carcasses weight and dressing percentage were recorded and there was no correlation between infestation by the horn fly and those parameters. At slaughter, samples of the flank areas and the back of the animals were collected and processed for histology studies, which revealed the presence of a perivascular inflammatory infiltration with eosinophils and few mononuclear cells (lymphocytes and plasma cells at the superficial dermis in which 16 out of 19 samples (84.21% were mild in 2 out of 19 samples (10.52% were moderate and in 1 out of 19 samples (5. 26% was marked. In the tanning phase called as Wet-blue, the classification of the leathers was as follows: 8 out 22 (36.36% type "A", 10 out of 22 (45.45% type "B", and"4 out of 22 (18.18% type "C. At this point in the group of animals treated with insecticide the areas commonly parasited by the horn fly (flanks and back a few

  14. New lichen records from Bukovské vrchy Mts (NE Slovakia

    Directory of Open Access Journals (Sweden)

    Ivan Pišút

    2013-12-01

    Full Text Available Interesting findings of 100 lichens from the Bukovské vrchy Mts (Biosphere Reserve Poloniny, Slovak part are reported as the result of recent survey work. Two species are new for Slovakia: Fellhanera gyrophorica and Rinodina efflorescens, and 34 species are reported for the first time from the studied area. The new records for the country are shortly commented as well as ecological aspects of Agonimia repleta, Strigula stigmatella, Gyalecta ulmi and Belonia herculina.

  15. 新疆南疆微小牛蜱Bm86基因及其编码蛋白剖析%Analysis of Bm86 Gene and its Encoding Protein of Rhipicephalus microplus in South Xinjiang

    Institute of Scientific and Technical Information of China (English)

    刘永宏; 赵丽

    2014-01-01

    为了能高效表达理想的微小牛蜱抗原,本研究对新疆生产建设兵团塔里木畜牧科技重点实验室已获得的Bm86基因(Bm86 Tarim)进行遗传进化分析,并对其编码蛋白进行生物学信息分析.结果显示本研究获得的新疆南疆微小牛蜱Bm86Tarim序列与已登录的所有国外Bm86基因完整阅读框序列的核苷酸和氨基酸同源性分别为95.9%~98.6%和93.8%~97.8%,差异极小;遗传进化树分析结果显示本研究毒株与已登录多数毒株在同一分支内;生物学信息预测结果显示该蛋白不稳定,不溶性的概率为93.26%,有4个潜在糖基化位点.本试验结果为后续Bm86基因表达、免疫抗原制备和抗微小牛蜱疫苗的研制奠定基础.

  16. Detection of anti-Borrelia burgdorferi antibodies in buffaloes (Bubalus bubalis in the state of Pará, Brazil Detecção de anticorpos anti-Borrelia burgdorferi em búfalos (Bubalus bubalis no estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Fabíola do Nascimento Corrêa

    2012-09-01

    contra B. burgdorferi, com positividade variando de 63,6% a 92,9%. O alto número de soropositivos pode ser explicado pela frequente presença do carrapato Rhipicephalus (Boophilus microplus e pela possível existência de espiroquetas do gênero Borrelia infectando búfalo na região estudada, embora novos estudos sejam necessários para a confirmação desta relação. Estes fatos sugerem reação cruzada entre a cepa americana G39/40 de B. burgdorferi utilizada como substrato antigênico e a espécie de Borrelia spp. que possivelmente infecta bubalinos no estado do Pará.

  17. Growing hairs in shorn cattle

    Directory of Open Access Journals (Sweden)

    Cecília José Veríssimo

    2013-12-01

    Full Text Available The shearing operation can provide double benefits to the cattle: they can become more heat tolerant and the tick infestation decreases. The cattle tick Rhipicephalus (Boophilus microplus causes great losses to dairy cattle, especially to the Holstein cattle because they are very susceptible to this tick. Its control is becoming each day more difficult, owing to the increasing resistance to acaricides they are acquiring. The objective of this work was to study the growing of haircoat following shearing. We made our experiment with 17 animals, 7 females and 10 males. They were shaved on the anterior third (head, neck, dewlap, scapula and arm of one side, at random. The work was performed in two steps: they were shorn for the first time on August 2nd 2012, with a size 10 blade in a clipper Oster model GoldenA5, which left the fur coat 2 mm long. Then we evaluated the hair length growing by collecting fortnightly three sample of hairs in the middle of the scapula, with  electric pliers, modified for this purpose, in both sides of the animals, sheared and non-sheared, until 30 days after this shearing. The three hair samples were put inside a little plastic bag per animal. Meanwhile, as we thought that the animals shearing had to be done closer to the skin, we decided to shear them again (in the same side shorn before, on October 2nd 2012. We changed our procedure using the same machine, but now with a blade size 30, which left the fur coat 1mm thick. After that, we collected again, fortnightly, samples of hairs on both sides during 2 months. The 10 longest hairs in the plastig bag were measured using a graph paper and the average per animal was calculated in each data and blade. A random design was applied for statistical analysis, the hair length of both sides, sheared and non sheared were compared by a two related samples tests – Wilcoxon, in a non parametric test, using the SPSSP 12.0 program, in each data within each blade. Using blade size

  18. Tick resistance and heat tolerance characteristics in cattle. III. Sweating rate

    Directory of Open Access Journals (Sweden)

    Cecília José Veríssimo

    2012-12-01

    Full Text Available Cattle in a sustainable tropical livestock should be heat tolerant and resistant to ticks. The relationship between Rhipicephalus (Boophilus microplus infestation and sweating rate, an important heat tolerance characteristic, was studied in six Nellore and four Holstein steers of seven-month-old. They were artificial infested (a.i. with 10,000 (Holstein and 20,000 (Nellore larvae in 16/Apr/2011. In days 20, 23 and 24 after the infestation, the 10 bigger females ticks found in whole animal were weighed and put in a chamber (27 oC and 80% RH, weighing the egg mass of each female tick fourteen days after. The sweating rate (SRskin, measured by Scheleger and Turner, 1963, method, in a shaved area of shoulder skin was evaluated in 14/Apr (2 days before the a.i. and in 05/May (19 days after a.i.. In 14/Apr the Scheleger and Turner, 1963, method was done on the coat not shaved (SRcoat. The sweating rate was measured in the afternoon (from 2 P.M., after 30 minutes of direct sunlight, on April. On May, the animals remained 60 minutes in direct sunlight because this day was colder. The experimental design was a non-probability sample restricted to the 10 available animals. Data from the steers’ sweating rate were analyzed using the General linear models of the SPSS® statistical package (version 12.0 using SRskin as dependent variable and breed and sampling date as independent variables. For SRcoat breed was the independent variable. Nellore, a tropical cattle breed, had higher SRskin (1,000.82 ± 64.59 g m-2 h-1, P< 0.001 than Holstein (620.45 ± 79.10 g m-2 h-1. SRskin was higher on May (1,187.33 ± 71.49 g m-2 h-1, P< 0.001 than on April (433.93 ± 71.49 g m-2 h-1. The correlation between the two different measurements of SR was positive and significant (r= 0,545, P<0,01, Pearson correlation. But in SRcoat the breed effect disappeared because the Holstein SRcoat increased (Holstein: 884.95 ± 472.12 g m-2 h-1 and Nellore: 1,060.72 ± 318.21 g m-2 h-1

  19. Comparative microarray analyses of adult female midgut tissues from feeding Rhipicephalus species.

    Science.gov (United States)

    van Zyl, Willem A; Stutzer, Christian; Olivier, Nicholas A; Maritz-Olivier, Christine

    2015-02-01

    The cattle tick, Rhipicephalus microplus, has a debilitating effect on the livestock industry worldwide, owing to its being a vector of the causative agents of bovine babesiosis and anaplasmosis. In South Africa, co-infestation with R. microplus and R. decoloratus, a common vector species on local livestock, occurs widely in the northern and eastern parts of the country. An alternative to chemical control methods is sought in the form of a tick vaccine to control these tick species. However, sequence information and transcriptional data for R. decoloratus is currently lacking. Therefore, this study aimed at identifying genes that are shared between midgut tissues of feeding adult female R. microplus and R. decoloratus ticks. In this regard, a custom oligonucleotide microarray comprising of 13,477 R. microplus sequences was used for transcriptional profiling and 2476 genes were found to be shared between these Rhipicephalus species. In addition, 136 transcripts were found to be more abundantly expressed in R. decoloratus and 1084 in R. microplus. Chi-square analysis revealed that genes involved in lipid transport and metabolism are significantly overrepresented in R. microplus and R. decoloratus. This study is the first transcriptional profiling of R. decoloratus and is an additional resource that can be evaluated further in future studies for possible tick control. PMID:25448423

  20. Vaccination against ticks and the control of ticks and tick-borne disease

    International Nuclear Information System (INIS)

    Full text: Ticks and tick-borne disease are a major constraint to livestock production in developing countries. The control of ticks is of particular importance given that a major component of the control of tick-borne disease is, in fact, via the control of the vector. Problems with the control of ticks through pesticide application continue to increase, explaining the continued interest in vaccine and biological control strategies as alternatives. The feasibility of vaccination was demonstrated conclusively with the release, in 1994, of a recombinant commercial vaccine against Boophilus microplus. Nevertheless, since then the field has languished commercially, despite ongoing scientific progress. This paper will address the hurdles to further development and some ways in which they might be overcome. Efficacy and the development of prototype vaccines Recombinant vaccines have a number of potential advantages over chemical control. These include safety, specificity and freedom from environmental contamination. They are potentially low cost and stable, either minimising or eliminating the need for a cold chain for distribution. Another advantage is less well recognised. Many of the problems with pesticides derive from inaccurate or inappropriate application. In this regard, vaccines are more robust technology, being less dependent on volume or timing of application. The problem with vaccines is their perceived and real lack of efficacy. The current commercial vaccine against B. microplus is a single antigen vaccine that, at best, gives 90% protection. Used in a sustained way, this is adequate in many production situations. In other situations, efficacy may be less and hence inadequate. Efficacy can be increased through the addition of other antigens to a vaccine. Over the last decade a number of possibilities have been identified, though none have been thoroughly evaluated. A reliable evaluation of the existing portfolio of antigens in a field situation would be

  1. Como es arriba es abajo: Simbolismo de los astros en Hermetismo y astrología

    OpenAIRE

    Aznar, Susana

    2016-01-01

    La cultura forma nuestra cosmovisio¿n de la realidad. Actualmente nuestra cultura esta¿ repleta de si¿mbolos e ima¿genes que de forma silenciosa transmiten sus mensajes a nuestro inconsciente. Entre todos compartimos una visio¿n global, ya que todos somos ba¿sicamente lo mismo: Seres humanos. Nuestra psique inconsciente presenta unos arquetipos que son presentes en todo el mundo, formando lo que se conoce como inconsciente colectivo. Mirando atra¿s en la historia nos damos cuenta que mucho...

  2. (Des)construir a formação

    OpenAIRE

    Esteves, Sandra Marisa Araújo

    2012-01-01

    O presente relatório final documenta a minha experiência enquanto aluna estagiária do Mestrado em Educação Pré-Escolar. Porque é durante a infância que as bases da formação pessoal e social se alicerçam e é nesta fase da vida que as crianças aprendem a aprticipar no meio que a rodeia, pretende-se que a primeira etapa do processo de educação ao longo da vida seja repleta de qualidade a vários níveis. (...)

  3. quot;PATRIMÓNIO À PROVA DE ÁGUA Apontamento para a Salvaguarda das Azenhas Açudes nas margens do rio Ave, Vila Nova de Famalicao/Trofa

    OpenAIRE

    R. Bruno Matos

    2011-01-01

    A tradição, elo que ata e harmoniza o passado com o presente, é o veículo que liga o passado ao futuro. (Camilo Castelo Branco)Na sequência do mestrado, em Metodologias de Intervenção no Património Arquitectónico, desenvolvido na Faculdade de Arquitectura da Universidade do Porto durante os últimos três anos fui levado a [re]viver as margens do rio Ave nos concelhos de Vila Nova de Famalicão e Trofa. Constatei uma realidade surpreendente repleta de valores culturais: deparei-me com Azenhas A...

  4. CONTABILIDADE AMBIENTAL: A REDEFINIÇÃO DE UM PERFIL PROFISSIONAL

    OpenAIRE

    Damas da Silveira, Stela Aparecida; Carvalho de Souza, Ana Hilda

    2013-01-01

    A educação superior brasileira está repleta de desafios contemporâneos. Os problemas sociais, mais do que nunca, refletem diretamente na expectativa da sociedade sobre os profissionais formados na universidade. Discussões sócio-ambientais tornaram-se imprescindíveis na academia e trouxeram consigo o surgimento de diferentes abordagens sobre estas questões. A contabilidade ambiental é uma delas. Trata-se de um tema que exige o desenvolvimento da ética e da responsabilidade socia...

  5. #NuevaFrontera: valor y misión de la biblioteca universitaria en las redes sociales online

    OpenAIRE

    Boyer Lagos, María; Gallego Santos, José Ignacio

    2013-01-01

    Transcurridos 18 meses desde el inicio de la participación de la Biblioteca UPM en las redes sociales online, parece llegada la ocasión para reflexionar -y, en el mejor espíritu 2.0, compartir la reflexión con colegas y seguidores- sobre el camino recorrido hasta ahora, y, en general, sobre esta nueva frontera bibliotecaria, repleta de retos tantos teóricos como prácticos, que es la adaptación de la misión y los valores de la biblioteca universitaria al entorno de la web social. Una de las...

  6. Produtos da linguagem: a hora e a vez de Macabéa

    OpenAIRE

    Goiamérico Felício Carneiro dos Santos

    2010-01-01

    Na ordem do mercado dos bens simbólicos, em A hora da Estrela, não estaria presentificada a enunciação discursiva da linguagem-produto? Não teríamos, nessa trama textual clariceana, uma linguagem não acessível, desafiadora, que fala de seus processos, de suas carências, driblando inúteis tentativas de decifrar, interpretar a vida e o destino de uma invisível Macabéa repleta de silêncios? Nessa obra, que mais claramente prenuncia a morte de uma estrela que explode sem experimentar o fulgor, a ...

  7. Temer o quê?: sair de casa ou ligar a TV?

    OpenAIRE

    Martins, Simone

    2007-01-01

    A sociedade ocidental atravessou diversas idades históricas, e em cada uma delas enfrentou seus medos. O temor ao Deus intolerante do Antigo Testamento, a Satã e sua sedução, às feiticeiras e sua heresia, aos estrangeiros e suas guerras. . . atualmente o medo instalado é da criminalidade. A luta do "bem contra o mal" se personifica aqui através das vítimas santificadas e dos bandidos cruéis - majoritariamente um grupo composto por membros das camadas populares. Histórias repletas de lágrimas ...

  8. First Record of Drosophila buzzatii (Patterson & Wheeler) (Diptera: Drosophilidae) Emerging from a Non-Cactus Host.

    Science.gov (United States)

    Fanara, J J; Soto, I M; Lipko, P; Hasson, E

    2016-06-01

    Drosophila buzzatii (Patterson & Wheeler), a typical cactophilic species of the repleta group, is registered for the first time emerging from Melon (Cucumis melo) in western Argentina. The analysis of inversion polymorphism and genetic diversity of mitochondrial cytochrome oxidase subunit I gene (mtCOI) provided additional evidence that corroborated the presence of a high proportion of D. buzzatii among the flies emerged from melon. This finding set the scenario for a broader range of possible hosts and host-related distribution and dispersion for this widespread species. PMID:26960546

  9. Gene duplication and adaptive evolution of digestive proteases in Drosophila arizonae female reproductive tracts.

    Directory of Open Access Journals (Sweden)

    Erin S Kelleher

    2007-08-01

    Full Text Available It frequently has been postulated that intersexual coevolution between the male ejaculate and the female reproductive tract is a driving force in the rapid evolution of reproductive proteins. The dearth of research on female tracts, however, presents a major obstacle to empirical tests of this hypothesis. Here, we employ a comparative EST approach to identify 241 candidate female reproductive proteins in Drosophila arizonae, a repleta group species in which physiological ejaculate-female coevolution has been documented. Thirty-one of these proteins exhibit elevated amino acid substitution rates, making them candidates for molecular coevolution with the male ejaculate. Strikingly, we also discovered 12 unique digestive proteases whose expression is specific to the D. arizonae lower female reproductive tract. These enzymes belong to classes most commonly found in the gastrointestinal tracts of a diverse array of organisms. We show that these proteases are associated with recent, lineage-specific gene duplications in the Drosophila repleta species group, and exhibit strong signatures of positive selection. Observation of adaptive evolution in several female reproductive tract proteins indicates they are active players in the evolution of reproductive tract interactions. Additionally, pervasive gene duplication, adaptive evolution, and rapid acquisition of a novel digestive function by the female reproductive tract points to a novel coevolutionary mechanism of ejaculate-female interaction.

  10. Chromosomal phylogeny of the Drosophila fasciola species subgroup revisited (Diptera, Drosophilidae

    Directory of Open Access Journals (Sweden)

    Nilda Maria Diniz

    2004-01-01

    Full Text Available The analysis of polytene chromosomes in 26 strains of seven species in the Drosophila fasciola subgroup, from several locations in Brazil, in addition to strains of two species belonging to the Drosophila mulleri subgroup (D. aldrichi and D. mulleri, enabled us to determine that the 3c inversion found in the latter species differ in one of its break points from that present in the species of the fasciola subgroup. Therefore, a change in the mulleri complex denomination from inversion 3c to inversion 3u is proposed. Accordingly, the fasciola subgroup is no longer a lesser phylogenetic part within the mulleri subgroup. Rather, it is directly related to the likely ancestor of the repleta group, called Primitive I. This information removes the main obstacle to considering the Drosophila fasciola subgroup as an ancestral group within the Drosophila repleta species group, according to the hypothesis of Throckmorton. Our data also support the conclusion that D. onca and D. carolinae are closely related species based on one new inversion in chromosome 4 (4f², in both species. D. fascioloides and D. ellisoni also form a pair of sister species based on the presence of fusions of chromosomes 2-4 and 3-5. D. rosinae is related only to the likely ancestor of the fasciola subgroup, where the 3c inversion was fixed.

  11. Control integrado de garrapatas en la ganadería bovina

    OpenAIRE

    Roger Iván Rodríguez-Vivas; José Alberto Rosado-Aguilar; Melina Maribel Ojeda-Chi; Luis Carlos Pérez-Cogollo; Iris Trinidad-Martínez; Manuel Emilio Bolio-González

    2014-01-01

    Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocando grandes pérdidas económicas en la producción bovina. El control de R. microplus se basa principalmente en el uso de ixodicidas; sin embargo, su uso irracional ha propiciado la aparición de garrapatas resistentes a las principales familias de ixodicidas. Esto hace necesario el desarrollo de alternativas de control...

  12. Dicty_cDB: CFH347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycddehqcvrkglgyecipkrltcetk kceasqvcimvngdaqcivppaaaaaeirinnfrfnrnsvqrnakpaqqqrsaqhakpaq hgkpaqhva Translated Amino Acid sequence...cvspprpdnncgdkycddehqcvrkglgyecipkrltcetk kceasqvcimvngdaqcivppaaaaaeirinnfrfnrns...e ovary cDNA, RIKEN full-length enriched library, clone:6620403D21, 3' end partial sequence. 48 0.16 1 AW728...Dp87; Flags: Precursor; 45 0.002 EU191620_1( EU191620 |pid:none) Rhipicephalus mic...roplus strain Moz... 45 0.002 EU352677_1( EU352677 |pid:none) Rhipicephalus microplus isolate Ca... 45 0.00

  13. Spatiotemporal Incidence of Acaracide Resistance among Outbreaks of Cattle Fever Ticks in the US

    Science.gov (United States)

    Cattle fever ticks, Rhipicephalus (Boophilus) spp, were eradicated from the U.S. but regularly make incursions along the border with Mexico. The USDA maintains a quarantine buffer zone with surveillance for stray Mexican cattle and inspection of herds in the counties along the Rio Grande. The year 2...

  14. 9 CFR 71.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Note: For Federal Register citations affecting § 71.1, see the List of CFR Sections Affected, which... description of any individual or group identification associated with the swine, the name of the swine... system. Tick infested. Infested with the ticks Boophilus annulatus (Margaropus annulatus),...

  15. Rationale for classical biological control of cattle fever ticks and proposed methods for field collection of natural enemies

    Science.gov (United States)

    Classical biological control using specialist parasitoids, predators and/or nematodes from the native ranges of cattle fever ticks Rhipicephalus microplus and Rhipicephalus annulatus could complement existing control strategies for this livestock pest in the transboundary region between Mexico and T...

  16. Epidemiology of ixodid ticks in cattle population of various agro-climatic zones of Punjab, India

    Institute of Scientific and Technical Information of China (English)

    Nirbhay Kumar Singh; Shitanshu Shekhar Rath

    2013-01-01

    Objective:To determine the epidemiology of ixodid ticks in bovines of different agro-climatic zones ofPunjab state,India.Methods:A total of4459 cattle of all age groups and sex were examined from eighteen districts of five major agro-climatic zones ofPunjab state, India.Results:The overall prevalence of ixodid ticks,Rhipicephalus microplus(R. microplus), Hyalomma anatolicum anatolicum(H. a. anatolicum) and mixed infestation were58.06%,50.16%, 11.34% and3.45%, respectively.Amongthe various agro-climatic zones highest prevalence rate ofR. microplus andH. a. anatolicumwere recorded in submountain undulating region(79.36%) and western region(20.40%), respectively indicating thatR. microplus prefers a hot and humid environment whereas, arid and semi arid conditions suit better forH. a. anatolicum.The overall prevalence of ixodid ticks was highest in monsoon season(83.74%), followed by summer(69.01%) and least in winters(31.64%) and a significant variation(P1year age group(55.02%) and the difference was statistically significant(P<0.01). Also a significantly higher(P<0.01) infestation rates of ixodid ticks was observed in males. Conclusions:The findings of the current study would provide a basis for evolving effective control strategy for the management of ticks in bovines of the region.

  17. The novel isoxazoline ectoparasiticide fluralaner: selective inhibition of arthropod γ-aminobutyric acid- and L-glutamate-gated chloride channels and insecticidal/acaricidal activity.

    Science.gov (United States)

    Gassel, Michael; Wolf, Christian; Noack, Sandra; Williams, Heike; Ilg, Thomas

    2014-02-01

    Isoxazolines are a novel class of parasiticides that are potent inhibitors of γ-aminobutyric acid (GABA)-gated chloride channels (GABACls) and L-glutamate-gated chloride channels (GluCls). In this study, the effects of the isoxazoline drug fluralaner on insect and acarid GABACl (RDL) and GluCl and its parasiticidal potency were investigated. We report the identification and cDNA cloning of Rhipicephalus (R.) microplus RDL and GluCl genes, and their functional expression in Xenopus laevis oocytes. The generation of six clonal HEK293 cell lines expressing Rhipicephalus microplus RDL and GluCl, Ctenocephalides felis RDL-A285 and RDL-S285, as well as Drosophila melanogaster RDLCl-A302 and RDL-S302, combined with the development of a membrane potential fluorescence dye assay allowed the comparison of ion channel inhibition by fluralaner with that of established insecticides addressing RDL and GluCl as targets. In these assays fluralaner was several orders of magnitude more potent than picrotoxinin and dieldrin, and performed 5-236 fold better than fipronil on the arthropod RDLs, while a rat GABACl remained unaffected. Comparative studies showed that R. microplus RDL is 52-fold more sensitive than R. microplus GluCl to fluralaner inhibition, confirming that the GABA-gated chloride channel is the primary target of this new parasiticide. In agreement with the superior RDL on-target activity, fluralaner outperformed dieldrin and fipronil in insecticidal screens on cat fleas (Ctenocephalides felis), yellow fever mosquito larvae (Aedes aegypti) and sheep blowfly larvae (Lucilia cuprina), as well as in acaricidal screens on cattle tick (R. microplus) adult females, brown dog tick (Rhipicephalus sanguineus) adult females and Ornithodoros moubata nymphs. These findings highlight the potential of fluralaner as a novel ectoparasiticide. PMID:24365472

  18. A metrópole moderna, o olhar surrealista: considerações benjaminianas

    Directory of Open Access Journals (Sweden)

    Vanessa Madrona Moreira Salles

    2011-04-01

    Full Text Available Walter Benjamin intenta apresentar a cidade, em sua multiplicidade e diversidade, como espaço de experiência sensorial e intelectual, local de encenação dos conflitos sociais e de transformações urbanísticas. Suas ruas são palco de circulação de mercadorias, repletas de enigmas; o lugar onde o sujeito autônomo, senhor de uma razão iluminista, perde-se em meio a uma labiríntica multidão – de pessoas, de objetos, de imagens -, e em que a experiência de rapidez, de anonimato pode ser realizada de modo mais radical do que em qualquer outro lugar. Desse modo, ler a cidade é ler um mosaico, e Benjamin retoma uma das mais profícuas leituras da metrópole urbana: a visada surrealista.

  19. Presentación

    OpenAIRE

    Ortega, Luis Mora

    2014-01-01

    Pese a recientes publicaciones, los estudios de geografía son aún escasos en nuestro país, y sobre Guayaquil, específicamente, es muy poco lo que se ha escrito. Por lo demás, la geografía es un campo del conocimiento mirado, por lo general, con cierto aire de aburrimiento, y su recuerdo trae a la memoria las tediosas horas de clase, repletas de nombres de montañas, ríos, metros de altitud, y demás datos que había que memorizar con esfuerzo, para luego olvidar. La geografía no goza de simpatía...

  20. La violencia simbólica en la interacción entre docentes y alumnos inmigrantes

    Directory of Open Access Journals (Sweden)

    Carlos Vecina Merchante

    2006-01-01

    Full Text Available Podemos considerar las representaciones sociales como una herramienta colectiva utilizada para dar sentido al comportamiento de los miembros de otros grupo, suelen estar repletas de estereotipos negativos que tienden a generalizar y a incidir en la opinión. Los factores que inciden en el origen y configuración son múltiples y complejos; este trabajo intenta crear un espacio para la reflexión sobre la existencia de representaciones sociales compartidas por la sociedad de la que los profesores son miembros y con la que comparten valores y visiones del exogrupo, esto puede dar lugar a dar un trato desigual a la hora de clasificar y organizar el trabajo en el aula.

  1. Comportamento do consumidor: procura de informação e intenção de compra online de seguro automovel - aplicação em portugal

    OpenAIRE

    Castro, Carla

    2012-01-01

    Doutoramento em Gestão Empresarial Aplicada/ Classificação: M31, M10, C39 A distribuição no setor segurador está repleta de desafios. Novas tendências de consumo, a internet e a utilização de distintos canais ao longo das etapas do processo de tomada de decisão de compra, têm um impacto relevante da decisão de compra e no processo de compra de seguro automóvel. A adoção de novos comportamentos pelo consumidor, o aumento dos “clientes híbridos” e a estratégia de distribuição ...

  2. Pseudoxantoma elástico perfurante periumbilical e periareolar Periumbilical and periareolar perforating pseudoxanthoma elasticum

    OpenAIRE

    Aline Lopes Bressan; Bárbara Nader Vasconcelos; Roberto Souto da Silva; Maria de Fátima G. Scotelaro Alves; Alexandre Carlos Gripp

    2010-01-01

    O pseudoxantoma elástico perfurante periumbilical (PEPP), ou elastose cálcica perfurante, é distúrbio raro e sua patogênese está associada a alteração da fibra elástica, tendo o trauma provável participação. Apresenta-se caso de paciente de 70 anos com quadro de máculas enegrecidas e pápulas encimadas por crostas na região periareolar e periumbilical há mais de dez anos. O exame histopatológico revelou fibras elásticas alteradas, repletas de cálcio, e formação de pertuito na derme com fibras ...

  3. Lygia Bojunga e a Literatura Infanto-juvenil: uma Crítica Lúdica e Abordagem à Realidade Social

    Directory of Open Access Journals (Sweden)

    Sirlene Cristófano

    2010-09-01

    Full Text Available A relação entre literatura e sociedade é uma questão importante na tradição da crítica literária brasileira, portanto não podemos deixar de destacar a fundamental responsabilidade que essa relação exerce na organização da formação ideológica de uma sociedade: a literatura como um compromisso social. A escritora contemporânea Lygia Bojunga constrói as suas narrativas para o público jovem, sempre utilizando a infância como tema principal. Para além disto, as suas obras são caracterizadas por uma marcante infracção dos limites entre realidade e fantasia, repletas de simbologia, o que poderá proporcionar à criança um caminho para a maturidade e para a busca da sua identidade. A escritora por meio de seus contos maravilhosos e realismo mágico eternizou estes valores, o que a tornou numa excelente representativa da literatura infanto-juvenil. Nas suas narrativas, repletas de agradáveis fantasias, que têm por fundamento elementos tomados do real, a autora debate os problemas sociais resultantes da ideologia dominante: a ditadura militar. Partindo deste ponto, este artigo pretende contextualizar Lygia Bojunga Nunes no seu tempo e no seu espaço literário, numa época política em que o Brasil vivia na ditadura, na qual a escritora empenhava-se na luta ideológica. O presente trabalho tem por objetivo reflectir sobre um dos temas importantes de uma de suas narrativas, A Bolsa Amarela, que trata dos problemas existentes nas relações humanas e que faculta uma crítica contundente, por meio de vasta simbologia à realidade social.

  4. Differences in tolerance to host cactus alkaloids in Drosophila koepferae and D. buzzatii.

    Science.gov (United States)

    Soto, Ignacio M; Carreira, Valeria P; Corio, Cristian; Padró, Julián; Soto, Eduardo M; Hasson, Esteban

    2014-01-01

    The evolution of cactophily in the genus Drosophila was a major ecological transition involving over a hundred species in the Americas that acquired the capacity to cope with a variety of toxic metabolites evolved as feeding deterrents in Cactaceae. D. buzzatii and D. koepferae are sibling cactophilic species in the D. repleta group. The former is mainly associated with the relatively toxic-free habitat offered by prickly pears (Opuntia sulphurea) and the latter has evolved the ability to use columnar cacti of the genera Trichocereus and Cereus that contain an array of alkaloid secondary compounds. We assessed the effects of cactus alkaloids on fitness-related traits and evaluated the ability of D. buzzatii and D. koepferae to exploit an artificial novel toxic host. Larvae of both species were raised in laboratory culture media to which we added increasing doses of an alkaloid fraction extracted from the columnar cactus T. terschekii. In addition, we evaluated performance on an artificial novel host by rearing larvae in a seminatural medium that combined the nutritional quality of O. sulphurea plus amounts of alkaloids found in fresh T. terschekii. Performance scores in each rearing treatment were calculated using an index that took into account viability, developmental time, and adult body size. Only D. buzzatii suffered the effects of increasing doses of alkaloids and the artificial host impaired viability in D. koepferae, but did not affect performance in D. buzzatii. These results provide the first direct evidence that alkaloids are key determinants of host plant use in these species. However, the results regarding the artificial novel host suggest that the effects of alkaloids on performance are not straightforward as D. koepferae was heavily affected. We discuss these results in the light of patterns of host plan evolution in the Drosophila repleta group. PMID:24520377

  5. A survey of free-living ixodid ticks on a commercial game farm in the Thabazimbi District, Limpopo Province, South Africa

    Directory of Open Access Journals (Sweden)

    B. Schroder

    2006-06-01

    Full Text Available Free-living stages of ticks on a commercial game farm in the Thabazimbi District, Limpopo Province, South Africa, were collected by drag-sampling with flannel strips during the period September 2003 to August 2004. A total of 5 tick species was collected from 4 sites. Boophilus decoloratus was the most abundant species, followed by Amblyomma hebraeum. Seasonal abundance of the ticks was quantified and an optimum time to implement control measures against the ticks is proposed.

  6. ECTOPARASITES IN GOATS AND SHEEPS IN THE TOWN OF MOSSORO, RIO GRANDE DO NORTE ECTOPARASITOS EM CAPRINOS E OVINOS NO MUNICÍPIO DE MOSSORÓ, RIO GRANDE DO NORTE

    Directory of Open Access Journals (Sweden)

    ana diogenes suassuna bezerra

    2010-04-01

    Full Text Available Goats and sheeps present an ectoparasite diversity that may result in considerable losses in these animals productivity. Fifteen agrarian reform settlements were visited, with the purpose of identifying ectoparasites in goats and sheeps, in which scraping, direct exams, and auricle exsudate collections were carried out. From the 494 examined goats, 89.87% had ectoparasites, as well as 232 sheeps, 76.72%. The arthropods identified in the goats were: Bovicola caprae (80.76%, Rhipicephalus microplus (1.01%, Cochliomyia hominivorax larvae (0.6%, Psoroptes cuniculi (0.4%, and Ctenocephalides felis (3.23%, Amblyomma parvum (1.01% and Linognathus stenopsis (0.2% which were described for the first time in Brazilian northeast. Mixed parasitism of B. caprae with R. microplus (0.46% and P. cuniculi with B. caprae (0.23% was also identified. In sheeps, B. ovis (74.5%, R. microplus (0.86%, C. hominivorax larvae (0.43% and A. parvum (0.43% were the ones registered for the first time, in this species, in Brazilian northeast, besides the association of B. ovis with R. microplus (0.56%. There was no association between gender and age (P>0.05. The development of studies to evaluate the ectoparasite importance as a limiting factor to animal production becomes important. 

    KEY WORDS: Goats, ectoparasite, sheeps.

    Caprinos e ovinos apresentam uma diversidade de ectoparasitos que podem resultar perdas consideráveis na produtividade desses animais. Visitaram-se quinze assentamentos de reforma agrária, com o objetivo de identificar ectoparasitos de caprinos e ovinos, procedendo-se à realização de raspados, exames diretos e coletas de exsudato do pavilhão auricular. Dos 494 caprinos examinados, 89,87% apresentaram ectoparasitos, e dos 232 ovinos, 76,72%. Os artrópodes identificados em caprinos foram: Bovicola caprae (80,76%, Rhipicephalus microplus (1,01%, larvas de Cochliomyia hominivorax (0,6%, Psoroptes cuniculi (0,4%, além de

  7. Transmembrane proteins--Mining the cattle tick transcriptome.

    Science.gov (United States)

    Richards, Sabine A; Stutzer, Christian; Bosman, Anna-Mari; Maritz-Olivier, Christine

    2015-09-01

    Managing the spread and load of pathogen-transmitting ticks is an important task worldwide. The cattle tick, Rhipicephalus microplus, not only impacts the economy through losses in dairy and meat production, but also raises concerns for human health in regards to the potential of certain transmitted pathogens becoming zoonotic. However, novel strategies to control R. microplus are hindered by lack of understanding tick biology and the discovery of suitable vaccine or acaricide targets. The importance of transmembrane proteins as vaccine targets are well known, as is the case in tick vaccines with Bm86 as antigen. In this study, we describe the localization and functional annotation of 878 putative transmembrane proteins. Thirty proteins could be confirmed in the R. microplus gut using LC-MS/MS analysis and their roles in tick biology are discussed. To the best of our knowledge, 19 targets have not been reported before in any proteomics study in various tick species and the possibility of using the identified proteins as targets for tick control are discussed. Although tissue expression of identified putative proteins through expansive proteomics is necessary, this study demonstrates the possibility of using bioinformatics for the identification of targets for further evaluation in tick control strategies. PMID:26096851

  8. Design of the ATAQ peptide and its evaluation as an immunogen to develop a Rhipicephalus vaccine.

    Science.gov (United States)

    Aguirre, André de Abreu Rangel; Lobo, Francisco Pereira; Cunha, Rodrigo Casquero; Garcia, Marcos Valério; Andreotti, Renato

    2016-05-15

    Tick infestation may cause several problems including affecting domestic animal health and reducing the production of meat and milk, among others. Resistance to several classes of acaricides have been reported, forcing researchers to search for alternative measures, such as vaccines against ticks, to ensure tick control while having no or at least low negative impacts on the environment and public health. However, the current commercially available vaccines in different strains of Rhipicephalus microplus are reported to be of low efficacy. Fortunately, reverse vaccinology approaches have shown positive results in the new generation of vaccines. On this basis, a synthetic peptide from the ATAQ protein, which is present in the gut and Malpighi tubes of R. microplus, was synthesized. The ATAQ proteins were isolated, characterized and sequenced from several species of the genus Rhipicephalus. The alignment showed 93.3% identity among DNA sequences of ATAQs from these species. Because of this, immunization trials with this peptide were conducted on mice, rabbits and cattle to evaluate the humoral immune response and the efficacy against Rhipicephalus sanguineus in addition to R. microplus. Based on recent results, we conclude that reverse vaccinology is a promising approach because it is more accurate and faster than conventional methods in the detection of potential antigens to use in anti-tick vaccines. It is not only applicable against R. microplus but also against tick species that play important roles in spreading other diseases. ATAQ proteins should be considered as the antigen in new trials to develop a multi-antigenic vaccine. Although these peptides behave as hapten and are not able to be recognized by the immune system on its own, using carriers and adjuvants helps its presentation and induces strong immune responses. Furthermore, an efficiency of 35% reduction in overall life cycle parameters was reported for R. microplus (98% for ELISA responder animals) and

  9. Characterization of ribosomal DNA (rDNA in Drosophila arizonae

    Directory of Open Access Journals (Sweden)

    Francisco Javier Tovar

    2000-06-01

    Full Text Available Ribosomal DNA (rDNA is a multigenic family composed of one or more clusters of repeating units (RU. Each unit consists of highly conserved sequences codifying 18S, 5.8S and 28S rRNA genes intercalated with poorly conserved regulatory sequences between species. In this work, we analyzed the rDNA of Drosophila arizonae, a member of the mulleri complex (Repleta group. Using genomic restriction patterns, cloning and mapping of some representative rDNA fragments, we were able to construct a representative restriction map. RU in this species are 13.5-14 kb long, restriction sites are completely conserved compared with other drosophilids and the rDNA has an R1 retrotransposable element in some RU. We were unable to detect R2 elements in this species.O DNA ribossômico (rDNA é uma família multigênica composta de um ou mais aglomerados de unidades de repetição (RU. Cada unidade consiste de seqüências altamente conservadas que codificam os rRNAs 18S, 5.8S e 28S, intercaladas com seqüências regulatórias pouco conservadas entre as espécies. Neste trabalho analisamos o rDNA de Drosophila arizonae, um membro do complexo mulleri (grupo Repleta. Usando padrões de restrição genômicos, clonagem e mapeamento de alguns fragmentos de rDNA representativos, estabelecemos um mapa de restrição do rDNA representativo desta espécie. Neste drosofilídeo, a RU tem um tamanho médio de 13.5-14 kb e os sítios de restrição estão completamente conservados com relação a outras drosófilas. Além disto, este rDNA possui um elemento transponível tipo R1 presente em algumas unidades. Neste trabalho não tivemos evidências da presença de elementos R2 no rDNA desta espécie.

  10. La función ideológica de la música en el cine español del franquismo

    Directory of Open Access Journals (Sweden)

    Virginia Sánchez Rodríguez

    2015-01-01

    Full Text Available Viridiana (1961, Luis Buñuel es una de las películas más célebres de la filmografía española del franquismo (1939-1975. Más allá de aspectos formales, la cinta está repleta de numerosas críticas sociopolíticas y religiosas en clave musical de una forma tan inteligente que lograron superar la censura. De acuerdo con el interés del componente ideológico de la música, en el presente estudio proponemos un análisis formal y semántico de su Banda Sonora Musical. Para llevar a cabo esta investigación utilizaremos una metodología basada en el análisis músico-audiovisual, atendiendo a la diversidad estilística –música sacra y música popular– y comprendiendo la evolución musical de la BSM como un reflejo de la propia transformación de Viridiana, la protagonista.

  11. Crítica social e idéias médicas nos excessos do desejo: uma análise dos "romances para homens" de finais do século XIX e início do XX Social criticism and medical ideas on desires' excesses: a study of "novels for men" from late nineteenth to early twentieth century

    Directory of Open Access Journals (Sweden)

    Alessandra El Far

    2007-06-01

    Full Text Available Este artigo procura analisar a produção literária pornográfica desde a segunda metade do século XIX até o início do XX no Brasil. Também conhecidos como "leitura para homens" ou "romances para homens", esses enredos alcançaram uma repercussão singular naquele período. Se, em um primeiro momento, essas narrativas, repletas de fantasias e desejos, tratavam de questões sociais e políticas, com a chegada do novo século, de modo evidente, elas passaram a estabelecer um estreito diálogo com as teorias médicas e científicas da época.This article analyses the pornographic literature from the second half of the nineteenth century until the beginning of the twentieth century in Brazil. Also known as "reading for men" or "novels for men", these plots reached a singular repercussion at the time. If at first these stories, full of fantasies and desires, talked about both social and political issues, with the coming of the new century they clearly started to establish a close dialogue with current medical and scientific theories.

  12. A COMIDA E A SOCIABILIDADE NA CULTURA POMERANA

    Directory of Open Access Journals (Sweden)

    Adriele Schmidt

    2015-12-01

    Full Text Available Este artigo objetiva identificar as comidas de origem pomerana e as tradições a elas associadas, explorando o processo de construção continuada das tradições culinárias nos rituais, nas festas e no cotidiano dos pomeranos. Trata-se de uma etnografia realizada em duas comunidades rurais do estado do Espírito Santo - Brasil. As comidas típicas pomeranas e as tradições associadas à culinária local estão repletas de significados e podem ser consideradas como uma linguagem que fala sobre família, relações sociais, trabalho, gênero e religião. A reciprocidade, troca e doações de comida são muito presentes no cotidiano e nos rituais pomeranos, envolvendo não só a comida, mas também sementes e até o empréstimo de utensílios de cozinha para a organização das festividades. Nesse sentido, nas comunidades pomeranas estudadas, além de alimentar o corpo físico, a comida alimenta o corpo social, amalgamando as relações sociais e afetivas.

  13. "La ambigüedad, una forma de evidencia" en el "Prólogo general de los cuentos de Canterbury" de Geoffrey Chaucer

    Directory of Open Access Journals (Sweden)

    Antonio PRIETO MARTÍNEZ

    2009-11-01

    Full Text Available La capacidad lírica de Chaucer en los Cuentos de Canterbury no se deja esperar. Los primeros versos del Prólogo General (Whan that April in hir corages, versos 1-11 son como una carta de presentación del poeta, que quiere dejar constancia de su modo de hacer, por una parte, y por otra, de su actitud de renovación con respecto a obras anteriores. Porque parece que Chaucer se hubiese sentado ante su mesa de trabajo con el mismo espíritu vivificante que Abril ha transmitido a Marzo, con la misma fuerza con la que Céfiro anima a la naturaleza, dispuesto a engendrar una obra nueva, repleta de vigor y de alegría. James Winny comparte esta idea cuando dice que «The natural forces which bring warmth and moisture to the earth, encouraging growth and fertility, stand in a direct relationship with the powerful impulse working upon the poet».

  14. A BAC-based physical map of the Drosophila buzzatii genome

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, Josefa; Nefedov, Michael; Bosdet, Ian; Casals, Ferran; Calvete, Oriol; Delprat, Alejandra; Shin, Heesun; Chiu, Readman; Mathewson, Carrie; Wye, Natasja; Hoskins, Roger A.; Schein, JacquelineE.; de Jong, Pieter; Ruiz, Alfredo

    2005-03-18

    Large-insert genomic libraries facilitate cloning of large genomic regions, allow the construction of clone-based physical maps and provide useful resources for sequencing entire genomes. Drosophilabuzzatii is a representative species of the repleta group in the Drosophila subgenus, which is being widely used as a model in studies of genome evolution, ecological adaptation and speciation. We constructed a Bacterial Artificial Chromosome (BAC) genomic library of D. buzzatii using the shuttle vector pTARBAC2.1. The library comprises 18,353 clones with an average insert size of 152 kb and a {approx}18X expected representation of the D. buzzatii euchromatic genome. We screened the entire library with six euchromatic gene probes and estimated the actual genome representation to be {approx}23X. In addition, we fingerprinted by restriction digestion and agarose gel electrophoresis a sample of 9,555 clones, and assembled them using Finger Printed Contigs (FPC) software and manual editing into 345 contigs (mean of 26 clones per contig) and 670singletons. Finally, we anchored 181 large contigs (containing 7,788clones) to the D. buzzatii salivary gland polytene chromosomes by in situ hybridization of 427 representative clones. The BAC library and a database with all the information regarding the high coverage BAC-based physical map described in this paper are available to the research community.

  15. Effect of scale on large-scale mutations

    CERN Document Server

    Berestycki, Nathanaël

    2011-01-01

    We consider the process of random transpositions of $n$ particles on a circle, where transpositions only occur if the spacing is at most some number $L = L(n)$. We look in particular at the evolution of the parsimony distance used by biologists in the context of comparative genomics. We show that this process exhibits the mean-field behaviour described by the first author and Durrett in 2006, if and only if L(n) tends to infinity, no matter how slowly. The proof relies on a comparison with a suitable spatial random graph and branching random walks. Interestingly, this random graph gets a giant component when $L \\gg (\\log n)^2$ (when the mean degree exceeds 1) but not when $L \\ll \\log n.$ Thus there are regimes where the random graph has no giant component but the random walk nevertheless has a phase transition. We discuss possible relevance of these results for a dataset coming from D. repleta and D. melanogaster and for the typical length of chromosomal inversions.

  16. Pseudoxantoma elástico perfurante periumbilical e periareolar Periumbilical and periareolar perforating pseudoxanthoma elasticum

    Directory of Open Access Journals (Sweden)

    Aline Lopes Bressan

    2010-10-01

    Full Text Available O pseudoxantoma elástico perfurante periumbilical (PEPP, ou elastose cálcica perfurante, é distúrbio raro e sua patogênese está associada a alteração da fibra elástica, tendo o trauma provável participação. Apresenta-se caso de paciente de 70 anos com quadro de máculas enegrecidas e pápulas encimadas por crostas na região periareolar e periumbilical há mais de dez anos. O exame histopatológico revelou fibras elásticas alteradas, repletas de cálcio, e formação de pertuito na derme com fibras elásticas degradadas no seu interior. O caso descrito corresponde ao PEPP, que nesta paciente também acomete área periareolar bilateralmente.The periumbilical perforating pseudoxanthoma elasticum or perforating calcific elastosis is a rare disorder and its pathogenesis is associated with the alteration of elastic fibers, which may probably result from trauma. We present the case of a 70-year-old woman with long-time blackish maculas and keratotic surface papules on the periareolar and periumbilical regions. The histopathological examination revealed altered elastic fibers, replete with calcium and formation of a path in the dermis with elastic fibers degraded in their interior, confirming the clinical diagnosis.

  17. Produtos da linguagem: a hora e a vez de Macabéa

    Directory of Open Access Journals (Sweden)

    Goiamérico Felício Carneiro dos Santos

    2010-01-01

    Full Text Available Na ordem do mercado dos bens simbólicos, em A hora da Estrela, não estaria presentificada a enunciação discursiva da linguagem-produto? Não teríamos, nessa trama textual clariceana, uma linguagem não acessível, desafiadora, que fala de seus processos, de suas carências, driblando inúteis tentativas de decifrar, interpretar a vida e o destino de uma invisível Macabéa repleta de silêncios? Nessa obra, que mais claramente prenuncia a morte de uma estrela que explode sem experimentar o fulgor, a intensidade da vida plena, não teríamos a representação de uma linguagem em crise por ser autoconsciente de sua precariedade? Nessa enunciação romanesca clariceana, a linguagem-produto se instaura, qual uma esfinge devoradora, apontando para os abismos dos nossos macabeicos destinos.

  18. Temer o quê?: sair de casa ou ligar a TV?

    Directory of Open Access Journals (Sweden)

    Martins, Simone

    2007-01-01

    Full Text Available A sociedade ocidental atravessou diversas idades históricas, e em cada uma delas enfrentou seus medos. O temor ao Deus intolerante do Antigo Testamento, a Satã e sua sedução, às feiticeiras e sua heresia, aos estrangeiros e suas guerras. . . atualmente o medo instalado é da criminalidade. A luta do "bem contra o mal" se personifica aqui através das vítimas santificadas e dos bandidos cruéis - majoritariamente um grupo composto por membros das camadas populares. Histórias repletas de lágrimas e sangue fazem dos noticiários um momento de entretenimento, um misto de atração e repulsa que mantém os olhos atentos. Numa conjunção de fatores, a cultura do medo se instala entre os grupos, mantendo a estrutura social estabelecida pelo discurso em prol da lei e da ordem. O temor é da sociedade criada por aqueles que mantêm essa estrutura; teme-se cada vez a própria criação.

  19. Smallholder pig production

    DEFF Research Database (Denmark)

    Braae, Uffe Christian; Ngowi, Helena; Johansen, Maria Vang

    2013-01-01

    pigs (2%) were found infested with Sarcoptes scabiei var. suis. Ticks found belonged to four genera; Amblyomma spp., Rhipicephalus spp., Haemaphysalis spp., and Boophilus spp. The prevalence of hard ticks among the free-range pigs was 50%. Ectoparasites were more prevalent in the free-range system...... although highly prevalent within both production systems. Keeping pigs in a free-range system and contact with neighbouring pigs were main risk factors for the presence of ectoparasites. Confinement was highly effective as a preventive tool against hard ticks....

  20. Protección contra babesiosis con una vacuna mixta de B. bovis y B. bigemina derivada de cultivo in vitro en una confrontación de campo. II Inmunización en una área endémica

    OpenAIRE

    Germinal Jorge Cantó Alarcón; Edmundo Enrique Rojas Ramírez; Jesús Antonio Álvarez Martínez; Juan Alberto Ramos Aragón; Juan Joel Mosqueda Gualito; Carlos Agustín Vega y Murguía; Julio Vicente Figueroa Millán

    2003-01-01

    Se evaluó la protección de un inmunógeno bivalente de B. bovis y B. bigemina derivado de cultivo in vitro. Se utilizaron 20 toretes Bos taurus mayores de 18 meses provenientes de una área libre de garrapatas Boophilus, y se trasladaron a una zona endémica, formándose en forma aleatoria dos grupos de 10 animales. Una semana posterior a su llegada, 10 de los animales se vacunaron por vía intramuscular a una dosis de 1 x 107 eritrocitos infectados de cada especie del parásito, los 10 restantes (...

  1. Rickettsia sp. strain colombianensi (Rickettsiales: Rickettsiaceae): a new proposed Rickettsia detected in Amblyomma dissimile (Acari: Ixodidae) from iguanas and free-living larvae ticks from vegetation.

    Science.gov (United States)

    Miranda, Jorge; Portillo, Aránzazu; Oteo, José A; Mattar, Salim

    2012-07-01

    From January to December 2009, 55 Amblyomma dissimile (Koch) ticks removed from iguanas in the municipality of Monteria and 3,114 ticks [458 Amblyomma sp. larvae, 2,636 Rhipicephalus microplus (Canestrini) larvae and 20 Amblyomma sp. nymphs] collected over vegetation in Los Cordobas were included in the study. The ticks were pooled into groups from which DNA was extracted. For initial screening of Rickettsia sp., each pool was analyzed by gltA real-time polymerase chain reaction (PCR). Positive pools were further studied using gltA, ompA, and ompB conventional PCR assays. Sequencing and phylogenetic analysis were also conducted. Rickettsial DNA was found in 28 pools of ticks (16 A. dissimile pools and 12 free-living larvae pools) out of 113 (24.7%) using real-time PCR. The same 28 pools were also positive using conventional PCR assays aimed to amplify gltA, ompA, and ompB. For each gene analyzed, PCR products obtained from 4/28 pools (two pools of A. dissimile, one pool of Amblyomma sp. larvae and one pool of Rh. microplus larvae) were randomly chosen and sequenced twice. Nucleotide sequences generated were identical to each other for each of the rickettsial genes gltA, ompA, and ompB, and showed 99.4, 95.6, and 96.4% identity with those of Rickettsia tamurae. They were deposited in the GenBank database under accession numbers JF905456, JF905458, and JF905457, respectively. In conclusion, we present the first molecular evidence of a novel Rickettsia (Rickettsia sp. strain Colombianensi) infecting A. dissimile ticks collected from iguanas, and also Rh. microplus and unspeciated Amblyomma larvae from vegetation in Colombia. PMID:22897060

  2. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Science.gov (United States)

    Coumou, Jeroen; Wagemakers, Alex; Trentelman, Jos J; Nijhof, Ard M; Hovius, Joppe W

    2014-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus. PMID:25919587

  3. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Directory of Open Access Journals (Sweden)

    Jeroen Coumou

    Full Text Available Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  4. Spread of parasites transported with their hosts: case study of two species of cattle tick.

    Science.gov (United States)

    Barré, N; Uilenberg, G

    2010-04-01

    Like all parasites, ticks can be spread easily along with their hosts. Ticks are obligate parasites of vertebrates, to which they attach themselves for varying periods of time, and are well-adapted to this mode of transport. Once the transport stage is complete and they have detached at destination, they are also able to wait several months for the arrival of a new host on which they will continue their life cycle. This leads to the establishment of a secondary tick population. Two tropical cattle tick species, Rhipicephalus microplus and Amblyomma variegatum, have perfected this strategy of colonisation and occupation of favourable zones. Rhipicephalus microplus, which originated from South and Southeast Asia, is highly specific for ungulates, and thanks to cattle movements it has spread throughout the tropical belt, apart from the remotest areas. Amblyomma variegatum, which originated in Africa, was transported to Madagascar and the Mascarene Islands, as well as to the West Indies, during the time of the Atlantic triangular trade. These two ticks are vectors of particularly serious cattle diseases: babesiosis and anaplasmosis in the case of R. microplus, and heartwater (cowdriosis) in the case of A. variegatum. Anticipated climate changes are likely to modify the potential geographical range of these two parasite species and numerous others. Even now there are still many areas of the Americas, Asia and Oceania into which A. variegatum has not yet spread, but which it would find favourable. It could be spread not only by the transport of cattle, but also by the migration of some of its other hosts, such as birds. Surveillance--and know-how--is needed to identify these parasites when they first appear and to rapidly contain new outbreaks. Efforts should be made to raise the awareness of livestock professionals about the risks of transporting cattle. Regulations should be implemented and precautions taken to avoid such artificial expansion of the range of ticks and

  5. SFTS Virus in Ticks in an Endemic Area of China

    OpenAIRE

    Wang, Shiwen; Li, Jiandong; Niu, Guoyu; Wang, Xianjun; Ding, Shujun; Jiang, Xiaolin; Li, Chuan; Zhang, Quanfu; Liang, Mifang; BI, ZHENQIANG; Li, Dexin

    2015-01-01

    In total, 3,145 ticks of the species Haemaphysalis longicornis (3,048; 96.9%), R. microplus (82; 2.6%), H. campanulata (9; 0.3%), and Dermacentor sinicus (5; 0.2%) were collected from animals and vegetation at Yantai in Shandong Province. Both adult and immature ticks were obtained, and all ticks collected from vegetation were unfed. Eggs were obtained from 22 blood-fed female ticks through maintenance at room temperature after collection. Severe fever with thrombocytopenia syndrome virus (SF...

  6. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition

    OpenAIRE

    Jeroen Coumou; Alex Wagemakers; Trentelman, Jos J.; Nijhof, Ard M; Hovius, Joppe W.

    2015-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccin...

  7. Epidemiología de la babesiosis de los bovinos causada por Babesia bigemina (Smith y Kilborne, 1893) en el sudoeste de la provincia del Chaco

    OpenAIRE

    Mastropaolo, Mariano

    2014-01-01

    Babesia bigemina es uno de los agentes etiológicos de la babesiosis de los bovinos y en Argentina es transmitida solamente por ninfas y adultos de la garrapata Rhipicephalus (B.) microplus. Los objetivos de este trabajo fueron evaluar el estatus epidemiológico y factores asociados para B. bigemina en rodeos del sudoeste de la provincia del Chaco y evaluar la incidencia de infección y la proporción de garrapatas infectadas en dos establecimientos ganaderos (AT y VA) de la región. Se determinó ...

  8. Current Status of Tick Fauna in North of Iran

    Directory of Open Access Journals (Sweden)

    P Shayan

    2007-04-01

    Full Text Available Background: The distribution and ecological preferences of ticks of domestic animals in North of Iran were studied four times a year from 2002 to 2005. Methods: A total of 1720 tick specimens were collected from cattle, sheep and goats from different localities of Caspian Sea areas consisting of Guilan, Mazandaran, Golestan and Ardebil provinces, Iran. Results: Fourteen tick species were identified as Hyalomma anatolicum anatolicum (5.23%, H.marginatum (20.34%, H.detritum (3.48%, Haemaphysalis punctata (12.79%, Haem. Parva (0.58%, Haem.concinna (0.58%, Haem.choldokovsky (6.97%, Ixodes ricinus (2.32%, Rhipicephalus sanguineus (19.76%, Rh.bursa (4.65%, Boophilus annulatus (9.88%, Dermacentor niveus (6.39%, D. marginatus (1.74% and Ornithodoros lahorensis (5.23%. Both Dermacentor and Ornithodoros were found only in Ardebil with cold climatic conditions and high altitude. The only ticks, which were found in forest area, were Boophilus annulatus and Ixodes ricinus. Conclusion: The veterinary and public health importance of the above species should be emphasized.

  9. Identification of Ixodide ticks of cattle in and around Hararamaya district, Eastern Ethiopia

    Directory of Open Access Journals (Sweden)

    S.A. Kassa

    2012-08-01

    Full Text Available We conducted a survey to determine the prevalence of Ixodide ticks, their predilection sites and relation to breed, sex, and age group of animals. A total of 560 animals were examined of which 186 (33.21% found infested with one or more ticks. Among the total 1446 ticks collected three generas; Amblyomma, Boophilus, and Rhipicephalus, and five species identified. The relative prevalence of each species was Amblyomma variegatum (38.87%, Amblyomma coherence (8.30%, Boophilus decoloratus (31.54%, Rhipicephalus pulchellus (6.64%, and Rhipicephalus evertsi evertsi (14.66%. A.variegatum and A. coherence shows higher preference to axial, scrotum/ udder, and groin & belly. B. decoloratus species were found prominently on the back & neck. R. evertsi evertsi and R. pulchelus showed high preference to the under tail and peri-anal &vulva regions of the body. The male to female sex ratio of the collected ticks was found 1.96:1, showing higher proportion of male than their counter parts. The prevalence of tick infestation was found significantly higher (P0.05.

  10. Ashkan Ghasemi Moghaddam1, Mozafar Razavi Seyed1, Mehrshad Rasouli1, Sajad Hosseinzade1, Mohammad Mehdi Darvishi2, Arash Rakhshanpour3, Mohammad Taghi Rahimi4,5

    Institute of Scientific and Technical Information of China (English)

    Ashkan Ghasemi Moghaddam; Mozafar Razavi Seyed; Mehrshad Rasouli; Sajad Hosseinzade; Mohammad Mehdi Darvishi; Arash Rakhshanpour; Mohammad Taghi Rahimi

    2014-01-01

    Objective:To survey the prevalence of cattle ticks in Nur County and prepare a list of tick fauna in this district. Methods: This investigation was carried out on 150 head of cattle ticks of rural areas of Nur city which is located in Mazandaran province during spring and summer seasons of 2011. The collected ticks were identified using light microscope and available systematic keys. Results:A total number of 1 563 ticks were isolated from examined cattle and their genus and numbers including:Ixodes ricinus 51%(111 male and 691 female) and Boophilus annulatus 49%(83 male and 678 female), respectively. Conclusions:Results of the current investigation indicate the presence of two species of acarine ectoparasites which have potential health risk Ixodes ricinus and Boophilus annulatus. More studies are required to increase our data concerning ticks and other ectopreasites of ruminants in other areas of Mazandaran province and should be noted to their ability in transmission of infectious agents.

  11. Survey of tick species parasiting domestic ruminants in Ghaemshahr county, Mazandaran province, Iran

    Institute of Scientific and Technical Information of China (English)

    Hosseini Vasoukolaei Nasibeh; Telmadarraiy Zakkyeh; Vatandoost Hassan; Yaghoobi Ershadi Mohammad Reza; Hosseini Vasoukolaei Morteza; Oshaghi Mohammad Ali

    2010-01-01

    Objective:To determine the tick species parasitizing domestic ruminants in Ghaemshahr county in Mazandaran, a Caspian province in the north of Iran.Methods:About361 sheep, 54 goats and10cattle of18 herds in several villages in Ghaemshahr were inspected for tick infestation. Separated ticks were preserved in70% alcohol and identified.Results:About323 ticks (207female,116 male) were collected, the occurrence of ticks on sheep, goats and cattle were28.3%, 22.2% and20.0%respectively. The mean number of ticks on each animal was low (3-5ticks per animal).Rhipicephalus sanguineus, Rhipicephalus bursa, Ixodes ricinus, Boophilus annulatus, Haemaphysalis punctata andHaemaphysalis numidiana were the tick species we found.Rhipicephalus sanguineus were the most abundant species in the study area. The largest number of ticks were generally present from April to July, mostly in animal ears and tails. Ixodes, Boophilus andHaemaphysalis occurred in mountainous areas of Ghaemshahr, whereas Rhipicephalus were present in both mountains and plains of the study area.Conclusions: The result of this study is a survey of tick species from domestic animals in Iran and implication of possible prevention measures for diseases transmitted by ticks.

  12. Hard ticks (Acari: Ixodidae) of livestock in Nicaragua, with notes about distribution.

    Science.gov (United States)

    Düttmann, Christiane; Flores, Byron; Kadoch Z, Nathaniel; Bermúdez C, Sergio

    2016-09-01

    We document the species of ticks that parasitize livestock in Nicaragua. The study was based on tick collection on cattle and horses from 437 farms in nine departments. Of 4841 animals examined (4481 cows and 360 horses), 3299 were parasitized, which represent 68 % of the bovines and 67 % of the equines in study: 59 cows and 25 horses were parasitized by more than one species. In addition, 280 specimens of the entomological museum in León were examined. The ticks found on cattle were Rhipicephalus microplus (75.2 % of the ticks collected), Amblyomma mixtum (20.8 %), A. parvum (2.6 %), A. tenellum (0.7 %), A. maculatum (0.7 %). While the ticks collected from the horses were: Dermacentor nitens (41.5 %), A. mixtum (31.7 %), R. microplus (13.8 %), A. parvum (6.5 %), A. tenellum (3.3 %), D. dissimilis (2.4 %) and A. maculatum (0.8 %). PMID:27392740

  13. Cattle tick vaccines: many candidate antigens, but will a commercially viable product emerge?

    Science.gov (United States)

    Guerrero, Felix D; Miller, Robert J; Pérez de León, Adalberto A

    2012-05-01

    The cattle tick, Rhipicephalus microplus, is arguably the world's most economically important external parasite of cattle. Sustainable cattle tick control strategies are required to maximise the productivity of cattle in both large production operations and small family farms. Commercially available synthetic acaricides are commonly used in control and eradication programs, but indiscriminate practices in their application have resulted in the rapid evolution of resistance among populations in tropical and subtropical regions where the invasive R. microplus thrives. The need for novel technologies that could be used alone or in combination with commercially available synthetic acaricides is driving a resurgence of cattle tick vaccine discovery research efforts by various groups globally. The aim is to deliver a next-generation vaccine that has an improved efficacy profile over the existing Bm86-based cattle tick vaccine product. We present a short review of these projects and offer our opinion on what constitutes a good target antigen and vaccine, and what might influence the market success of candidate vaccines. The previous experience with Bm86-based vaccines offers perspective on marketing and producer acceptance aspects that a next-generation cattle tick vaccine product must meet for successful commercialisation. PMID:22549026

  14. Carrapatos (Acari: Ixodidae em mamíferos silvestres do Parque Nacional da Serra da Canastra e arredores, Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Thiago Fernandes Martins

    2015-02-01

    Full Text Available O presente estudo relata ixodídeos em mamíferos silvestres no Parque Nacional da Serra da Canastra e arredores, no estado de Minas Gerais, Brasil. De julho de 2005 a junho de 2014, foram coletadas 58 larvas, 133 ninfas e 43 carrapatos adultos em 40 eventos de captura de mamíferos de vida livre do Parque e arredores. Nos hospedeiros da ordem Carnivora, foram identificados Amblyomma ovale Koch, 1844, Amblyomma sculptum Berlese, 1888, Amblyomma tigrinum Koch, 1844, Dermacentor nitens Neumann, 1897 e Rhipicephalus microplus (Canestrini, 1888. Em hospedeiros da ordem Xenarthra, foram identificados espécimes de Amblyomma pseudoconcolor Aragão, 1908 e A. sculptum. Este estudo relata os primeiros registros dos ixodídeos D. nitens e R. microplus parasitando Lycalopex vetulus, e A. ovale em Leopardus tigrinus no país. Os achados do presente estudo indicam a proximidade entre os animais domésticos e silvestres causada pela expansão agropecuária no território brasileiro

  15. Sobre subjetividades diaspóricas e ardis cotidianos : a cidadania cultural na favela da Candelária

    Directory of Open Access Journals (Sweden)

    João Maia

    2009-09-01

    Full Text Available Resumo O objetivo deste artigo é abordar a diáspora contemporânea, que diz respeito não apenas ao trânsito migratório entre países, mas também ao movimento febril, à estética diaspórica que torna a cultura de nossos dias irremediavelmente impura e híbrida, repleta de um permanente deslize de significados, em permanente mutação. O foco recai sobre a interface entre a memória, a cidadania e o papel dos líderes na interpretação dos valores culturais na comunicação. Para explorar tais objetivos, realizamos, desde 2003, pesquisa de observação participante na Candelária, uma sublocalidade do Morro da Mangueira, no Rio de Janeiro. O percurso de análise desenvolveu-se com base na concepção teórica de entender a cultura não como semiose ou apropriação, mas como produção. O trabalho explora a inserção da ONG Meninas e Mulheres do Morro, aspectos do consumo e do multiculturalismo na metrópole comunicacional. Palavras-chave: Comunicação; consumo; metrópole; cidadania. Resumen El artículo tiene por objetivo abordar la diáspora contemporánea que está relacionada no solo con el tránsito migratorio entre países, sin también con el movimiento febril, con la estética diaspórica que convierte la cultura de nuestros días en una cosa irremediablemente impura e híbrida, repleta de un permanente desliz de significados, en permanente mutación. Focaliza la interfaz entre la memoria, la ciudadanía y el papel de los líderes en la interpretación de los valores culturales en la comunicación. Para alcanzar estos objetivos, realizamos, desde 2003, una investigación de observación participante en la Candelária, una sublocalidad del Morro da Mangueira, en Río de Janeiro. El camino del análisis se desarrolló a partir de la concepción teórica que entiende la cultura como producción y no como semiosis o apropiación. El trabajo analiza la inserción de la ONG Meninas e Mulheres do Morro, aspectos del consumo y del

  16. Phylogenetic patterns of geographical and ecological diversification in the subgenus Drosophila.

    Directory of Open Access Journals (Sweden)

    Ramiro Morales-Hojas

    Full Text Available Colonisation of new geographic regions and/or of new ecological resources can result in rapid species diversification into the new ecological niches available. Members of the subgenus Drosophila are distributed across the globe and show a large diversity of ecological niches. Furthermore, taxonomic classification of Drosophila includes the rank radiation, which refers to closely related species groups. Nevertheless, it has never been tested if these taxonomic radiations correspond to evolutionary radiations. Here we present a study of the patterns of diversification of Drosophila to test for increased diversification rates in relation to the geographic and ecological diversification processes. For this, we have estimated and dated a phylogeny of 218 species belonging to the major species groups of the subgenus. The obtained phylogenies are largely consistent with previous studies and indicate that the major groups appeared during the Oligocene/Miocene transition or early Miocene, characterized by a trend of climate warming with brief periods of glaciation. Ancestral reconstruction of geographic ranges and ecological resource use suggest at least two dispersals to the Neotropics from the ancestral Asiatic tropical disribution, and several transitions to specialized ecological resource use (mycophagous and cactophilic. Colonisation of new geographic regions and/or of new ecological resources can result in rapid species diversification into the new ecological niches available. However, diversification analyses show no significant support for adaptive radiations as a result of geographic dispersal or ecological resource shift. Also, cactophily has not resulted in an increase in the diversification rate of the repleta and related groups. It is thus concluded that the taxonomic radiations do not correspond to adaptive radiations.

  17. Morfologia, ultraestrutura e morfometria do tegumento da paca (Cuniculus paca Linnaeus, 1766 criada em cativeiro

    Directory of Open Access Journals (Sweden)

    José G.M.P. Isola

    2013-05-01

    Full Text Available Considerando-se a falta de informações detalhadas sobre a morfologia da paca, sendo o segundo maior roedor da fauna brasileira, de excelente qualidade de carne e, dada a importância do tegumento comum, inclusive para o bom manejo em cativeiro, e até mesmo estudos como uma opção de animal de experimentação, descreveu-se a morfologia, morfometria e a ultraestrutura da pele de oito pacas (Cuniculus paca machos e fêmeas, mediante a análise comparativa de segmentos cutâneos das regiões cervical, dorsal e medial do carpo. Observaram-se macroscopicamente as características da pelagem. Parte dos segmentos das regiões cutâneas foi analisada à microscopia de luz e parte, à microscopia eletrônica de varredura. Mensuraram-se as espessuras da derme, epiderme, camada córnea, perfis das fibras de colágeno da derme reticular e a área dos perfis das células das glândulas sebáceas repletas. Analisaram-se os resultados pela estatística descritiva e teste "T" (p<0,001. A coloração da pelagem da paca é castanho avermelhado com cerdas organizadas em grupos. A arquitetura da cútis e os anexos cutâneos se assemelham aos dos mamíferos em geral, embora haja ausência de glândulas sudoríparas. De acordo com a analise morfométrica, pôde-se inferir que a arquitetura da cútis de pacas machos e fêmeas apresenta diferenças quando comparada entre os sexos e também em um mesmo animal, diferenciando-se entre diversas regiões corpóreas.

  18. Genomics of ecological adaptation in cactophilic Drosophila.

    Science.gov (United States)

    Guillén, Yolanda; Rius, Núria; Delprat, Alejandra; Williford, Anna; Muyas, Francesc; Puig, Marta; Casillas, Sònia; Ràmia, Miquel; Egea, Raquel; Negre, Barbara; Mir, Gisela; Camps, Jordi; Moncunill, Valentí; Ruiz-Ruano, Francisco J; Cabrero, Josefa; de Lima, Leonardo G; Dias, Guilherme B; Ruiz, Jeronimo C; Kapusta, Aurélie; Garcia-Mas, Jordi; Gut, Marta; Gut, Ivo G; Torrents, David; Camacho, Juan P; Kuhn, Gustavo C S; Feschotte, Cédric; Clark, Andrew G; Betrán, Esther; Barbadilla, Antonio; Ruiz, Alfredo

    2015-01-01

    Cactophilic Drosophila species provide a valuable model to study gene-environment interactions and ecological adaptation. Drosophila buzzatii and Drosophila mojavensis are two cactophilic species that belong to the repleta group, but have very different geographical distributions and primary host plants. To investigate the genomic basis of ecological adaptation, we sequenced the genome and developmental transcriptome of D. buzzatii and compared its gene content with that of D. mojavensis and two other noncactophilic Drosophila species in the same subgenus. The newly sequenced D. buzzatii genome (161.5 Mb) comprises 826 scaffolds (>3 kb) and contains 13,657 annotated protein-coding genes. Using RNA sequencing data of five life-stages we found expression of 15,026 genes, 80% protein-coding genes, and 20% noncoding RNA genes. In total, we detected 1,294 genes putatively under positive selection. Interestingly, among genes under positive selection in the D. mojavensis lineage, there is an excess of genes involved in metabolism of heterocyclic compounds that are abundant in Stenocereus cacti and toxic to nonresident Drosophila species. We found 117 orphan genes in the shared D. buzzatii-D. mojavensis lineage. In addition, gene duplication analysis identified lineage-specific expanded families with functional annotations associated with proteolysis, zinc ion binding, chitin binding, sensory perception, ethanol tolerance, immunity, physiology, and reproduction. In summary, we identified genetic signatures of adaptation in the shared D. buzzatii-D. mojavensis lineage, and in the two separate D. buzzatii and D. mojavensis lineages. Many of the novel lineage-specific genomic features are promising candidates for explaining the adaptation of these species to their distinct ecological niches. PMID:25552534

  19. Beira, uma paisagem modernista na África Tropical

    Directory of Open Access Journals (Sweden)

    Mário Gonçalves Fernandes

    2016-01-01

    Full Text Available A Cidade da Beira, é um estudo de caso complexo e ímpar no que se refere à implementação das ideias modernistas em países tropicais. A cidade tornou-se próspera em virtude dos elevados rendimentos providenciados pela sua interface ferro-portuário que a ligava à Rodésia/Zimbabwe e constituía a base da sua riqueza, atraindo jovens ambiciosos e talentosos arquitectos e engenheiros civis portugueses que construíram uma urbe paradoxal, repleta de edifícios modernistas emblemáticos, plenos de complexas e pouco ortodoxas soluções técnicas que preenchem um plano urbanístico único na África colonial portuguesa. Este artigo discute o processo de expansão da cidade assente numa matriz modernista, profundamente influenciado pelo imaginário arquitectónico e urbano brasileiro procurando sublinhar a inscrição da influência modernista na lógica de expansão da cidade como opção técnica e política. Paralelamente discute a importância da circulação das ideias e modelos urbanos e arquitectónicos no meio dos arquitectos e engenheiros civis portugueses radicados em Moçambique. Metodologicamente os autores procederam a um trabalho de campo assente no reconhecimento da matriz da cidade e na identificação do legado arquitectónico modernista de influência brasileira, seleccionando de entre o edificado os exemplos mais emblemáticos.

  20. In-Vitro Assessment of the Acaricidal Properties of Artemisia Annua and Zataria Multiflora Essential Oils to Control Cattle Ticks

    Directory of Open Access Journals (Sweden)

    KH Pirali-Kheirabadi

    2011-03-01

    Full Text Available Background: The aim of this study was to investigate the ‘acaricidal effect' of Zataria multiflora and Ar­temisia annua essential oils on Rhipicephalus (Boophilus annulatus.Methods: This study was carried out in 2009 in the Laboratory of Parasitology of the Faculty of Veteri­nary Medicine of Shahrekord University, west central Iran. Six dilutions (5, 10, 20, 40, 60 and 80 µL/cm3 of both essential oils were used against engorged female R. (Boophilus annula­tus ticks using an in vitro immersion method. The mortality rates for each treatment were re­corded 6, 15 and 24 hours post inoculation (hpi. Mortality rate was analyzed using Repeated Meas­ures Analysis of Variance, and compari­son of means was carried out using General Linear Models Procedure.Results: The mortality rate caused by different dilutions of Z. multiflora essential oil ranged from 26.6% (using 10 µL/cm3 to 100% (using 40 µL/cm3 and for A. annua essential oil it was 33.2 to 100% (using 20 and 80 µL/cm3, respectively by the end of the experiment (36 hpi. No mortality was recorded for the non-treated control group or for dilutions less than 5 and 10 µL/cm3 using Zataria and Artemisia essential oils, respectively. For Z. multiflora mortality peaked at 15 hpi for all concentrations other than 20 µL/cm3 and took 24 h to achieve its maximum effect while for A. an­nua the two highest concentrations needed 24 hpi to reach their full effect. In addition, essen­tial oils applied at more than 20 and 60 µL/cm3 caused 100% egg-laying failure in engorged fe­male ticks by Zataria and Artemisia, respectively while no failure was observed for the non-treated control group. The mortality rate in both botanical acaricides was dose-dependent.Conclusion: Both these medicinal plants have high potential acaricidal effects on the engorged stage of R. (Boophilus annulatus in vitro.

  1. Eosinophils increase in animals that received biotherapic

    Directory of Open Access Journals (Sweden)

    Pedro Gilberto Silva Morais

    2012-12-01

    Full Text Available Dairy industry is an important Brazilian economic activity participating of income generation. European breeds cattle aren’t adapted to parasites found in the tropics, like the Rhipicephalus microplus tick. Parasites can acquire resistance to allopathic products, but not to homeopathic products. We evaluate the efficacy of an antiparasiticide biotherapic against the R. microplus tick. The biotherapic was prepared according to the homeopathic pharmacopoeia recommendations from vegetable (Abrotanum and animal products (Rhipicephalus microplus, Amblyomma cajenennense, Haematobia irritans, Musca domestica, Dermatobia hominis, all diluted and vigorous shaken (dynamized in water or alcohol at a ratio of 1:99, in the 12th Centesimal Hahnemann (CH12, with limestone as the carrier. This homeophatic product found in veterinary pharmacies of Ituiutaba’s region, Minas Gerais State, is registered at Ministério da Agricultura, Pecuária e Abastecimento (MAPA. Natural tick infestation was accessed in thirty Girolando (Gir x Holstein cows with 7 to 13 year-old, by monthly counting of tick female bigger than 6 mm, from October/2009 to July/2011. Cows were divided in three groups of 10 similar animals. The treated group (T1 received roughage, concentrate and biotherapic. The placebo group (T2 received roughage, concentrate and limestone and the control group (T3 received only roughage and concentrate. T1 and T2 groups were managed together and remained in the same paddock. T3 group was separed from T1 and T2 by a wire fence. From October 2009 to September 2010 blood cell counts and serum biochemical tests were performed monthly only in T1 and T2, but visual clinical observations were made in all animals. Any group was treated with acaricide when the count’s average reached 50 or more ticks. It was necessary 7 baths with acaricide in T1 and T2, while in T3 group (control group it was necessary 19 acaricide baths to control the cattle tick. We verified

  2. Ticks on crested francolins, Francolinus sephaena, and on the vegetation on a farm in Limpopo Province, South Africa : research communication

    Directory of Open Access Journals (Sweden)

    A.C. Uys

    2005-09-01

    Full Text Available Ticks were collected at approximately bi-monthly intervals between June 1996 and June 1997 from crested francolins, Francolinus sephaena, and from the vegetation on a mixed cattle and wildlife farm in Limpopo Province, South Africa. The birds were infested with the immature stages of 13 tick species, of which Amblyomma hebraeum, Amblyomma marmoreum and Hyalomma marginatumrufipes were the most numerous and prevalent. Ten ixodid tick species were collected from the vegetation, of which the immature stages of Rhipicephalus appendiculatus, Rhipicephalus (Boophilus decoloratus and Rhipicephalus evertsi evertsi were the most numerous. No adult ticks were collected from the birds and only two from the vegetation. The restricted home range of crested francolins implies that they could serve as a source of tick infestation only for other animals within the same habitat as the birds.

  3. Effects of cattle treatment with a fluazuron pour-on on survival and reproduction of the dung beetle species Onthophagus gazella (Fabricius).

    Science.gov (United States)

    Kryger, U; Deschodt, C; Davis, A L V; Scholtz, C H

    2007-02-28

    While resistance against many other classes of acaricides has been described, products containing benzoylphenyl urea are currently still successfully used against the pesticide-resistant blue tick (Boophilus decoloratus) in South Africa. In order to assess any adverse impact of these tickicides on the important dung beetle (Coleoptera: Scarabaeidae) fauna, a bioassay was undertaken on the ecotoxicological effects of a fluazuron (benzoylphenyl urea) pour-on formulation (Acatak) on the survival and reproduction of the African dung beetles species Onthophagus gazella (Fabricius). The experiment yielded no significant differences in adult or larval survival, egg production, fecundity and fertility between the control and treatment group following three beetle generations over. These results suggested that treatment of cattle with the fluazuron pour-on formulation Acatak was not detrimental to the selected dung beetle species in any notable way. PMID:16978786

  4. Ticks (Acari: Ixodidae on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo B Labruna

    2002-12-01

    Full Text Available From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paraná river, between the states of São Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species, Boophilus (1 and Anocentor (1. A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  5. Geographic distribution of Bhanja virus.

    Science.gov (United States)

    Hubálek, Z

    1987-01-01

    A review on the geographic distribution, vectors and hosts of Bhanja virus (Bunyaviridae) is based on reports about: isolations of the virus; antibody surveys. Bhanja virus has been isolated in 15 countries of Asia, Africa and Europe, and antibodies against it have been detected in 15 additional countries. Vector range includes ticks of the family Ixodidae (subfam. Amblyomminae; not subfam. Ixodinae): 13 species of 6 genera (Haemaphysalis, Dermacentor, Hyalomma, Amblyomma, Rhipicephalus and Boophilus) yielded the virus. Bhanja virus has only rarely been isolated from vertebrates (Atelerix, Xerus, Ovis, Bos; possibly bats), though antibodies have been detected frequently in a wide range of mammals (Ruminantia being the major hosts), in several species of birds (Passeriformes, Galliformes) and even reptiles (Ophisaurus apodus). Natural foci of the Bhanja virus infections are of the boskematic type (sensu Rosický), associated closely with pastures of domestic ruminants infested by ticks in the regions of tropical, subtropical and partly temperate climatic zones. PMID:3108117

  6. Efficacy of the Bm86 antigen against immature instars and adults of the dog tick Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae).

    Science.gov (United States)

    Perez-Perez, D; Bechara, G H; Machado, R Z; Andrade, G M; Del Vecchio, R E M; Pedroso, M S; Hernández, M V; Farnós, O

    2010-02-10

    The Bm86 antigen has been used to control ticks of the Boophilus genera in integrated programs that also include the use of acaricides. Because of recent phylogenetic studies have lead to the inclusion of all Boophilus species within the Rhipicephalus genera, we aimed to investigate the efficacy of the Bm86 antigen on the biotic potential of Rhipicephalus sanguineus. Domestic dogs were vaccinated with Bm86 and challenged with the three instars of R. sanguineus. Male and female mongrel dogs were divided into two groups of four animals each, comprising non-vaccinated and vaccinated animals. Immunized dogs were given two doses of an experimental formulation containing 50mug of recombinant Bm86, at 21 days interval while the other group was given placebo, consisting of the same preparation without Bm86. Each dog was challenged 21 days after the last dose with 250 larvae, 100 nymphs and 55 adults (25 females and 30 males) released inside feeding chambers (one per instar) glued to their shaved flank. The effect of the vaccination was evaluated by determining biological parameters of ticks including the yield rates of larvae, nymphs and adult females. Adult females engorged weight, egg mass weight, efficiency rate of conversion to eggs (ERCE) and hatchability. In addition, sera were collected from dogs at 0, 21, 36, 45 and 75 days after the vaccination and used for the detection of specific antibodies by ELISA. Collection rates of larvae, nymphs and adult females fed on vaccinated dogs were significantly (pBm86. We concluded that the Bm86 antigen used as a vaccine for dogs reduced the viability and biotic potential of the R. sanguineus. PMID:19836894

  7. Efficacy of Hyalomma scupense (Hd86) antigen against Hyalomma excavatum and H. scupense tick infestations in cattle.

    Science.gov (United States)

    Galaï, Yousr; Canales, Mario; Ben Saïd, Mourad; Gharbi, Mohamed; Mhadhbi, Moez; Jedidi, Mohamed; de La Fuente, José; Darghouth, Mohamed-Aziz

    2012-11-19

    The Rhipicephalus microplus recombinant Bm86-based tick vaccines have shown their efficacy for the control of several Hyalomma cattle ticks genera, namely H. dromedarii and H. anatolicum. However, H. scupense species, the most important tick in North Africa has never been studied. Vaccination trials using either a recombinant Bm86-based vaccine or a recombinant Hd86-based vaccine (the Bm86 ortholog in H. scupense) were conducted in cattle against immature and adult H. scupense ticks and adult H. excavatum ticks. The results showed a 59.19% reduction in the number of scupense nymphs engorging on Hd86 vaccinated cattle. However, cattle vaccination with Bm86 or Hd86 did not have an effect on H. scupense or H. excavatum adult ticks infestations. These results showed that Hd86 vaccines are selectively effective against H. scupense immature instars and emphasize on an integrated anti-tick vaccine control in North Africa. PMID:23036501

  8. Extensive polymorphism of Ra86 genes in field populations of Rhipicephalus appendiculatus from Kenya.

    Science.gov (United States)

    Kamau, L M; Skilton, R A; Githaka, N; Kiara, H; Kabiru, E; Shah, T; Musoke, Aj; Bishop, R P

    2016-07-01

    Commercial vaccines based on recombinant forms of the Bm86 tick gut antigen are used to control the southern cattle tick, Rhipicephalus microplus, a 1-host species, in Australia and Latin America. We describe herein sequence polymorphism in genes encoding Ra86 homologues of Bm86 in the brown ear tick, Rhipicephalus appendiculatus, isolated from four Kenyan field populations and one laboratory colony. Sequencing of 19 Ra86 sequences defined two alleles differentiated by indels, encoding 693 amino acids (aa) and 654 aa respectively, from the Muguga laboratory reference strain. Ra86 sequences were also determined from gut cDNA from four field populations of R. appendiculatus collected in different livestock production systems in Kenya. Analysis of approximately 20 Ra86 sequences from each of the four field sites in central and Western Kenya; Makuyu, Kiambu, Kakamega and Uasin Gishu, revealed three additional size types differentiated by 39-49 amino acid indels resulting in a total of 5 indel-defined genotypes. The 693 aa type 5 was isolated only from the laboratory tick stock; genotypes 1, 2 and 3 were identified in ticks from the four Kenyan field sites and appeared to be derivatives of the shorter RA86 genotype found in Muguga laboratory stock genotype 4. By contrast no large indels have yet been observed between R. microplus sequences from Australia, South America or Africa. Evidence that selection contributes to the observed sequence variation was provided by analysis of ratio of synonymous and non-synonymous substitutions and application of the selective neutrality and neutral evolution tests to the primary data. Phylogenetic analysis clustered sequences from all Ra86 size types and Bm86, into four major clades based on amino acid substitutions, but there was no evidence that these groupings correlated with geographical separation of R. appendiculatus populations. PMID:27051976

  9. Algumas anotações sobre o juízo em Hume

    Directory of Open Access Journals (Sweden)

    Evandro C. Godoy

    2011-08-01

    Full Text Available O filósofo escocês David Hume produziu uma teoria acerca dos processos cognitivos humanos que tem vasta influência na contemporaneidade, sobretudo na Filosofia da Mente e na Epistemologia. Desta influência relevante decorre a necessidade de interpretações sérias e cautelosas, ainda que isto demande muito cuidado com a terminologia peculiar de sua obra, que pode levar a comparações mal embasadas com outros autores. Na intenção de colaborar para o esclarecimento e qualificação do debate acerca das contribuições de Hume, o presente texto pretende apresentar uma visão resumida, mas geral da sua filosofia teórica, de modo a deixar claro que i as relações de ideias descritas na filosofia do autor não constituem, por si só, uma teoria do juízo; ii sua concepção de juízo deve ser buscada na sua explicação da crença e iii apesar da marcante influência de seus antecessores (principalmente de Locke e Descartes, sua filosofia apresenta uma teoria do juízo original e repleta de particularidades. Abstract The Scottish philosopher David Hume produced a theory about human cognitive processes that has widespread influence in contemporary, especially in the Philosophy of Mind and Epistemology. This important influence demands serious and cautious interpretations, and it burdens indeed care with the peculiar terminology of his work in order to avoid ill-grounded comparisons with other authors. Intending to contribute to clarification and qualification of the debate about the contributions of Hume, this text presents a general idea, though resumed, of his theoretical philosophy in order to make clear that: i the relations of ideas described in the philosophy of the author are not, by itself, a theory of judgment; ii his conception of judgment must be searched in his explanation of belief and iii despite the remarkable influence of his predecessors (Descartes and Locke especially, his philosophy has a full detailed and original theory

  10. Epileptic events in the XIX century as reported by the Brazilian Royal Family Eventos epilépticos no século XIX segundo relatos da Família Real Brasileira

    Directory of Open Access Journals (Sweden)

    Marleide da Mota Gomes

    2010-06-01

    Full Text Available Members of the Brazilian Royal Family carry a rich medical history of epileptic seizures and alike. OBJECTIVE: To present the medical knowledge about epilepsy by the time of the Brazilian Empire, as reported by the royal family. METHOD: Narrative review of historical facts about D. Pedro I's family health. RESULTS: The Royal Family, since D. João VI's generation is full of members with epilepsy or acute symptomatic seizures of different etiologies. CONCLUSION: The reported cases suggest that Dom Pedro I's family presented epilepsy with tonic-clonic generalized seizures, besides psychogenic, organic non epileptic events and acute symptomatic seizures. As a whole, this familial epilepsy could fit the diagnosis of generalized epilepsy with febrile convulsion plus.Há uma história médica rica de crises epilépticas e similares nos membros da família real brasileira. OBJETIVO: Apresentar o conhecimento médico sobre epilepsia à época do Império no Brasil, conforme informado pelos acometidos da família real. MÉTODO: Revisão narrativa de fatos históricos sobre a saúde da família de D. Pedro I. RESULTADOS: A genealogia da família real, desde a geração de D. João VI é repleta de pessoas acometidas por epilepsia ou crises sintomáticas agudas de diversas etiologias. CONCLUSÃO: O relato de casos sugere que Dom Pedro I e sua família apresentavam epilepsia de incidência familiar predominantemente com crises tônico-clonicas generalizadas, além de eventos sintomáticos agudos, psicogênicos e orgânicos não epilépticos. Como um todo, a epilepsia dessa família poderia ser enquadrada no diagnóstico de epilepsia generalizada com convulsão febril plus.

  11. A abordagem familiar no tratamento da anorexia e bulimia nervosa Family assessment in the treatment of anorexia and bulimia nervosa

    Directory of Open Access Journals (Sweden)

    Alicia Weisz Cobelo

    2004-01-01

    Full Text Available O final do século XX enfatiza a inclusão da família no tratamento de pacientes portadores de anorexia e bulimia nervosa. Pesquisas (Castro et al.,2000; Webster et al.,2000 colocam como relevante considerar a estrutura familiar, as práticas conversacionais e os legados transgeracionais como elementos que podem estar contribuindo, de modo significativo, no desenvolvimento ou na manutenção dos transtornos alimentares. No Ambulatório de Bulimia e Transtornos Alimentares e no Projeto de Atendimento a Crianças e Adolescentes do IPQ, o grande desafio dos terapeutas de família tem sido compartilhar com famílias e pacientes suas histórias repletas de inseguranças e angústias e construir uma ponte de união entre a família e a equipe multidisciplinar, para que a compreensão dos significados, refletida por todos, possa ser agilizada e transformada em novas contribuições de vida para as pacientes e seus familiares.The end of the 20th century emphasizes the inclusion of the family in the treatment of the patients with anorexia and bulimia nervosa. Researches (Castro et al.,2000; Webster et al.,2000 determine as relevant to consider the family structure, the interaction pattern, and the "transgeneration bequest" - the legacy that goes from one generation to the next - as elements that might contribute in a significant way to the development or maintenance of the eating disorders. At the Bulimia and Eating Disorders Ambulatory and in the IPQ's Project for Attendance of Children and Adolescents, the great challenge for the family therapists has been to share with the families and patients their histories full of insecurity and anguish. The therapists must also overcome the difficulties of building a bridge that brings together the family and the multidisciplinary team so that the comprehension of the meanings, reflected by all, might be quickly transformed into new life contributions to these patients and their families.

  12. Critical literacy in the english language classroom O letramento crítico na aula de língua inglesa

    Directory of Open Access Journals (Sweden)

    Clarissa Menezes Jordão

    2012-01-01

    Full Text Available This paper reports the experience of developing teaching materials for public school teachers and students in southern Brazil in a project funded by the Education Department of Paraná State. The materials were intended as resources to be used by teachers according to their needs and those of their local communities, rather than as a textbook per se. The theory underlying this project is based on critical literacy and the idea that language is discourse, i.e. embedded in cultural and ideological values which determine its meaning and establish power relations among texts, among readers and among texts and their readers - Freirean "readers of the wor(ld". Student-readers are, in this sense, co-constructors of meanings and responsible for making sense of reality. We expect students and teachers who use the materials we designed to become more aware of their possibilities as agents and this way we intend to foster a sense of active citizenship.Este artigo relata uma experiência de desenvolvimento de materiais didáticos para alunos de escolas públicas no sul do Brasil, em um projeto financiado pela SEED - Secretaria de Estado da Educação do Paraná. Os materiais foram pensados como recursos a serem utilizados pelos professores de acordo com suas necessidades locais, ao invés de constituírem-se simplesmente em um livro didático. A teoria subjacente ao projeto está baseada no letramento crítico e na concepção da língua como discurso, ou seja, uma língua repleta de valores culturais e ideológicos, os quais determinam significados e estabelecem relações de poder entre textos, entre leitores e entre textos e seus leitores, em sintonia com o conceito freiriano de palavramundo - "wor(ld". Os alunos leitores são, nesse sentido, coprodutores de significados e responsáveis por dar sentido à realidade. Esperamos que alunos e professores, que venham a utilizar os materiais que elaboramos, se tornem mais cientes de suas possibilidades como

  13. Intoxicação aguda por triclorfon em caprinos tratados com a dose terapêutica

    Directory of Open Access Journals (Sweden)

    Welber Daniel Zanetti Lopes

    2014-02-01

    Full Text Available O presente estudo descreve um surto de intoxicação por triclorfon em caprinos, que receberam pela via oral, a dosagem terapêutica do princípio ativo em questão (100mg/kg, provenientes da Universidade Estadual de Maringá, campus de Umuarama, PR. Cinquenta e três ovinos foram tratados com a mesma formulação/solução e não se observou nenhum efeito colateral nos animais referente ao tratamento com triclorfon. Das 20 cabras medicadas, cerca de 40 minutos após a administração do triclorfon, oito apresentaram os clássicos sinais clínicos de ataxia, decúbito externo-lateral, sialorreia, tremores, constrição das pupilas, dispneia com ruídos, micção e defecação involuntária, paresia espástica, timpanismo e lacrimejamento. Quase que imediatamente após a detecção destes sinais, as oito cabras foram medicadas com sulfato de atropina 1% 0,5mg/kg mais fluidoterapia. Cinco destes animais tiveram de receber nova dosagem de sulfato de atropina uma hora após a primeira aplicação, em função de alguns sinais clínicos, como tremores musculares, ainda estarem presentes. De 48 a 72 horas após a administração do triclorfon, três destes cinco animais vieram a óbito. Na necropsia, foi possível observar mucosas cianóticas, congestão de fígado, baço e rins, vasos mesentéricos congestos, vesícula biliar repleta, enfisema pulmonar, parênquima pulmonar avermelhado. Os resultados encontrados neste trabalho chamam atenção que o surto aconteceu em cabras adultas, que apresentavam boas condições clínicas e acima de tudo, receberam a dosagem terapêutica recomendada em bula pelo fabricante. Talvez isso possa indicar alguma sensibilidade mais elevada desta espécie animal à dosagem recomendada em bula do triclorfon (100mg/kg para caprinos.

  14. Algumas interrogações sobre o sistema de comunicação no brasil: mídia e relações de poder, saber e subjetivação

    Directory of Open Access Journals (Sweden)

    Ana Carolina Farias Franco

    2013-01-01

    Full Text Available Neste artigo, consideramos a mídia como um campo complexo, atravessado por lutas heterogêneas que colocam em jogo a disputa de valores, de interesses políticos e econômicos. Nossa análise tem como objetivo questionar as múltiplas relações de poder que constituem este espaço de práticas discursivas e não-discursivas. E indagar, especialmente, como estas relações têm se configurado pela formação de monopólios no sistema de comunicação brasileiro. Para isto, nos apoiamos na análise sobre as relações de poder-saber-subjetivação em Michel Foucault. Analisamos como as oligarquias do setor de radiodifusão no país têm estabelecido também mecanismos de dominação no campo da comunicação, ao conseguirem articular um dispositivo que reproduz suas práticas cristalizadas em agem por meio da lógica do comentário de informações rápidas e fragmentadas, repletas de um projeto de banalização do cotidiano; marcada pelo mercado do entretenimento sensacionalista, limitando que outros modos de existência e discursos circulem e ganhem visibilidade, na sociedade brasileira. Abstract In this article we consider the media as a complex field, crossed by heterogeneous struggles to bring into play the contest of values, political and economic interests. Our analysis aims to question the multiple power relations that constitute the space of discursive practices and non-discursive. And ask, especially as these relations have been marked by the formation of monopolies in the communication system in Brazil. For this, we rely on the analysis of the relations of power-knowledge-subjectivity in Michel Foucault. We analyze how the oligarchies of the broadcasting industry in the field of communication, they can articulate a device that plays crystallized in their practices banality of everyday life, marked by sensational entertainment market, limiting than other modes of existence and discourses circulate and gain visibility in Brazilian

  15. Olhando para trás: um novo caminho possível para a descoberta de drogas em psicofarmacologia Mirando hacia atrás: un nuevo camino posible para la descubierta de drogas en psicofarmacología Looking backwards: a possible new pathway for drug discovery in psychopharmacology

    Directory of Open Access Journals (Sweden)

    Edward Shorter

    2004-08-01

    Full Text Available A história da psicofarmacologia é repleta de erros do tipo II - a rejeição de compostos efetivos baseada na crença enganosa de que eles foram ineficazes por não terem vencido o placebo em um ensaio clínico controlado. A revisão de algumas dessas drogas para estabelecer seu perfil de receptores e para determinar quais os compostos patenteáveis que atualmente estão na "prateleira" e que encaixam nesse perfil pode representar um caminho futuro possível para a descoberta de drogas. Este artigo examina as circunstâncias especiais nas quais inúmeras drogas potencialmente efetivas foram retiradas do mercado nos Estados Unidos.La historia de la psicofarmacología está llena de errores de tipo II - el rechazo de compuestos efectivos basado en la creencia equivocada de que ellos han sido ineficaces porque no han vencido el placebo en un ensayo clínico controlado. La revisión de algunas de esas drogas para establecer su perfil de receptores y para determinar cuales son los compuestos patentables que actualmente están en la "estante" y que se encajan en ese perfil puede representar un camino futuro posible para la descubierta de drogas. Este artículo analiza las circunstancias especiales en las que innumerables drogas potencialmente efectivas han sido retiradas del mercado en Estados Unidos.The history of psychopharmacology is littered with type II errors - the rejection of effective compounds in the specious belief that they were inefficacious because they had failed to beat placebo in a controlled trial. Revisiting some of these drugs to establish their receptor profile, and then determining what patentable compounds now on the shelf match that profile, might represent a possible future pathway to drug discovery. This article looks at the special circumstances in which numerous potentially effective drugs were withdrawn in the United States.

  16. Ticks associated with the three largest wild ruminant species in Southern Africa

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2007-09-01

    Full Text Available The objective of this study was to assess the host status of the three largest southern African wild ruminants, namely giraffes, Giraffa camelopardalis, African buffaloes, Syncerus caffer, and eland, Taurotragus oryx for ixodid ticks. To this end recently acquired unpublished data are added here to already published findings on the tick burdens of these animals, and the total numbers and species of ticks recorded on 12 giraffes, 18 buffaloes and 36 eland are summarized and discussed. Twenty-eight ixodid tick species were recovered. All stages of development of ten species, namely Amblyomma hebraeum, Rhipicephalus (Boophilus decoloratus, Haemaphysalis silacea, Ixodes pilosus group, Margaropus winthemi, Rhipicephalus appendiculatus, Rhipicephalus evertsi evertsi, Rhipicephalus glabroscutatum, Rhipicephalus maculates and Rhipicephalus muehlensi were collected. The adults of 13 species, of which the immature stages use small mammals as hosts, namely Haemaphysalis aciculifer, Hyalomma glabrum, Hyalomma marginatum rufipes, Hyalomma truncatum, Ixodes rubicundus, Rhipicephalus capensis, Rhipicephalus exophthalmos, Rhipicephalus follis, Rhipicephalus gertrudae, Rhipicephalus lounsburyi, Rhipicephalus lunulatus, Rhipicephalus pravus group and Rhipicephalus simus, were also collected.

  17. Ticks associated with the three largest wild ruminant species in southern Africa.

    Science.gov (United States)

    Horak, I G; Golezardy, H; Uys, A C

    2007-09-01

    The objective of this study was to assess the host status of the three largest southern African wild ruminants, namely giraffes, Giraffa camelopardalis, African buffaloes, Syncerus caffer, and eland, Taurotragus oryx for ixodid ticks. To this end recently acquired unpublished data are added here to already published findings on the tick burdens of these animals, and the total numbers and species of ticks recorded on 12 giraffes, 18 buffaloes and 36 eland are summarized and discussed. Twenty-eight ixodid tick species were recovered. All stages of development of ten species, namely Amblyomma hebraeum, Rhipicephalus (Boophilus) decoloratus, Haemaphysalis silacea, Ixodes pilosus group, Margaropus winthemi, Rhipicephalus appendiculatus, Rhipicephalus evertsi evertsi, Rhipicephalus glabroscutatum, Rhipicephalus maculatus and Rhipicephalus muehlensi were collected. The adults of 13 species, of which the immature stages use small mammals as hosts, namely Haemaphysalis aciculifer, Hyalomma glabrum, Hyalomma marginatum rufipes, Hyalomma truncatum, Ixodes rubicundus, Rhipicephalus capensis, Rhipicephalus exophthalmos, Rhipicephalus follis, Rhipicephalus gertrudae, Rhipicephalus lounsburyi, Rhipicephalus lunulatus, Rhipicephalus pravus group and Rhipicephalus simus, were also collected. PMID:17933365

  18. Preliminary survey of ticks (Acari : Ixodidae on cattle in northern Sudan

    Directory of Open Access Journals (Sweden)

    D.A. Salih

    2004-11-01

    Full Text Available In a cross sectional survey conducted during the period June 2001 to July 2002, the geographical distribution of ticks on cattle in the Sudan was determined. Seventeen locations were surveyed from Northern, Central, Eastern, Western, Blue Nile and White Nile Provinces. Total body collections of ticks were made from 20 cattle at each location. Four tick genera and 11 species were identified. The tick species collected included Amblyomma lepidum, Amblyomma variegatum, Boophilus decoloratus, Hyalomma anatolicum anatolicum, Hyalomma dromedarii, Hyalomma impeltatum, Hyalomma marginatum rufipes, Hyalomma truncatum, Rhipicephalus evertsi evertsi, Rhipicephalus sanguineus group and Rhipicephalus simus simus. Major ecological changes have occurred due to extensive animal movement, deforestation, desertification and establishment of large mechanized agricultural schemes. These factors have certainly affected the distribution of ticks and tick-borne diseases in the Sudan. The absence of A. variegatum and A. lepidum in northern Sudan was not surprising, since these tick species are known to survive in humid areas and not in the desert and semi-desert areas of northern Sudan. The absence of B. annulatus in northern and central Sudan is in accordance with the finding that this tick species is restricted to the southern parts of the central Sudan. The presence of H. anatolicum anatolicum in Um Benin in relatively high abundance is an interesting finding. The present finding may indicate that the southern limit of this species has changed and moved southwards to latitude 13o N. It is concluded that major changes in tick distribution have taken place in the Sudan

  19. First molecular detection of Theileria ovis in Rhipicephalus sanguineus tick in Iran

    Institute of Scientific and Technical Information of China (English)

    Telmadarraiy Zakkyeh; Oshaghi Mohammad Ali; Hosseini Vasoukolaei Nasibeh; Yaghoobi Ershadi Mohammad Reza; Babamahmoudi Farhang; Mohtarami Fatemeh

    2012-01-01

    Objective:To determine tick infestation of domestic ruminants and their infection to ovine theileriosis in northern Iran. Methods:About 425 domestic ruminants in Ghaemshahr city in northern Iran were inspected for tick infestations. Twenty tick specimens (13 females and 7 males) of Rhipicephalus sanguineus (R. sanguineus), the most common tick in the study area, were tested by PCR amplification against 18s rRNA genome of Theileria spp using specie specific primers and then the PCR products were sequenced for species identification by comparison with data base available in GenBank. Results:About 323 ticks were collected from 102 animals (88 sheep, 12 goats and 2 cattle). The prevalence of ticks infesting animals was R. sanguineus (82.35%), Rhipicephalus bursa (R. bursa) (0.3%), Ixodes ricinus (I. ricinus) (15.2%), Boophilus annulatus (B. annulatus) (1.2%), Haemaphysalis punctata (H. punctata) (0.3%) and Haemaphysalis numidiana (H. numidiana) (0.6%). Eleven (55%) tick specimens were PCR positive against genome of Theileria ovis (T. ovis). Sequence analysis of the PCR products confirmed presence of T. ovis in one R. sanguinus. Conclusions:This is the first report of tick infection to T. ovis in Iran. Due to dominant prevalence of R. sanguineus as well as its infection to T. ovis, it is postulated this tick is the main vector of ovine theileriosis in northern Iran.

  20. Tick vaccines and the transmission of tick-borne pathogens.

    Science.gov (United States)

    de la Fuente, J; Kocan, K M; Blouin, E F

    2007-08-01

    Ticks transmit pathogens that cause diseases which greatly impact both human and animal health. Vaccines developed against Boophilus spp. using Bm86 and Bm95 tick gut antigens demonstrated the feasibility of using vaccines for control of tick infestations. These vaccines also reduced transmission of tick-borne pathogens by decreasing exposure of susceptible hosts to ticks. The recently discovered tick antigens, 64P putative cement protein and subolesin involved in the regulation of tick feeding and reproduction, were also shown to reduce tick infestations. These antigens, together with the TROSPA receptor for Burrelia burgdorferi OspA were effective against tick-borne pathogens by reducing the infection levels in ticks and/or the transmission of the pathogen. Development of a vaccine targeted at both the tick vector and pathogen would contribute greatly to the control of tick infestations and the transmission of tick-borne diseases. These results have demonstrated that tick vaccines can be developed for control tick infestations and show promise for the prevention of the transmission of tick-borne pathogens. PMID:17682852

  1. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Martha Glenny A

    2004-01-01

    Full Text Available Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lyme IgG/IgM (Trinity biotech la presencia de anticuerpos contra Borrelia burgdorferi. Además, se colectaron garrapatas en animales domésticos por búsqueda directa. Resultados: Se detectó seropositividad en 9,9 % de los sueros evaluados. Asimismo, de 433 garrapatas colectadas se identificaron los géneros: Ixodes (5,5%, Amblyomma (18,0%, Rhipicephalus (23,5%, Anocentor (31,1% y Boophilus (21,7%. Conclusiones: Existen personas seropositivas por Borrelia en Piura y Amazonas, coincidiendo con los hallazgos realizados en Sapillica en el año 1992, además se detectó la presencia de garrapatas del género Ixodes en Piura.

  2. Camel Diseases and Conditions in a Non-traditional Camel Keeping Area: A case study of Kajiado District With Special Emphasis on Trypanosomiasis

    International Nuclear Information System (INIS)

    Camels in Kenya are raised in the lowlands of Semi-arid to arid areas of Northern Kenya. Some NGO's (PHI and Farm Africa) introduced some camels into the wetter Southern rangelands of Kenya, specifically in Kajiado in 1989. There is no information so far on the productivity of these animals in this new environment. The objective of this study was to collect data on disease and conditions in Kajiado district with special emphasis on trypanosomosis. Twenty-four herds of camels in three divisions of Kajiado, comprising of 324 animals, were clinically examined and blood as well as faecal samples collected for laboratory examination for haemoparasites, anaemia and helminths as well as other infections and ectoparasites. The mean trypanosome point prevalence was 7.2% although Magadi had the biggest prevalence of 26.4%, while the central division had the least, 1.3% PCV values were proportion to magnitude of infection. T. brucei/T. evansi were shown to be present in varying degrees. Tick infestation comprised of Boophilus, Rhipicephalus and Hyalomma in about 53% of the camels. Helminth infection was observed in about 51% of the camels comprising mainly Haemonchus, Trichosrongylus, Strongyloides and Oesophagostomum. There were also cases of Abscesses, diarrhoea, mange eye infections, wounds and mastitis. It was concluded that new management strategies for the camel in southern rangelands is desirable to counter possible new diseases as well as other challenges of productivity

  3. Current Limitations in the Control and Spread of Ticks that Affect Livestock: A Review

    Directory of Open Access Journals (Sweden)

    Agustín Estrada-Peña

    2013-04-01

    Full Text Available Ticks are well-known parasites that affect livestock productivity. This paper reviews the current knowledge regarding the spread of ticks with their impact in animal health and the limitations to achieve effective control measures. The forecasted trends in climate play an obvious role in promoting the spread of ticks in several regions. It appears that climate warming is pivotal in the spread and colonization of new territories by Rhipicephalus microplus in several regions of Africa. The reported increase in altitude of this tick species in the mountainous regions of Central and South America appears to be driven by such general trends in climate change. This factor, however, is not the only single contributor to the spread of ticks. The poor management of farms, uncontrolled movements of domestic animals, abundance of wild animals, and absence of an adequate framework to capture the ecological plasticity of certain ticks may explain the complexity of the control measures. In this paper, we review several details regarding the relationships of ticks with the environment, wild fauna and competition with other species of ticks. Our intention is to highlight these relationships with the aim to produce a coherent framework to explore tick ecology and its relationship with animal production systems.

  4. Molecular and serological detection of Babesia Bovis and Babesia Bigemina in cattle in the Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Jenevaldo Barbosa da Silva

    2014-12-01

    Full Text Available Bovine babesiosis is an important disease of cattle where Rhipicephalus microplus acts as a vector for the two causal organisms Babesia bovis and Babesia bigemina. A total of 22 calves were randomly monitored during three years by semi-nested PCR assay and ELISA test to determine prevalence of B. bovis and B. bigemina. The overall prevalence of B. bovis and B. bigemina was 30% and 35% by nested PCR (nPCR, and 70% and 75% by ELISA, respectively. Statistical analysis of the characteristics of animals showed that age and tick infestations (p<0.05 might play an important role in the spread of babesiosis as animal less than 6 months old. A high correlation (Kappa index of 0.70 for B. bovis and 0.65 for B. bigemina, respectively between serological and molecular tests suggests that the combination of the utilized techniques in the present study is suitable for babesiosis diagnosis in an endemic unstable area.

  5. Bartonellae in animals and vectors in New Caledonia.

    Science.gov (United States)

    Mediannikov, Oleg; Davoust, Bernard; Cabre, Olivier; Rolain, Jean-Marc; Raoult, Didier

    2011-12-01

    Bartonellae are gram-negative facultative intracellular alpha-proteobacteria from the family Bartonellaceae. The natural history of bartonellae consists of a reservoir/host, which is a vertebrate with chronic intravascular infection with sustained bacteremia, and a vector (usually an arthropod) that transfers the bacteria from the reservoir to a susceptible yet uninfected host. In order to reveal the sources and reservoirs of Bartonella infection in animals and vectors in New Caledonia, we collected the blood samples of 64 dogs, 8 cats, 30 bovines, 25 horses and 29 wild deer Cervus timorensis russa and 308 associated blood-sucking parasites (14 keds Hippobosca equina, 258 ticks (22 Rhipicephalus microplus, 235 Rhipicephalus sanguineus, and 1 Haemaphysalis longicornis), 12 fleas Ctenocephalides felis and 24 dog lice Trichodectes canis). We isolated ten strains of Bartonella: four Bartonella henselae from cats and six Bartonella chomelii from cattle. The strains were characterized by sequencing of five genes (16S, ITS, rpoB, gltA and ftsZ). The six strains isolated from cattle were close to the reference strain of B. chomelii and were, probably, imported from France with cattle of Limousin race. PCR showed that 35% of keds collected from deer and 31% of deer were infected by B. aff. schoenbuchensis; all other samples were negative. Our data confirmed that in New Caledonia, as in other regions of the world, cats are the major reservoirs of B. henselae. We also confirmed that Hippoboscidae flies may serve as the vectors of ruminant-associated bartonellae. PMID:22018646

  6. Molecular detection of canine distemper virus (CDV, canine adenovirus A type 1 and 2 (CAdV-1 and CAdV-2, and canine parvovirus type 2 (CPV-2 in the urine of naturally infected dogs

    Directory of Open Access Journals (Sweden)

    Ana Paula Silva

    2014-12-01

    Full Text Available Bovine babesiosis is an important disease of cattle where Rhipicephalus microplus acts as a vector for the two causal organisms Babesia bovis and Babesia bigemina. A total of 22 calves were randomly monitored during three years by semi-nested PCR assay and ELISA test to determine prevalence of B. bovis and B. bigemina. The overall prevalence of B. bovis and B. bigemina was 30% and 35% by nested PCR (nPCR, and 70% and 75% by ELISA, respectively. Statistical analysis of the characteristics of animals showed that age and tick infestations (p<0.05 might play an important role in the spread of babesiosis as animal less than 6 months old. A high correlation (Kappa index of 0.70 for B. bovis and 0.65 for B. bigemina, respectively between serological and molecular tests suggests that the combination of the utilized techniques in the present study is suitable for babesiosis diagnosis in an endemic unstable area.

  7. Efeito protetor da acetamida em bovinos indica monofluoroacetato como princípio tóxico de Palicourea marcgravii (Rubiaceae

    Directory of Open Access Journals (Sweden)

    Tiago C. Peixoto

    2012-04-01

    Full Text Available O presente trabalho teve como objetivo avaliar e comparar o efeito protetor da acetamida nas intoxicações experimentais por monofluoroacetato (MF e por folhas frescas de Palicourea marcgravii em bovinos, no intuito de confirmar, de forma prática, que esse composto é o princípio tóxico responsável pelo quadro clínico-patológico e pela morte dos animais intoxicados por essa planta. Três bovinos receberam MF, por via oral, na dose de 0,5mg/kg e, em seguida, a dois desses animais administraram-se acetamida, por via oral, nas doses de 0,38 e 2,0g/kg. Outros dois bovinos receberam 1,0g/kg de P. marcgravii, em seguida, a um deles administrou-se 1,0 g/kg de acetamida. Acetamida, quando administrada em quantidades suficientes (maior dose, evitou o aparecimento dos sinais clínicos e a morte de todos os animais que receberam MF ou P. marcgravii. Tal efeito protetor foi, de fato, confirmado após uma semana, quando o mesmo protocolo experimental foi repetido, para cada bovino, porém sem a administração de acetamida. Todos os bovinos não tratados com acetamida manifestaram sinais clínicos e morreram subitamente. O quadro clínico-patológico manifestado pelos bovinos intoxicados por MF ou P. marcgravii foi semelhante e, caracterizou-se por "morte súbita". Os animais em geral, apresentaram taquicardia, taquipnéia, tremores musculares, jugular repleta com pulso venoso positivo, polaquiúria, instabilidade, perda de equilíbrio, por vezes, cambaleavam e apoiavam a cabeça no flanco. Na fase final, todos os animais deitavam-se e levantavam-se com maior frequencia, deitavam ou caíam em decúbito lateral, esticavam os membros, faziam movimentos de pedalagem, apresentavam respiração ofegante, arritmia, opistótono, nistagmo, mugiam e morriam. A duração da "fase dramática" variou de 2 a 26min. À necropsia verificaram-se, em geral, aurículas, jugulares, ázigos e pulmonares leve a moderadamente ingurgitadas, leve a acentuado edema da

  8. Immunization of Cattle with Tick Salivary Gland Extracts

    Directory of Open Access Journals (Sweden)

    Ali Nikpay

    2016-01-01

    Full Text Available Background: Rhipicephalus (Boophilus annulatus tick is one of the most important ectoparasite of cattle. Re­cently, several laboratories in the world have been concentrated on immunizing cattle against tick using various types of tissue extracts of ticks. The aim of this study was to evaluate the effect of immunization of cattle with tick salivary gland extract on biological parameters of ticks and humoral immune responses of cattle.Methods: Fourteen more dominant protein bands identified as immunogenic by Western-blot analysis were eluted from polyacrylamide gel. Test and control groups were injected three times with eluted proteins and sterile PBS (pH= 7.2 respectively with equivalent amount of adjuvant. After four weeks a tick challenge was performed. Fi­nally, biological parameters of collected engorged female ticks were recorded and humoral immune responses to immunization measured by ELISA.Results: The results indicated immunization of cattle resulted in reduction in mean tick counts, attachment, en­gorgement weights, feeding index, egg mass weight, hatchability and fertility index (respectively 63.1%, 62.6%, 30.2%, 36.4%, 40%, 78.7% and 13.3% and increased duration of feeding, pre-oviposition and incubation period of eggs (respectively 8.6%, 45 and 31.34%. All changes were statistically significant (P< 0.05. Results showed an increase in antibody production of test group from the first week after immunization. The antibody level was boosted following tick infestation.Conclusion: This investigation indicates that immunization of cattle with these antigens could induce a protective immune response against Rh. (B. annulatus tick that would be expected to provide a safe non-chemical means of tick control.

  9. Occurrence of Soft and Hard Ticks on Ruminants in Zagros Mountainous Areas of Iran

    Directory of Open Access Journals (Sweden)

    S Nabian

    2008-08-01

    Full Text Available Background:The distribution and preferences of ticks of animals in central of Iran were studied four times a year. Methods: One thousand seven tick specimens were collected from different localities including Isfahan, Chaharmahalbak­htiary, EastAzarbaijan, West Azerbaijan, Kordestan, Kermanshah, Lorestan and Fars. Results: Most of sampled animals in this area were infested. We also encountered with a wild goat (Capra hircus aegagrus in Kolah Qazi national park in this part that was infested intensively by Boophilus kohlsi. Fifteen ixodid tick species were identified over the study period from cattle, sheep and domestic and wild goats namely B. kohlsi (3.6% Rhipicephalus sanguineus (4.5%, Rh.bursa (21.9%, Rh.turanicus (2.9%, Dermacentor niveus (12.9%, D.raskemensis (4.1%, D.marginatus (7.3%, Haemaphysalis punctata (3.5%, H. Parva (0.6%, H. Choldokovskyi (2%, Hyalomma anatolicum excavatum (4.8%, H.anatolicum anatolicum (5.2%, H. asiaticum asiaticum (7.3%, H. marginatum marginatum (13%, and H. detritum detritum (5.9%. The only soft tick found was Ornithodoros canestrinii which occurred in all localities of Isfahan Province but with significant differences in abundance. Clear pattern of seasonality was evident for this species and it was generally present from November to March, while ixodid ticks were present throughout the year. The largest numbers of adult ixodid ticks were generally present from April to August. Conclusion: The results showed that Rh.bursa, D.niveus and H.marginatum marginatum are dominant tick species

  10. Isolation of aerobic bacteria from ticks infested sheep in Iraq

    Institute of Scientific and Technical Information of China (English)

    Waleed Ibrahem Jalil; Mohammad Mushgil Zenad

    2016-01-01

    Objective: To highlight the presence of aerobic bacteria in live ticks infested sheep, in Diyala Governorate, Iraq. Methods: One hundred and thirty adult alive ticks were picked up from sheep which were reared in different farms in Diyala Governorate, Iraq, during the period from November 2012 to May 2013. Ticks were classified in the Natural History Museum in Baghdad. They were dissected aseptically for extraction of the salivary gland and mid-gut. The removed tissue from each organ was inoculated in buffer peptone water (1%) and incubated for 2 h at 37℃, to maintain weak and/or injured bacterial cells, then transmitted to nutrient broth incubated at 37℃ for 18 h. Culturing was done on three solid bacteriological media (nutrient, blood and McConkey agars), and then incubated at 37℃ for 24 h. Bacterial identification was performed by using multiple biochemical tests and API-20 strips. Data were analyzed by using Statistical Analysis System version 9.1, 2010. Chi-square test was used for comparison at significant level of P ≤0.05. Results: Two species of ticks were identified [Rhipicephalus (Boophilus) annulatus and Hyalomma turanicum]. High bacterial isolation rate was observed (483 isolates). A significant high isolation rate was recorded from Rhipicephalus annulatus (63.14%). Six bacterial species were identified [Escherichia coli (28.36%), Pseudomonas aeruginosa (18.01%), Bacillus cereus (14.69%), Staphylococcus aureus (13.66%), Citrobacter freundii (13.04%), and Enterobacter species (12.21%)]. Also the high bacterial isolation rates were recorded in the temperate months (November, March and April); these coin-cided with high reproductive performance of ticks. Conclusions: The high isolation rate of aerobic pathogens from ticks might reflect the active contribution of this arthropod in environmental contamination and increase the probability of transmitting bacterial pathogens to their hosts.

  11. Efficacy of orally administered powdered aloe juice (Aloe ferox against ticks on cattle and ticks and fleas on dogs

    Directory of Open Access Journals (Sweden)

    J.J. Fourie

    2005-06-01

    Full Text Available The efficacy of orally administered powdered aloe juice (Aloe ferox was evaluated against ticks on cattle and against ticks and fleas on dogs. Twelve calves were each infested over a 25-day period with approximately 4000 larvae of Rhipicephalus (Boophilus decoloratus and allocated to 3 groups of 4 calves each. Three days after the last larval infestation and daily for 22 days thereafter, the calves in 1 group were fed 5 mg / kg body weight and those in another 25 mg / kg body weight of powdered aloe juice incorporated in game maintenance pellets, while the animals in the 3rd group received only pellets. Detached female ticks were collected daily and counted and the weights and the fertility of groups of 50 engorged female ticks collected from the animals were ascertained. The powdered aloe juice in the game maintenance pellets had no effect on the tick burdens of the calves or on the fertility of the ticks. Six dogs, in each of 2 groups, were treated daily for 15 consecutive days, commencing on Day -5 before the 1st tick infestation, with either 0.39 g or 0.74 g of powdered aloe juice, administered orally in gelatin capsules, while a 3rd group of 6 dogs served as untreated controls. All the dogs were challenged with Haemaphysalis leachi on Days 0 and +7, and with Ctenocephalides felis on Days+1and +8, and efficacy assessments were made 1 day after flea and 2 days after tick challenge, respectively. Treatment was not effective against ticks or fleas on the dogs.

  12. Studies on prevalence, risk indicators and control options for tick infestation in ruminants

    Directory of Open Access Journals (Sweden)

    Nady M. Asmaa

    2014-03-01

    Full Text Available An epidemiological study was conducted at Benisuef district to determine the current situation and associated determinants of tick infestations in ruminants and to assess the efficacy of three different types of insecticides against tick infestation under field conditions. Total of (1082 animals of different species (540 cattle, 230 buffaloes, 108 of each sheep & goats and 96 camels were selected randomly and examined carefully for tick infestation. About (30.1% of total observed animals were found tick infested with highest rate in cattle (60.5% followed by goats (25.9%, buffaloes (17.8%, sheep (14.8% while no tick infestation recorded in camels. The most prevalent tick's species affecting ruminants was Boophilus annulatus (26.5% followed by Hyalomma anatolicum (6.1% then Rhipicephalus turanicus (3.4%. Regarding the associated risk factors, tick infestation was found statistically significant (P 3 years (78.8% followed by at age, ≤2 months (57.8% and during summer months were found highly significant (P < 0.01 in cattle ( 76.5% followed by goats and sheep (33.3% & 22.9% resp., comparing with results in winter. The preferred sites of ticks' attachment to infested animals were udders and external genitalia (70.7% of each then Neck & chest (63.0% of each, inner thighs (61.1%, perineum (41.7%, ears (14.6%, around eyes (11.7%. The obtained results revealed that poor husbandry practices of small holder farmers be a determinant making the animals more prone to tick infestation in this district. Improving the hygienic conditions associated with treatment of infested cattle with Ivermectin (0.2 mg/kg b.wt, S/C and spraying of Deltamethrin (1% for surrounding environment twice every 14 days are recommended for control of tick infestation under field condition.

  13. Ectoparasites of livestock, dogs, and wild rodents in the Chittagong Hill Tracts in southeastern Bangladesh.

    Science.gov (United States)

    Fuehrer, Hans-Peter; Igel, Petra; Treiber, Moritz; Baumann, Timo A; Riedl, Julia; Swoboda, Paul; Joachim, Anja; Noedl, Harald

    2012-10-01

    A large variety of ectoparasites parasitizing on livestock, dogs, and rodents are documented throughout the world, of which several are proven vectors for major (including zoonotic) diseases affecting humans and/or livestock. However, there remains a significant lack of knowledge in regard to the ectoparasite fauna in remote regions of the developing world, such as southeastern Bangladesh, and an urgent need to investigate this fauna to improve diagnostic options. In the course of the present study, more than 5,300 ectoparasites were collected by flag dragging and handpicking of livestock, dogs, and rodents in the District of Bandarban (Chittagong Hill Tracts) in southeastern Bangladesh. Three tick species were identified: Haemaphysalis bispinosa (flagging, cattle, goats, and dogs), Rhipicephalus microplus (cattle, goats), and Rhipicephalus sanguineus (dogs, goats, and flagging). H. bispinosa was the dominant tick species on mammalian hosts as well as on vegetation. Furthermore, Ctenocephalides canis (dogs, goats) and Linognatus sp. (goat) were found. Overall, 73 rodents of eight different species (e.g., Mus musculus, Rattus sikkimensis, Bandicota bengalensis, and Niviventer sp.) hosted a variety of ectoparasites such as mites (Laelaps nuttali, Laelaps echidninus, Lyponissoides sp. and Ornithonyssus bacoti), fleas (Xenopsylla cheopis), and one myiasis-causing dipteran species. Monitoring the ectoparasite burden of livestock and other mammals is urgently needed in order to control ectoparasites associated with social and economic burden (e.g., reduced milk production, weight loss). Several zoonotic diseases can be transmitted by ectoparasites in this area, where the majority of the population live in basic housing conditions and in direct contact with livestock, dogs, and rodents. PMID:22576854

  14. Rickettsial Infection in Animals, Humans and Ticks in Paulicéia, Brazil.

    Science.gov (United States)

    Silveira, I; Martins, T F; Olegário, M M; Peterka, C; Guedes, E; Ferreira, F; Labruna, M B

    2015-11-01

    A previous study in Paulicéia Municipality, south-eastern Brazil, reported 9.7% of the Amblyomma triste ticks to be infected by Rickettsia parkeri, a bacterial pathogen that causes spotted fever in humans. These A. triste ticks were shown to be associated with marsh areas, where the marsh deer Blastocerus dichotomus is a primary host for this tick species. During 2008-2009, blood serum samples were collected from 140 horses, 41 dogs, 5 opossums (Didelphis albiventris) and 26 humans in farms from Pauliceia Municipality. Ticks were collected from these animals, from vegetation and from additional wildlife in these farms. Overall, 25% (35/140) of the horses, 7.3% (3/41) of the dogs, 3.8% (1/26) of the humans and 100% (5/5) of the opossums were seroreactive (titre ≥64) to spotted fever group (SFG) Rickettsia spp. Multivariate statistical analysis indicated that horses that were allowed to forage in the marsh were 4.8 times more likely to be seroreactive to spotted fever group (SFG) Rickettsia spp than horses that did not forage in the marsh. In addition, horses that had been living in the farm for more than 8.5 years were 2.8 times more likely to be seroreactive to SFG Rickettsia spp than horses that were living for ≤8.5 years. Ticks collected from domestic animals or from vegetation included Amblyomma cajennense, Amblyomma coelebs, Amblyomma dubitatum, Dermacentor nitens and Rhipicephalus microplus. By PCR analyses, only one pool of A. coelebs ticks from the vegetation was shown to be infected by rickettsiae, for which DNA sequencing revealed to be Rickettsia amblyommii. Ticks (not tested by PCR) collected from wildlife encompassed A. cajennense and Amblyomma rotundatum on lizards (Tupinambis sp), and A. cajennense and A. triste on the bird Laterallus viridis. Our results indicate that the marsh area of Paulicéia offers risks of infection by SFG rickettsiae. PMID:25643912

  15. Directory of Open Access Journals (Sweden)

    Fredrick M. Kivaria

    2012-09-01

    Full Text Available A cross-sectional study was conducted between September and October 2010 in five states of South Sudan that were selected on the basis of the perceived risk of tick-borne diseases. The purpose was to investigate epidemiological parameters of tick-borne diseases in South Sudan and their uses in future control strategies. A total of 805 calves were assessed by clinical, microscopic and serological examination and tick counts. The indirect Enzyme-Linked Immuno-Sorbent Assay (ELISA was used to detect antibodies to Theileria parva, Theileria mutans, Anaplasma marginale and Babesian bigemina. Sero-conversion risks for T. parva and T. mutans were 27.3% and 31.3% respectively, whilst the risk was 57.6% and 52.8% for A. marginale and B. bigemina, respectively. Major tick species identified include Rhipicephalus appendiculatus, Rhipicephalus decoloratus, Rhipicephalus microplus, Amblyomma variegatum, and Rhipicephalus evertsi. There was great variation (P ≤ 0.001 in the number of all these ticks, both between herds in a state and between calves in an individual herd. The low and intermediate sero-conversion risks observed in the study states suggest that immunisation against East Coast fever (ECF is justified. Fortunately, three major genotypes that were identified by applying Polymerase Chain Reaction Restriction Fragment Length Polymorphism (PCRRFLP analysis on the p104 to the blood samples and T. parva Muguga, matched very well with T. parva Kiambu 5 and T. parva Muguga; therefore the Muguga cocktail can be used for the immunisation of cattle in South Sudan. However, prospective studies are required to develop optimal control measures for tick-borne diseases under different ecological and husbandry practices in South Sudan.

  16. Babesia bovis and Babesia bigemina infection levels estimated by qPCR in Angus cattle from an endemic area of São Paulo state, Brazil.

    Science.gov (United States)

    Giglioti, R; Oliveira, H N; Santana, C H; Ibelli, A M G; Néo, T A; Bilhassi, T B; Rabelo, M D; Machado, R Z; Brito, L G; Oliveira, M C S

    2016-07-01

    The levels of infection by Babesia bovis and Babesia bigemina were estimated by absolute quantification through the quantitative PCR technique (qPCR). Fifty-one contemporaneous Angus cattle were evaluated on two occasions. The number of standard female Rhipicephalus microplus ticks present on the left side of the body was counted and blood samples were drawn from the tail vein into tubes containing the anticoagulant EDTA. The blood samples were submitted to DNA extraction and used to quantify the number of copies (NC) of DNA from B. bovis and B. bigemina by qPCR. The data on tick count and number of DNA copies were transformed for normalization and analyzed by a mixed model method. A multivariate model with repeated measures of the same animal, including the effects of collection, parasite species and their interaction, was used. The repeatability values were obtained from the matrix of (co)variances and were expressed for each species. The correlations between the counts of different species on the same animal, in the same collection or different collections, were also estimated. The results showed the qPCR could distinguish the two between infection by the two Babesia species. Infection levels by B. bovis and B. bigemina were detected in 100% and 98% of the animals, respectively. Significant differences were found (PDNA from B. bovis and B. bigemina and the tick counts suggests that the variation of parasitemia by the hemoparasites did not depend on the tick infestation levels at the moment of each collection. The repeatability values estimated indicate that under the study conditions, the variations in the tick infestation levels and of parasitemia by B. bovis and B. bigemina depend more on factors related to each collection than on intrinsic factors of the animal. PMID:26907097

  17. Modeling the impact of climate and landscape on the efficacy of white tailed deer vaccination for cattle tick control in northeastern Mexico.

    Science.gov (United States)

    Estrada-Peña, Agustín; Carreón, Diana; Almazán, Consuelo; de la Fuente, José

    2014-01-01

    Cattle ticks are distributed worldwide and affect animal health and livestock production. White tailed deer (WTD) sustain and spread cattle tick populations. The aim of this study was to model the efficacy of anti-tick vaccination of WTD to control tick infestations in the absence of cattle vaccination in a territory where both host species coexist and sustain cattle tick populations. Agent-based models that included land cover/landscape properties (patch size, distances to patches) and climatic conditions were built in a GIS environment to simulate WTD vaccine effectiveness under conditions where unvaccinated cattle shared the landscape. Published and validated information on tick life cycle was used to build models describing tick mortality and developmental rates. Data from simulations were applied to a large territory in northeastern Mexico where cattle ticks are endemic and WTD and cattle share substantial portions of the habitat. WTD movements were simulated together with tick population dynamics considering the actual landscape and climatic features. The size of the vegetation patches and the distance between patches were critical for the successful control of tick infestations after WTD vaccination. The presence of well-connected, large vegetation patches proved essential for tick control, since the tick could persist in areas of highly fragmented habitat. The continued application of one yearly vaccination on days 1-70 for three years reduced tick abundance/animal/patch by a factor of 40 and 60 for R. annulatus and R. microplus, respectively when compared to non-vaccinated controls. The study showed that vaccination of WTD alone during three consecutive years could result in the reduction of cattle tick populations in northeastern Mexico. Furthermore, the results of the simulations suggested the possibility of using vaccines to prevent the spread and thus the re-introduction of cattle ticks into tick-free areas. PMID:25047078

  18. Modeling the impact of climate and landscape on the efficacy of white tailed deer vaccination for cattle tick control in northeastern Mexico.

    Directory of Open Access Journals (Sweden)

    Agustín Estrada-Peña

    Full Text Available Cattle ticks are distributed worldwide and affect animal health and livestock production. White tailed deer (WTD sustain and spread cattle tick populations. The aim of this study was to model the efficacy of anti-tick vaccination of WTD to control tick infestations in the absence of cattle vaccination in a territory where both host species coexist and sustain cattle tick populations. Agent-based models that included land cover/landscape properties (patch size, distances to patches and climatic conditions were built in a GIS environment to simulate WTD vaccine effectiveness under conditions where unvaccinated cattle shared the landscape. Published and validated information on tick life cycle was used to build models describing tick mortality and developmental rates. Data from simulations were applied to a large territory in northeastern Mexico where cattle ticks are endemic and WTD and cattle share substantial portions of the habitat. WTD movements were simulated together with tick population dynamics considering the actual landscape and climatic features. The size of the vegetation patches and the distance between patches were critical for the successful control of tick infestations after WTD vaccination. The presence of well-connected, large vegetation patches proved essential for tick control, since the tick could persist in areas of highly fragmented habitat. The continued application of one yearly vaccination on days 1-70 for three years reduced tick abundance/animal/patch by a factor of 40 and 60 for R. annulatus and R. microplus, respectively when compared to non-vaccinated controls. The study showed that vaccination of WTD alone during three consecutive years could result in the reduction of cattle tick populations in northeastern Mexico. Furthermore, the results of the simulations suggested the possibility of using vaccines to prevent the spread and thus the re-introduction of cattle ticks into tick-free areas.

  19. Association of bovine Toll-like receptor 4 with tick infestation rates and blood histamine concentration.

    Science.gov (United States)

    Zhao, G; Yu, M; Cui, Q-W; Zhou, X; Zhang, J-C; Li, H-X; Qu, K-X; Wang, G-L; Huang, B-Z

    2013-01-01

    We investigated a possible association between bovine Toll-like receptor 4 (TLR4) and resistance to tick infestation in 103 cattle, including BMY cattle (1/2 Brahman, 1/4 Murray Grey, and 1/4 Yunnan Yellow cattle), Brahman, and Red Angus grazing on improved pasture. The tick infestation weight and number of Rhipicephalus microplus and the blood histamine concentration were measured and compared with those of 32 Chinese Holsteins and 30 Simmentals. A 228-bp fragment was amplified and sequenced to analyze the polymorphisms of the TLR4 gene. After SSCP and sequencing analysis, 4 SNPs, i.e., 535(A>C), 546(T>C), 605(T>A), and 618(G>C), were identified, corresponding to GenBank accession Nos. AY297041 and NW_003104150; the latter two SNPs caused Leu→Gln and Gln→His substitutions, respectively. Genotype AA was completely predominant in the Chinese Holstein and Simmental; genotypes AA and AB were detected in Red Angus, while genotypes AA, AB, BB, and BC were detected in Brahman and in BMY cattle. A negative correlation was identified between blood histamine concentration and number of tick infestation; in BMY cattle this negative association was significant. The tick infestation in cattle with genotype BB was significantly lower than in those with genotype AA. Blood histamine concentration in cattle with genotype BB was significantly higher than in those with genotype AA. The TLR4 gene mutation could affect the blood histamine level and activate the immune reaction after tick infestation. Allele B has potential as a molecular marker for tick-resistance originated from Zebu cattle for use in cattle breeding programs. PMID:23479166

  20. Targeted surface expression of an exogenous antigen in stably transfected Babesia bovis.

    Directory of Open Access Journals (Sweden)

    Jacob M Laughery

    Full Text Available Babesia bovis is a tick-borne intraerythocytic protozoan responsible for acute disease in cattle which can be controlled by vaccination with attenuated B. bovis strains. Emerging B. bovis transfection technologies may increase the usefulness of these live vaccines. One use of transfected B. bovis parasites may be as a vaccine delivery platform. Previous transfection methods for B. bovis were limited by single expression sites and intracellular expression of transfected antigens. This study describes a novel transfection system in which two exogenous genes are expressed: one for selection and the other for a selected antigen designed to be delivered to the surface of the parasites. The strategy for duplicating the number of transfected genes was based on the use of the putative bidirectional promoter of the B. bovis 1.4 Kb ef-1α intergenic region. The ability of this region to regulate two independent expression sites was demonstrated using a luciferase assay on transiently transfected B. bovis parasites and then incorporated into a stable transfection plasmid to control independent expression of the selectable marker GFP-BSD and another gene of interest. A chimeric gene was synthetized using sequences from the protective B-cell epitopes of Rhipicephalus microplus tick antigen Bm86 along with sequences from the surface exposed B. bovis major surface antigen-1. This chimeric gene was then cloned into the additional expression site of the transfection plasmid. Transfection of the B. bovis Mo7 strain with this plasmid resulted in stable insertion into the ef-1α locus and simultaneous expression of both exogenous genes. Expression of the Bm86 epitopes on the surface of transfected merozoites was demonstrated using immunofluorescence analyses. The ability to independently express multiple genes by the inclusion of a bidirectional promoter and the achievement of surface expression of foreign epitopes advances the potential of transfected B. bovis as