WorldWideScience

Sample records for book cover 2k7

  1. Data of evolutionary structure change: 1CLMA-2K7DA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2K7DA 1CLM 2K7D A A LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQN...PT-EAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA GQNPT-EAELQ

  2. Data of evolutionary structure change: 1CLMA-2K7CA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2K7CA 1CLM 2K7C A A LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQN...-PTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA SLGQN-PTEAE

  3. Gender representation in Christian book covers: A case study

    Directory of Open Access Journals (Sweden)

    Stella Viljoen

    2011-03-01

    Full Text Available In this article, we described how gender is represented on two Christian book covers by popular author, John Eldredge, namely Wild at Heart. Discovering the Secret to a Man�s Soul (2001 and Captivating. Unveiling the Mystery of a Woman�s Soul (2005. Through semiotic visual analysis, we explored how the active male�passive female opposition functions on these covers. This opposition is constructed by visually associating the male figure on the cover of Wild at Heart with active outdoor adventurism and the female figure on Captivating with passive situatedness in nature. The titles of the two books also contribute to positioning the male as active and the female as passive. We further investigated how certain myths are created on these covers in support of an active male�passive female opposition and its underlying ideologies. The cover of Wild at Heart creates and also taps into the colonial myth of conquest. The cover of Captivating creates and taps into the myth of the fairytale and visually represents the female figure in a whimsical manner, thus constructing her as a representation of the spiritual or divine. The article questioned the role this information design plays in prescribing the expectations of gendered identity.

  4. Analysis of Motions in Comic Book Cover Art: Using Pictorial Metaphors

    Directory of Open Access Journals (Sweden)

    Igor Juricevic

    2016-04-01

    Full Text Available Motion can be depicted using literal pictorial devices (representing features present in the real world and metaphorical pictorial devices (representing features that do not occur in the real world. How are literal and metaphorical pictorial devices used in comic book cover art? We analyzed the pictorial devices used to depict the motion 'running' in 400 Silver Age (1956–1971 and Bronze Age (c. 1970–1985 superhero comic book covers (Frankenhoff & Thompson, 2012. Literal devices (such as arm and leg positions were used additively; that is, artists preferred to use many literal devices. On the other hand, metaphorical devices (such as action lines were not used additively; artists preferred to use only one metaphorical device. We propose the Literal Additive Metaphorical One-And-Done (LA-MOAD theory to account for the use of literal and metaphorical devices in comic book cover art. The differential use of literal and metaphorical devices by comic book artists may be unique to comic book cover art, or it may reflect a basic function of our visual system. 

  5. Evaluating books by their covers. The influence of realism and complexity in photography on the appreciation by tweens

    NARCIS (Netherlands)

    Hartman, Lysette; Okken, Vanessa; Rompay, van Thomas

    2014-01-01

    This research is the first that examined tweens’ appreciation of the use of realism and complexity in photography on book covers for children. Additionally, the level of agreement between tweens’ preferences and what adults think tweens appreciate is explored. Data were obtained through questionnair

  6. Books

    Science.gov (United States)

    White, Daniel O.

    1973-01-01

    Reviews books and curriculum materials for law-related courses for public schools coordinated by the National Center for Law-Focused Education in Chicago. Police and police behavior is the focus of this review. (DM)

  7. Nicole Matthews & Nickianne Moody, eds., Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction.

    Directory of Open Access Journals (Sweden)

    Thomas Van Parys

    2010-01-01

    Full Text Available

     

    Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction

    Nicole Matthews & Nickianne Moody, eds.,

     

    Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction. Aldershot/Burlington: Ashgate, 2007.

    ISBN: 978-0-7546-5731-6

  8. Value of Traditional Elements Involved in Book Cover Design%书籍封面设计中传统元素的介入价值

    Institute of Scientific and Technical Information of China (English)

    钱昱霏

    2015-01-01

    目前,在图书市场一片繁荣的大环境中,书籍的封面设计变得尤为重要。在一定程度上,书籍封面设计的成功与否,直接决定了其内容是否能得到必要的关注,进而影响到其销售情况。在书籍封面设计中,传统元素的介入是一种富有美学价值和文化容量的“复古”,它不仅有助于打开书籍的销售市场,也拓展了封面设计美学的表现空间,并直接推动着中国传统文化与当前文化语境的融合。%At present,book cover design has become particularly important in the prosperous book mar-ket.To some extent,whether the cover design of a book is successful or not directly determines whether the content of this book can be paid necessary attention,and then will affect its sales.The involvement of traditional elements in book cover design is a renascence full of aesthetic value and cultural capacity.It will not only help to establish broader markets of book sales,and expand the representation space of cover de-sign aesthetics,but also drive forward the integration of the traditional culture and the current cultural con-text in China directly.

  9. Book Review: Book review

    Science.gov (United States)

    Manohar, C. S.

    2015-02-01

    The subject of the theory of vibrations has carried an aesthetic appeal to generations of engineering students for its richness of ideas, and for the intellectual challenges it offers. Also, the diverse range of its applications (covering civil, mechanical, automotive, and aerospace structures) has provided obvious motivations for its study. For most students, the subject provides, perhaps, the first encounter in substantial application of mathematical tools (differential equations, calculus of variations, Fourier/Laplace transforms, and matrix algebra) to engineering problems. The intimate relationship that the subject of mechanics has with mathematics strikes home probably for the first time. While teaching this subject, the instructor is spoilt for choice in selecting a text book and so are the students who wish to pursue a self-study of the subject. Many luminaries in the field have offered their own exposition of the subject: starting from the classics of Rayleigh, Timoshenko, Den Hartog, Bishop and Johnson, and the works of more recent vintage (e.g., the books by Meirovich, Clough, and Penzien, and works with computational flavour, such as, those by Bathe and Petyt), several works easily come to one's mind. Given this milieu, it requires a distinctive conviction to write a new book on this subject. And, here we have a book, written by a practitioner, which aims to deal with fundamental aspects of vibrations of engineering systems. The scepticism that this reviewer had on the need for having one more such book vanished as he browsed through the book and read selectively a few sections. The author's gift for elegant explanations is immediately noticeable even in such a preliminary reading. After a more careful reading, the reviewer has found this book to be insightful and he considers the book to be a welcome addition to the family of books on vibration engineering. The author has struck a fine balance between physical explanations, mathematical niceties

  10. Application of Text Exotic Form in Designing Book Cover%文字异域化形态在图书封面设计中的应用

    Institute of Scientific and Technical Information of China (English)

    张明平

    2016-01-01

    Book cover is an important component of a book.Texts are the most important and indispen-sable element of a book because accurately expressing the intention of authors in a book is inseparable from the text.Text of exotic unique form of expression offer people an unexpected sensory experi-ence,which shows a high concern value in the dissemination process.The author uses the exotic form to design as a starting point,first analyzes the design of a variety of concrete manifestation exotic styles such as distortion and exaggeration,knowing and pictograms,stacking,and combinations and then takes the design of Tibetan,Mongolian,and Korean as examples to explore the exotic form of a book cover design for reference for designers.%图书封面是书籍组成的重要部分,而文字又是图书中最不可缺少的重要元素,任何一本书要想准确表达作者的中心思想都离不开文字。文字异域化独特的表现形式,能给人一种意想不到的感官体验,在传播的过程中具有很高的关注价值。本文以文字异域化形态设计为切入点,首先分析了各种异域化设计风格的具体表现形式;如:变形和夸张、会意和象形、叠加与组合、提炼等;然后以藏文、蒙文、韩文等各种风格设计为例,探讨了异域化形态在图书封面设计中的具体结合方式,以供设计人员参考。

  11. Graphic Charm--The Graphics Art of Book Cover Design%图形之魅--论书籍封面设计中的图形艺术

    Institute of Scientific and Technical Information of China (English)

    明兰

    2013-01-01

      图形艺术是书籍封面设计中重要的视觉语言,随着科技的进步,图形艺术呈现出更为多样的形态和艺术表现力。本文通过阐述了摄影图片、绘画图形、抽象图形、图表化图形各自的艺术特色和魅力,阐述了书籍封面设计中的图形艺术达到形式与内容统一的重要性。%Graphics art is an important visual language in the book cover design, the progress of science and technology makes the graphics art show more diverse forms and artistic expression.The article expounds the artistic features and charm of the photographs, painting graphics, abstract graphics and infoGraphic, aimed at making the graphics art of book cover design to achieve the unity of form and content.

  12. Thinking outside the Book

    Science.gov (United States)

    Eaton, Dolores E.

    2012-01-01

    A title, a cover, and pages with "substance" bound together--this is what the author's eighth-grade students decided were the essential elements of a book. There could be more, but no less. In art, one does judge a book by its cover. In this article, the author describes how her students created their books. (Contains 1 online resource.)

  13. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    4th Dalai Lama Yundain GyamcoAuthored by 5th Dalai Lama and translated by Chen Qingying and Ma Lianlong, the book tells the life of the 4th Dalai Lama who was the only non-Tibetan among the various generations of the Dalai Lama.As he was the first reincarnated Mongolian Living Buddha of the Gelug Sect, he held an important position in the history of the Gelug Sect. His period was a period filled with social changes, and little historical materials are found to cover his period. Publication of the book, published by the Tapei All Buddhist Cultural Undertakings Co. Ltd., is obviously a must-read book.

  14. Book Review: Book review

    Science.gov (United States)

    van der Linden, Sebastian

    2016-05-01

    Compiling a good book on urban remote sensing is probably as hard as the research in this disciplinary field itself. Urban areas comprise various environments and show high heterogeneity in many respects, they are highly dynamic in time and space and at the same time of greatest influence on connected and even tele-connected regions due to their great economic importance. Urban remote sensing is therefore of great importance, yet as manifold as its study area: mapping urban areas (or sub-categories thereof) plays an important (and challenging) role in land use and land cover (change) monitoring; the analysis of urban green and forests is by itself a specialization of ecological remote sensing; urban climatology asks for spatially and temporally highly resolved remote sensing products; the detection of artificial objects is not only a common and important remote sensing application but also a typical benchmark for image analysis techniques, etc. Urban analyses are performed with all available spaceborne sensor types and at the same time they are one of the most relevant fields for airborne remote sensing. Several books on urban remote sensing have been published during the past 10 years, each taking a different perspective. The book Global Urban Monitoring and Assessment through Earth Observation is motivated by the objectives of the Global Urban Observation and Information Task (SB-04) in the GEOSS (Global Earth Observation System of Systems) 2012-2015 workplan (compare Chapter 2) and wants to highlight the global aspects of state-of-the-art urban remote sensing.

  15. Book Review: Book review

    Science.gov (United States)

    Wang, Christina Yan

    2017-02-01

    The world class Ni-Cu-PGE sulfide deposits associated with the Sudbury Igneous Complex (SIC) are quite unique on earth in the sense that the energy source and origin were triggered by a large meteorite impact event. The ore deposits in the SIC make up one of the largest Ni-Cu-PGE sulfide deposit camps in the world and have now been mined for over 100 years. This is the first complete reference book that focuses entirely on the SIC and covers the fields of economic geology, petrology, geochemistry and geophysics. The purpose of this book is to explore the linkage between sulfide and silicate magmas generated by the 1.85 Ga Sudbury impact event and to unite an understanding of the process of crustal melt sheet evolution with the formation of the magmatic sulfide mineralization. The author, Peter Lightfoot, has been based in Sudbury for 25 years. As a top scientist on magmatic Ni-Cu-PGE sulfide deposits and a Chief Geologist with the Brownfield Exploration group at Vale Base Metals, Peter has been positioned to develop and assemble the ideas presented in this book, which are perfectly balanced between industry and academia.

  16. The New Russian Book

    DEFF Research Database (Denmark)

    Pristed, Birgitte Beck

    This book takes up the obtrusive problem of visual representation of fiction in contemporary Russian book design. By analyzing a broad variety of book covers, the study offers an absolutely unique material that illustrates a radically changing notion of literature in the transformation of Soviet ...... the fields of Russian studies, contemporary book and media history, art, design, and visual studies.......This book takes up the obtrusive problem of visual representation of fiction in contemporary Russian book design. By analyzing a broad variety of book covers, the study offers an absolutely unique material that illustrates a radically changing notion of literature in the transformation of Soviet...... print culture to a post-Soviet book market. It delivers a profound and critical exploration of Russian visual imaginary of classic, popular, and contemporary prose. Among all the carelessly bungled covers of mass-published post-Soviet series the study identifies gems from experimental designers...

  17. Book Review: Book review

    Science.gov (United States)

    Mishchenko, Michael I.

    2017-01-01

    The second - revised and enlarged - edition of this popular monograph is co-authored by Michael Kahnert and is published as Volume 145 of the Springer Series in Optical Sciences. As in the first edition, the main emphasis is on the mathematics of electromagnetic scattering and on numerically exact computer solutions of the frequency-domain macroscopic Maxwell equations for particles with complex shapes. The book is largely centered on Green-function solution of relevant boundary value problems and the T-matrix methodology, although other techniques (the method of lines, integral equation methods, and Lippmann-Schwinger equations) are also covered. The first four chapters serve as a thorough overview of key theoretical aspects of electromagnetic scattering intelligible to readers with undergraduate training in mathematics. A separate chapter provides an instructive analysis of the Rayleigh hypothesis which is still viewed by many as a highly controversial aspect of electromagnetic scattering by nonspherical objects. Another dedicated chapter introduces basic quantities serving as optical observables in practical applications. A welcome extension of the first edition is the new chapter on group theoretical aspects of electromagnetic scattering by particles with discrete symmetries. An essential part of the book is the penultimate chapter describing in detail popular public-domain computer programs mieschka and Tsym which can be applied to a wide range of particle shapes. The final chapter provides a general overview of available literature on electromagnetic scattering by particles and gives useful reading advice.

  18. Book Review:

    Science.gov (United States)

    Gregory, Ruth

    2007-06-01

    The study of braneworlds has been an area of intense activity over the past decade, with thousands of papers being written, and many important technical advances being made. This book focuses on a particular aspect of braneworlds, namely perturbative gravity in one specific model: the Randall-Sundrum model. The book starts with an overview of the Randall-Sundrum model, discussing anti-de Sitter (AdS) space and the Israel equations in some detail. It then moves on to discuss cosmological branes, focusing on branes with constant curvature. The book then turns to brane gravity, i.e. what do we, as brane observers, perceive the gravitational interaction to be on the brane as derived from the actual five-dimensional gravitational physics? After a derivation of the general brane equations from the Israel equations, the remainder of the book deals with perturbative gravity. This part of the book is extremely detailed, with calculations given explicitly. Overall, the book is quite pedagogical in style, with the aim being to explain in detail the topics it chooses to cover. While it is not unusual to have books written on current and extremely popular research areas, it is unusual to have calculations written so explicitly. This is both a strength and a weakness of this book. It is a strength because the calculations are presented in a detail that students learning the topic will definitely appreciate; however, the narrow focus of the book also means that it lacks perspective and fails to present the broader context. In choosing to focus on one particular aspect of Randall-Sundrum branes, the book has not managed to communicate why a large number of theorists have worked so intensively on this model. In its early stages, the explicit detail of the Randall-Sundrum model would be extremely useful for a student starting out in this research area. In addition, the calculational detail later in the computation of the graviton propagator on the brane would also be welcome not

  19. Karriere, Alltag und Partnerschaft. Strukturen und Implikationen des glass ceiling Book cover Career, Daily Life, and Partnership: Structures and Implications of the Glass Ceiling

    Directory of Open Access Journals (Sweden)

    Hedwig Rudolph

    2007-11-01

    Full Text Available In dem Buch werden zum einen die strukturellen Rahmenbedingungen beleuchtet, mit denen Frauen in Führungspositionen konfrontiert sind, zum anderen ihre Lebensumstände dargestellt – jeweils im Vergleich zu ihren männlichen Kollegen. Im Hinblick auf die dokumentierten durchgängigen Differenzen zuungunsten von Frauen werden politische Gestaltungsvorschläge skizziert.This book illuminates the structural and external factors confronting women in executive positions and examines their living conditions in comparison to their male colleagues. The book sketches concepts for political change with respect to the continuing differences that have been documented as harming women.

  20. Book Review:

    Science.gov (United States)

    Botet, R.

    2004-09-01

    The second edition of Mathematical Methods for Physics and Engineering by Riley et al is a great scientific textbook. The reader should not be intimidated by its size - over 1200 pages - and skimming through it, one is confronted with a vast amount of information (which could be daunting for students). However, when reading it in detail one realizes that the number of pages is justified and the result is a self-contained reference on mathematical methods for physics. The book is well organized: it starts at basic university undergraduate level and progresses to the highest graduate level. It is a tour de force to write mathematical sections that are both complete and at a appropriate academic level; the sequence of sections (and their content) has been chosen with great care in order that each section may introduce the following ones. The authors have clearly succeeded with this challenge, making this a remarkable pedagogical book. No precise knowledge is needed at the beginning, and all the material is presented in a logical progression. The student can confidently follow the material as it is presented. Even though this book is devoted to physics and engineering, it can be used by students in other scientific fields. The material covered in the book concentrates on applied theorems and formulae. But as the title of the book indicates, it is primarily written 'for physics and engineering' so this is to be expected and it greatly simplifies the text of the course. Consequently, derivations of the main results are essentially 'for physicists'. Frequently proofs are briefly outlined and are not as detailed as many mathematicians would like. Nevertheless, the final results are always clearly stated together with the technical conditions under which they should be used, thus providing a very comprehensive and practical textbook. The only criticism is that the sections on probability and statistics do not fit comfortably between their previous and following sections

  1. Software engineer's pocket book

    CERN Document Server

    Tooley, Michael

    2013-01-01

    Software Engineer's Pocket Book provides a concise discussion on various aspects of software engineering. The book is comprised of six chapters that tackle various areas of concerns in software engineering. Chapter 1 discusses software development, and Chapter 2 covers programming languages. Chapter 3 deals with operating systems. The book also tackles discrete mathematics and numerical computation. Data structures and algorithms are also explained. The text will be of great use to individuals involved in the specification, design, development, implementation, testing, maintenance, and qualit

  2. Batik to Book

    Science.gov (United States)

    Tisinger, Betty

    1972-01-01

    Article describes how fifth- and sixth-graders first wrote Japanese Haiku poetry, then made books with batik covers. Materials needed and technique to follow are outlined, with photographs showing some details. (PD)

  3. Clever use of color in the children's books cover design%色彩在儿童书籍封面设计中巧妙运用

    Institute of Scientific and Technical Information of China (English)

    陈颖

    2015-01-01

    色彩对于儿童来说是一个美妙的世界,不同的色色彩给孩子们的感觉不一样.儿童书籍是孩子们的成长伙伴和良师益友,一本成功的儿童书籍设计离不开色彩的装饰,离开了色彩,就影响孩子们认知世界.结合儿童心理、生理、喜好等特点,探索色彩在儿童书籍中的运用.%Color is a wonderful world for children, different color for the children don't feel the same. Children's books is a children's growth partner and mentor, a successful children's book design is inseparable from the color decoration, leaving the color, the impact of the children's cognition of the world. According to children's psychological and physiological characteristics, etc, to explore the use of color in children's books.

  4. Weeded Books Inspire Student Art Projects

    Science.gov (United States)

    Lincoln, Margaret

    2004-01-01

    The rationale behind weeding books is to remove dated, obsolete, erroneous material and worn books in disrepair from the collection to make room for current titles. Students of Lakeview have discovered an innovative idea of creating an altered book from the weeded book by taking a hardcover book and changing the original cover by means of a…

  5. Book Review: Book review

    Science.gov (United States)

    Clevers, Jan G. P. W.

    2016-09-01

    For many years a good introductory book for undergraduate and postgraduate students on remote sensing of the Earth's land surface, which was not starting with an emphasis on traditional photographic techniques, was missing. In 2010 the first edition of the book Fundamentals of Satellite Remote Sensing by Emilio Chuvieco and Alfredo Huete was published by CRC Press and it was filling this gap. Now the second edition by Emilio Chuvieco was published by CRC Press. This second edition is made more attractive by the use of colour and including colour illustrations instead of the black-and-white ones in the first edition.

  6. Carter G. Woodson Book Awards.

    Science.gov (United States)

    Social Education, 2000

    2000-01-01

    Presents the recipients of the 1999 Carter G. Woodson book awards that honor books focusing on ethnic minorities and race relations that are appropriate for elementary and secondary levels. Includes books that cover topics such as life for Japanese Americans in internment camps and lives of 12 black women. (CMK)

  7. Book Review:

    Science.gov (United States)

    Folacci, Antoine; Jensen, Bruce

    2003-12-01

    bosonic fields are considered, the space of histories is an infinite-dimensional manifold and if fermionic fields are also present, it must be viewed as an infinite-dimensional supermanifold [3]. The fields can then be regarded as coordinates on these structures, and the geometrical notions of differentiation, metric, connections, measure, as well as the geodesics which can be defined on it, are of fundamental importance in the development of the formalism of quantum field theory. This is the so-called global approach to quantum field theory where time does not play any particular role, and quantization is then naturally realized covariantly using tools such as the Peierls bracket (a covariant generalization of Poisson bracket), the Schwinger variational principle and Feynman sums over histories. However, it should be noted that the boycott of canonical methods by DeWitt is not total: when he judges they genuinely illuminate the physics of a problem, he does not hesitate to descend from the global point of view and to use them. In a few words, we have in fact described the research program initiated by DeWitt forty years ago, which has progressively evolved in order to take into account the latest development of gauge theories. While the Les Houches Lectures of 1963 [1] were mainly concentrated on the formal structure and the quantization of Yang--Mills and gravitational fields, the present book also deals with more general gauge theories including those with open gauge algebras and structure functions, and therefore supergravity theories. More precisely, the book, more than a thousand pages in length, consists of eight parts and is completed by six appendices where certain technical aspects are singled out. An enormous variety of topics is covered, including the invariance transformations of the action functional, the Batalin--Vilkovisky formalism, Green's functions, the Peierls bracket, conservation laws, the theory of measurement, the Everett (or many worlds

  8. Electronics engineer's reference book

    CERN Document Server

    Turner, L W

    1976-01-01

    Electronics Engineer's Reference Book, 4th Edition is a reference book for electronic engineers that reviews the knowledge and techniques in electronics engineering and covers topics ranging from basics to materials and components, devices, circuits, measurements, and applications. This edition is comprised of 27 chapters; the first of which presents general information on electronics engineering, including terminology, mathematical equations, mathematical signs and symbols, and Greek alphabet and symbols. Attention then turns to the history of electronics; electromagnetic and nuclear radiatio

  9. Book Review: Book review

    Science.gov (United States)

    Pulte, Helmut

    In his Erkenntnisproblem, Ernst Cassirer described Heinrich Hertz (1857-1894) as the first great physicist who consequently elaborated a both hypothetical and objective concept of scientific theory, i.e. an understanding of physical theory, which combines a logical rigorous analysis of the different possibilities of conceptual foundation with a carefully thought-out renunciation of absolute truth for one of these possibilities. This judgment mainly refers to Hertz's book Die Prinzipien der Mechanik, in neuem Zusammenhange dargestellt (1894), which was the main result of his scientific research during the last 3 years of his short life.

  10. Book Review:

    Science.gov (United States)

    Webb, Steve

    2008-11-01

    life and is a condensed history of the development of nuclear physics, political changes and world affairs over the period. It is succinctly arranged and the reader is taken remarkably rapidly through the salient details of the above story in a most readable way. The author states that his intention for the book is to bring the story to a much wider audience than those who work in nuclear or medical physics. Indeed he hopes it will be read by those who might call themselves non-scientists and also young people who might be inspired to pursue a career in physics. Throughout the book salient physics is compartmentalised into bite-sized boxes and explained through analogy, simple diagrams and hardly an equation in sight. Thus one such box entitled 'How to make Nukes work!' should not alarm readers or anti-terror watchdogs. The barest of information is given at all stages; just enough to follow the Rotblat story. In essence the book will be of most use to those who have only the vaguest ideas of the above story. Readers expecting a definitive, well-referenced, chronological tome, backed by a substantial bibliography of primary peer-reviewed papers, will be disappointed. Kit Hill points though to such a definitive work published two years ago by the University of Liverpool. This reviewer felt that maybe the book is a little too thin and in places longed for rather more substance and detail. The author would surely, in his defence, say 'look elsewhere'. This said, it can easily be read cover to cover in one short evening sitting. In a world burgeoned with paperwork to read, that might be considered an advantage. A second disappointment is that there is virtually nothing on the productivity of Rotblat over 30 years as Professor of Medical Physics. This reviewer feels that is a lost opportunity. Kit Hill, personal friend of Jo Rotblat and co-worker with Pugwash, was himself in a similar role (though working mainly with non-ionizing ultrasound radiation) and could have made his

  11. Book Review:

    Science.gov (United States)

    Poisson, E.

    2006-09-01

    The motion of a charged particle interacting with its own electromagnetic field is an area of research that has a long history; this problem has never ceased to fascinate its investigators. On the one hand the theory ought to be straightforward to formulate: one has Maxwell's equations that tell the field how to behave (given the motion of the particle), and one has the Lorentz-force law that tells the particle how to move (given the field). On the other hand the theory is fundamentally ambiguous because of the field singularities that necessarily come with a point particle. While each separate sub-problem can easily be solved, to couple the field to the particle in a self-consistent treatment turns out to be tricky. I believe it is this dilemma (the theory is straightforward but tricky) that has been the main source of the endless fascination. For readers of Classical and Quantum Gravity, the fascination does not end there. For them it is also rooted in the fact that the electromagnetic self-force problem is deeply analogous to the gravitational self-force problem, which is of direct relevance to future gravitational wave observations. The motion of point particles in curved spacetime has been the topic of a recent Topical Review [1], and it was the focus of a recent Special Issue [2]. It is surprising to me that radiation reaction is a subject that continues to be poorly covered in the standard textbooks, including Jackson's bible [3]. Exceptions are Rohrlich's excellent text [4], which makes a very useful introduction to radiation reaction, and the Landau and Lifshitz classic [5], which contains what is probably the most perfect summary of the foundational ideas (presented in characteristic terseness). It is therefore with some trepidation that I received Herbert Spohn's book, which covers both the classical and quantum theories of a charged particle coupled to its own field (the presentation is limited to flat spacetime). Is this the text that graduate students

  12. Book Review:

    Science.gov (United States)

    Poisson, E.

    2005-10-01

    The ever growing relevance of general relativity to astrophysics and cosmology continues to motivate the publication of new textbooks which put the theory in a fresh perspective informed by recent developments. In the last few years we have witnessed the appearance of two new books which reflect this trend, and which stand proud among the classic relativity texts. While the 1970s were the decade of Weinberg [1] and Misner et al [2], and the 80s the decade of Schutz [3] and Wald [4], this is clearly the decade of Hartle [5] and Carroll. Hartle has introduced a novel pedagogical approach to teaching general relativity, which he convincingly argues [6] should be done in the standard undergraduate physics curriculum. His 'physics-first approach' emphasizes physical phenomena and minimizes mathematical formalism. Hartle achieves a lot by introducing only the spacetime metric and the geodesic equation, which are the main tools needed to explore curved spacetime and extract physical consequences. To be sure, to explain how the metric is obtained in the first place does require a background of differential geometry and the formulation of the Einstein field equations. But in Hartle's book this material is wisely presented at a later stage, after an ample sampling of the physics of curved spacetime has motivated the need for the advanced mathematics. Carroll follows instead the traditional route, what Hartle calls the 'math-first approach', in which one introduces first the required mathematical formalism and only then derives the physical consequences. He is, of course, in good company, as this is the method followed in all existing textbooks (with Hartle's being the sole exception). Carroll's approach may not be original, but it is tried and true, and the result of Carroll's efforts is an excellent introduction to general relativity. The book covers the standard topics that would be found in virtually all textbooks (differential geometry, the field equations, linearized

  13. Book Reviews.

    Science.gov (United States)

    Powicke, J. C.; And Others

    1986-01-01

    Reviews of 10 recent books and one new journal ("Catalyst: A Journal of Policy Debate") are provided. Topics of the books reviewed include: economics in modern Britain, world economics, the mixed economy, Milton Friedman's thought, British industry, economic issues, and London as a financial center. (JDH)

  14. Book Bonding.

    Science.gov (United States)

    Elleman, Barbara

    1998-01-01

    Discusses nine books (fiction, nonfiction, and poetry) for children that center on bats. Focuses on one book ("Silverwing") as an example of the animal fantasy genre, which can tell the adventures of a particular animal, impart environmental knowledge and concerns, and include intriguing, solid facts about the animal in question. Offers…

  15. Professional Books.

    Science.gov (United States)

    Gilstrap, Robert L.

    1994-01-01

    Reviews five books: "Garbage Pizza, Patchwork Quilts and Math Magic" (Ohanian), about elementary math instruction; "Ready for What?" (Graue), on school readiness; "The Braid of Literature: Children's Worlds of Reading" (Wolf and Heath); "The Best Years of Their Lives" (Zvirin), a book of resources for teenagers; and "Teaching and Learning in the…

  16. Newnes electronics engineers pocket book

    CERN Document Server

    Brindley, Keith

    2013-01-01

    This book is packed with information and material which everyone involved in electronics will find indispensable. Now when you need to know a transistor's characteristics, or an integrated circuit's pinout details, simply look it up! The book is full of tables, symbols, formulae, conversions and illustrations.Promotion via the new Newnes Pocket Book catalogue to the electronics trade will drive sales into the book trade Covers component data; encapsulations; pin-outs; symbols & codings Extensive material on conversion factors, formulae; units and relationships

  17. Mechanical engineer's reference book

    CERN Document Server

    Parrish, A

    1973-01-01

    Mechanical Engineer's Reference Book: 11th Edition presents a comprehensive examination of the use of Systéme International d' Unités (SI) metrication. It discusses the effectiveness of such a system when used in the field of engineering. It addresses the basic concepts involved in thermodynamics and heat transfer. Some of the topics covered in the book are the metallurgy of iron and steel; screw threads and fasteners; hole basis and shaft basis fits; an introduction to geometrical tolerancing; mechanical working of steel; high strength alloy steels; advantages of making components as castings

  18. Electronics engineer's reference book

    CERN Document Server

    Mazda, F F

    1989-01-01

    Electronics Engineer's Reference Book, Sixth Edition is a five-part book that begins with a synopsis of mathematical and electrical techniques used in the analysis of electronic systems. Part II covers physical phenomena, such as electricity, light, and radiation, often met with in electronic systems. Part III contains chapters on basic electronic components and materials, the building blocks of any electronic design. Part IV highlights electronic circuit design and instrumentation. The last part shows the application areas of electronics such as radar and computers.

  19. Electrical engineer's reference book

    CERN Document Server

    Jones, G R

    2013-01-01

    A long established reference book: radical revision for the fifteenth edition includes complete rearrangement to take in chapters on new topics and regroup the subjects covered for easy access to information.The Electrical Engineer's Reference Book, first published in 1945, maintains its original aims: to reflect the state of the art in electrical science and technology and cater for the needs of practising engineers. Most chapters have been revised and many augmented so as to deal properly with both fundamental developments and new technology and applications that have come to the fore since

  20. Newnes electrical pocket book

    CERN Document Server

    Reeves, E A

    2013-01-01

    Newnes Electrical Pocket Book, Twenty-first Edition, provides engineers with convenient access to various facts, tables, and formulae relating to the particular branch of engineering being dealt with. In the case of electrical engineering, it is essential that the engineer have a clear understanding of the methods by which the various formulae are derived to ensure that any particular formulae is applicable to the conditions being considered. The first section of the Pocket Book is devoted to the theoretical groundwork upon which all the practical applications are based. This covers symbols,

  1. Electronics pocket book

    CERN Document Server

    Parr, E A

    1981-01-01

    Electronics Pocket Book, Fourth Edition is a nonmathematical presentation of the many varied topics covered by electronics. The book tackles electron physics, electronic components (i.e. resistors, capacitors, and conductors), integrated circuits, and the principles of a.c. and d.c. amplifiers. The text also discusses oscillators, digital circuits, digital computers, and optoelectronics (i.e., sensors, emitters, and devices that utilize light). Communications (such as line and radio communications, transmitters, receivers, and digital techniques); the principles and examples of servosystems; a

  2. Nightmare book

    Science.gov (United States)

    judithku; jajustin; tyler, d.

    2017-02-01

    In response to Kate Brown's review of Kate Moore's book The Radium Girls, which tells the depressing but important tale of female radium-dial painters in the early 1900s who contracted radiation poisoning.

  3. Reviews: Books.

    Science.gov (United States)

    Weiss, Bretta; And Others

    1993-01-01

    Reviews three books: "The Schoolhome: Rethinking Schools for Changing Families," by Jane Martin; "Godly Play," by Jerome Berryman; and "Five Kingdoms: An Illustrated Guide to the Phyla of Life on Earth," by Margulis and Schwartz. (TJQ)

  4. Orange Book

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Approved Drug Products with Therapeutic Equivalence (Orange Book or OB) is a list of drugs approved under Section 505 of the Federal Food, Drug and Cosmetic Act...

  5. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2012-01-01

    Full Text Available The second edition of Computational Physics by Rubin Landau, Manuel Paez and Cristian C. Bordeianu (published by Wiley hit bookshelves in 2007, and is steadily making its way into physics classrooms across the United States. Your reviewer first encountered the book at the Stanford Campus Book Store, where it is presumably being put to good use by students and faculty. The first edition was published in 1997 with Landau and Paez as authors [Computational Physics, 1st edn, Wiley, New York, 1997]. Rubin Landau is a very experienced computational physicist and staff member of the Oregon State University in Corvallis, where he directs the Computational Physics for Undergraduates course and teaches using this book. Landau is an incredibly active teacher to put it mildly – the code for the book is supplied in an accompanying DVD and he also posts applets and video lectures for his courses on his web page (http://www.physics.orst.edu/~rubin/.

  6. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang Liwei-China's First Astronaut; and Chronology of the First Manned Space Flight. The book is appended with Memorabilia of China'...

  7. MacBook Teach Yourself VISUALLY

    CERN Document Server

    Miser, Brad

    2010-01-01

    Like the MacBook itself, Teach Yourself VISUALLY MacBook, Second Edition is designed to be visually appealing, while providing excellent functionality at the same time. By using this book, MacBook users will be empowered to do everyday tasks quickly and easily. From such basic steps as powering on or shutting down the MacBook, working on the Mac desktop with the Dashboard and its widgets to running Windows applications, Teach Yourself VISUALLY MacBook, Second Edition covers all the vital information and provides the help and support a reader needs—in many ways it's like having a Mac Genius at

  8. Book Review:

    Science.gov (United States)

    Borcherds, P. H.

    2004-09-01

    There is a new tradition in England called Apple Day which is held on some day in October. The actual day varies from place to place. For instance, in 2003, 23 October was Apple Day at Woolsthorpe Manor, the house where Isaac Newton was born and where, during the Plague, he is said to have developed the theory of gravity. (For information on future Apple Days see, for example, http://www.nationaltrust.org.uk/main/thingstodo.) Last year in our garden we picked an apple which weighed one pound, thirteen and a half ounces (1 lb 13 1/2 oz or 29 1/2 oz). The following day we went to an Apple Day event where there were many exotic apples on display, varieties which are not sold in shops. One of the varieties there was called 'Twenty Ounce'. By now you may be wondering what all this has to do with the book being reviewed. We shall return to this later. This entertaining book is ostensibly about units, in particular about Imperial and metric units, but there are numerous informative digressions. The author reminds us that almost every country 'with the exception of the United States, North and South Yemen, Burma and Brunei' has gone metric. He points out that the United States (US) became officially metric in 1893. However, as early as 1866, the US legal definition of the metre was 39.370000 inches. He tells us that after World War II the (US) inch was rounded down (from 25.400051) to 25.4 mm. There is no mention that the Imperial (British) inch was simultaneously rounded up from 25.399956 mm to 25.4 mm. The author frequently digresses, covering such matters as the trisection of angles and Eratosthenes' graphic solution for duplicating the cube. There is an informative discussion on the length of the day: appropriately 25 December, which lasts for 24 h and 30 s, is the longest day. He shows how with cycles and epicycles one can construct an ellipse. Ptolemy did not realize the importance of the focus of the ellipse. The author discusses various topics in the development of

  9. Electronic book – paperless book

    Directory of Open Access Journals (Sweden)

    Mateja Ločniškar-Fidler

    2003-01-01

    Full Text Available The article presents the electronic book, which is accessible on the Internet, with particularities and drawbacks that the present and future users and librarians may encounter.It also presents devices (such as scanners and hand-helds and software required for reading and designing electronic books, as well as the details we should pay attention to when buying and using the above mentioned devices. Some of the most significant web pages dedicated to the selling and promoting of electronic books are also presented. The protection of authors’ works, distributed via the Internet and digital media, is gaining importance. In September 1999, Slovenia also joined the international agreement on the protection of copyrights. It is expected that electronic books will gradually become part of the collection of all types of libraries. Therefore, libraries will need appropriate technical equipment as well as trained personnel for the usage of this new medium.

  10. Book Review:

    Science.gov (United States)

    Fulling, S. A.

    2006-05-01

    saying that gravity was not only an honourable member of the forces of nature, but ultimately the source of them all. It has become a cliche that the unification of relativity with quantum theory is the central problem of contemporary physics. In the 1950s, before strings, non-Abelian monopoles, or even quasars, Bryce DeWitt was applying the quantum-field-theoretical methods and conceptual framework of his mentor, Julian Schwinger, to gravity. His central insight was that the conceptual and technical problems of quantum gravity were closely analogous to those of gauge theories. He developed a unified, relentlessly abstract, and highly personal vision of the fundamentals of physical theory. It was, and is, expressed in idiosyncratic and condensed notation often different from the languages of mainstream field theorists, traditional relativists, and mathematicians alike. In short, he has never been easy reading. His ideas were systematically presented in famous lecture series at the Les Houches summer schools on Relativity, Groups and Topology in 1963 [1] and 1983 [2], the book Supermanifolds [3], and a number of (relatively) shorter expositions that have been widely read. By the middle 1970s the methods that he had developed mainly for gravity were widely recognized as very useful for Yang Mills gauge theories, and his work had become part of the mainstream. Now, another 20 years after the second Les Houches, we have this final testament of Bryce DeWitt's ideas. At over 1000 pages in two volumes in a fabric-covered slipcase, it is the sort of work usually described as 'magisterial' (meaning, perhaps, 'no one has yet succeeded in reading it all the way through'). Over the years, of course, DeWitt learned many new things and thought of ways to say the old things better. Accordingly, the new books consist of reworkings of the most important parts of the older writings together with some new material. Oxford University Press is to be thanked and congratulated for the care it

  11. Book Review

    Science.gov (United States)

    Mishchenko, Michael I.

    2016-08-01

    The main purpose of this exemplary book is to provide a systematic exposition of the entire field of optical tweezers and their applications. The book is divided into three (approximately equal) parts summarizing the electromagnetic theory of optical tweezers (Part I), the practice of designing and building optical tweezers (Part II), and extensive applications of optical tweezers in various branches of science (Part III). The exposition is highly methodical and addresses the needs of anyone dealing with optical tweezers, be it a theoretician, an engineer/experimentalist, a routine practitioner, or an interested scientist.

  12. Tv & video engineer's reference book

    CERN Document Server

    Jackson, K G

    1991-01-01

    TV & Video Engineer's Reference Book presents an extensive examination of the basic television standards and broadcasting spectrum. It discusses the fundamental concepts in analogue and digital circuit theory. It addresses studies in the engineering mathematics, formulas, and calculations. Some of the topics covered in the book are the conductors and insulators, passive components, alternating current circuits; broadcast transmission; radio frequency propagation; electron optics in cathode ray tube; color encoding and decoding systems; television transmitters; and remote supervision of unatten

  13. Ban the Book Report: Promoting Frequent and Enthusiastic Reading

    Science.gov (United States)

    Foster, Graham

    2012-01-01

    Teachers recognize that frequent independent reading increases student knowledge on a wide range of topics, enhances vocabulary, and improves comprehension. "Ban the Book Report" inspires teachers to go beyond narrow and analytical book reports by exploring the potential of book talks, alternate book covers, identifying features of informational…

  14. Google Book Search: The Good, the Bad, & the Ugly

    Science.gov (United States)

    Schaffhauser, Dian

    2008-01-01

    Google is opening up whole new worlds for internet surfers and researchers everywhere. Google Book Search (books.google.com), which is still in beta after several years of testing, offers the ubiquitous Google search box on its home page. It also has categories of books as well as book cover images that refresh every time the home page is…

  15. Thin book

    DEFF Research Database (Denmark)

    En lille bog om teater og organisationer, med bidrag fra 19 teoretikere og praktikere, der deltog i en "Thin Book Summit" i Danmark i 2005. Bogen bidrager med en state-of-the-art antologi om forskellige former for samarbejde imellem teater og organisationer. Bogen fokuserer både på muligheder og...

  16. Book reviews

    NARCIS (Netherlands)

    NN,

    1961-01-01

    H.H. Allan, Flora of New Zealand. Vol. 1, 1961, liv + 1085 pp., 40 text figs., 4 end paper maps. Owen, Wellington. The author died in 1957; this volume, which contains the pteridophytes, gymnosperms, and dicots, was seen through the press by Lucy B. Moore. The book weighs no more than 560 grams, so

  17. Book Reviews.

    Science.gov (United States)

    Cole, Michael; And Others

    1993-01-01

    Reviews four books: (1) "On Intelligence. . .More or Less: A Bioecological Treatise on Intellectual Development" (Stephen J. Ceci); (2) "Knowing Children: Experiments in Conversation and Cognition" (Michael Siegal); (3) "Adolescents and Their Families: Paths of Ego Development" (S. T. Hauser and others); and (4) "Adolescence: An Anthropological…

  18. Book reviews

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is dedicated to the world-known specialist in marine mycology, E. B. Gareth Jones on the occasion of his 65th birthday, for his substantial contribution to marine mycology. It contains 22 contributions by a multitude of authors, grouped around the central theme of Fungi in marine environme

  19. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang

  20. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the

  1. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    This book is a concise and rewritten version of the author’s ‘Anatomie der Hymenomyceten’, published in 1997 by Koeltz Verlag (CH), which, unfortunately, never has been reviewed in this journal. In almost 500 pages the author leads us through the exciting world of the anatomy, cytology, and histolog

  2. Book fair

    CERN Multimedia

    2006-01-01

    The Swiss academic publishing house 'Presses Polytechniques Universitaires Romandes'will be presenting its most recent scientific and technical publications at a book fair in the lobby of the Main Building (60) from 10 a.m. to 4 p.m. on Thursday 28 September 2006.

  3. Book Reviews.

    Science.gov (United States)

    Joyner, Christopher C.; And Others

    1986-01-01

    Scholarly reviews of nine books are presented. Topics include nuclear deterrence, urban planning in France, human rights in the Republic of China, the United States' support of Israel, U. S. military policy, an analysis of Rousseau's social contract, political influences on the U. S. presidency, the state and political theory, and the loss of…

  4. Digital books.

    Science.gov (United States)

    Wink, Diane M

    2011-01-01

    In this bimonthly series, the author examines how nurse educators can use the Internet and Web-based computer technologies such as search, communication, and collaborative writing tools; social networking and social bookmarking sites; virtual worlds; and Web-based teaching and learning programs. This article describes digital books.

  5. BOOK REVIEW

    Institute of Scientific and Technical Information of China (English)

    CHEN Shuaifeng; ZHANG Yun

    2011-01-01

    @@ The generic term"Chinese tradition"can be viewed from various perspectives.One thinks first of classic texts like The Four Books and The Five Classics,or the poetry of the Tang and the Song,as key parts of the genealogy of the "Chinese tradition."

  6. Book Reviews.

    Science.gov (United States)

    Eron, Leonard D.; And Others

    1994-01-01

    Reviews six books on developmental psychology: (1) "Children and Violence" (David Reiss and others); (2) "Television and the American Child" (George Comstock); (3) "Intellectual Development" (Robert Sternberg and Cynthia Berg); (4) "Context and Development" (Robert Cohen and Alexander Siegel); (5) "Adolescent Identity Formation" (Gerald Adams and…

  7. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA’S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China’s manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems

  8. Electronic Books

    Science.gov (United States)

    Clyde, Laurel A.

    2005-01-01

    Terje Hillesund points out that "information technology and especially the Internet have profoundly changed the ways of publishing." Recently, the book publishing industry has started to catch up, making digitized texts--including multimedia texts--available for sale through online bookstores, and in some cases, available for free downloading.…

  9. Recommended Books

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Book 1: (Editor-in-Chief: Shi Yafeng; Published by Elsevier and Science Press Beijing in 2008, 539 pages) Glaciers and Related Environments in China Since the professional institution for glaciology attached to the Chinese Academy of Sciences was established in 1958, studies of glaciers in alpine regions, and of Quaternary glaciations throughout

  10. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    Since the publication of the first edition of this book, important developments in biotechnology and mushroom production made a new, revised version necessary. As it is written for the mushroom industry, it emphasizes on nutritional, medical, and cultivating aspects of edible and medicinal fungi. A

  11. Book Reviews.

    Science.gov (United States)

    Coates, Elizabeth; And Others

    1993-01-01

    Reviews three books: (1) "Jeux Populaires Traditionnels pour les Enfants d'aujourd'hui" (Traditional Popular Games for Today's Children) (Jacqueline Theriault and Denise Garon); "Early Childhood Education" (B. Persky and L. Golubchick, editors); and "Playing to Learn: The Young Child, Teacher and the Classroom" (Weininger and Daniel). (AC)

  12. Book notice

    NARCIS (Netherlands)

    Adema, Frits

    1999-01-01

    FOCKO WEBERLING & WILHELM TROLL: Die Infloreszenzen Band II, Teil 2, Monotele und polytele Synfloreszenzen. Gustav Fischer Verlag, Jena, Germany, 1998. 483 pp., illus. ISBN 3-437-35436-1. Price: DEM 238. A new volume in the monumental series of books on inflorescences in the tradition of Troll’s mor

  13. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Zhang Jingwu and Tibetan Liberation The Research Office of Party History of the Committee of the Tibet Autonomous Region edited this book. In the 1950s, Zhang Jingwu received orders to Tibet. He was designated as the representative of the Central Government

  14. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Selected Works on Historical Documents of Tibet (XXI);Collection of Journals on Tibetan Studies;Guidance to Traditional Architecture in Tibet;Concise History of Tibetan Music;Concise History of Tibetan Fine Arts;Series Books on Himalayas;Trekking in Tibet。

  15. Books Reviews

    OpenAIRE

    家本, 秀太郎

    1998-01-01

    Books Reviewed: "The Balance of Payments: Free Versus Fixed Exchange Rates"; "The Economics of Irrigation"; "Farmers and a Hungry World"; "French and EEC Grain Policies and Their Price Effects, 1920-1970"; "Growth and Structure in the Economy of Modern Italy"; "Production Yearbook 1966"; "The Cotton Industry: An Essay in American Economic History. Part I. The Cotton Culture and the Cotton Trade"

  16. Book Reviews.

    Science.gov (United States)

    Lance, Larry M.; And Others

    1987-01-01

    Reviews the following Human Sexuality books: "Taking Sides: Clashing Views on Controversial Issues in Human Sexuality" (Francoeur, R.T., 1987); "Annual Editions: Human Sexuality" (Pocs, O., 1987); "Personal Issues in Human Sexuality" (Gordon, S. and Snyder, W., 1986); "Journey Into Sexuality: An Exploratory Voyage" (Reiss, I.L., 1986); and…

  17. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Study of Nuns of Tibetan Buddhism Nuns constitute a part of members of Tibetan Buddhism. Recent years have seen more girls and women apply to be nuns. Studying the why and the female body of the members of Tibetan Buddhism is therefore of practical significance. Authored by Degyi Zholma, the book provides a panoramic description of nuns, including history and status quo. To write

  18. BOOK REVIEWS

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    This book by Professor Chen Yunü is a multi-faceted study of Buddhism during the Ming dynasty (1368-1644).The aim of the research as stated by the author is to clarify the social role of Buddhist institutions during that period and to explicate the "laicization" of Buddhism during the Ming (pp.30-31).

  19. Book review

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is entirely dedicated to the functional role of fungi in all kind of ecosystems, and it attempts to show how the world would function if fungi were not there. It is conceived as an introduction to the subject for students in mycology and ecology. The introductory chapters deal with fundame

  20. Book Review:

    Science.gov (United States)

    Fallone, B. G.

    2004-01-01

    This book represents the proceedings of the five day programme on IMRT techniques presented at the 2003 American Association of Physicists in Medicine (AAPM) Summer School held in Colorado Springs, Colorado. The book is essentially an overview of IMRT techniques, discussing the history, the mathematical processes involved in the planning stages, the biological indices for evaluations, the off-line and on-line medical imaging that is required, the various IMRT delivery techniques available, positioning and motion verification, shielding and QA issues, and some clinical applications. There is some additional discussion on modulated electron and proton therapy, views on the clinical and financial impact of IMRT, as well as some speculation on the future uses of IMRT. The fact that the book is an `overview' must be emphasized. Medical physicists who are well-read in IMRT, or have implemented IMRT, even partially, may be a little disappointed with the book. Although specific details were purposely omitted, the well-read physicist would have preferred to go right to the `heart of the matter', something this book fails to do. As is typical of many proceedings-type books, there is a certain level of inconsistency of writing styles, as well as some redundancy between the different chapters. It is unfortunate that such a large volume does not have an index to allow a reader to explore a particular subject pertaining to IMRT. The reader would have to guide himself/herself by the table of contents before each chapter which could be a problem if the reader requires some information quickly. It is interesting to note that the book lends itself to a variety of professionals interested in IMRT, including administrators. It may be a source of help for medical physicists who wish to discuss IMRT issues with higher level administration, for example. Some clinical applications are also reviewed. The lack of details concerning the advantages of IMRT with respect to clinical outcome is

  1. Teach yourself visually MacBook Pro

    CERN Document Server

    Hart-Davis, Guy

    2014-01-01

    Clear instructions to help visual learners get started with their MacBook Pro Covering all the essential information you need to get up to speed with your MacBook Pro, this new edition provides you with the most up-to-date information on performing everyday tasks quickly and easily. From basics such as powering on or shutting down the MacBook Pro to more advanced tasks such as running Windows applications, this visual guide provides the help and support you need to confidently use your MacBook Pro to its full potential.Empowers you to perform everyday tasks quickly and easilyCovers new hardwa

  2. Land Cover

    Data.gov (United States)

    Kansas Data Access and Support Center — The Land Cover database depicts 10 general land cover classes for the State of Kansas. The database was compiled from a digital classification of Landsat Thematic...

  3. Book Review

    Science.gov (United States)

    Tanona, Scott

    There is more to this book than readers of this journal might expect from an author who has associated Bohr and Heisenberg with Derrida and Lacan (Plotnitsky, 1994, 2002). Plotnitsky has written in the past on trying to bridge the "two cultures" of the "science wars" by defending Derrida and others against what he perceives to have been too-quickly dismissive critiques (Plotnitsky, 1997), but he has not provided an extended philosophical analysis of Bohr to support the connections he has made. This book seems to be an attempt to engage in a careful analysis of Bohr in a way meant to satisfy critical readers and also support what he here calls "nonclassical epistemology".

  4. Book Review

    Directory of Open Access Journals (Sweden)

    Peralam Yegneswaran Prakash

    2016-08-01

    Full Text Available Since its primary release in 1992 and a second version in 2007 the book ‘Descriptions of Medical Fungi’ has been impressively advanced in its utility for identification of fungi. The initial editions of this book titled ‘Descriptions of Medical QAP Fungi’ were prepared as description sheets to facilitate identification of fungi at participant laboratories in the Royal College of Pathologists of Australasia (RCPA Mycology Quality Assurance Program (QAP. Keeping pace with the major shifts in fungal nomenclature, an updated and refurbished third edition is now available. The authors have attempted to reconcile and portray the present-day morphological description of medically important fungi with supplementary phylogenetic studies.

  5. Book Reviews

    OpenAIRE

    Adrianus Koster; Peter Gathercole; Simon Kooijman; Roland Werner; P.E. de Josselin de Jong; John Ingleson; C.K. Jonker-de Putter; M. Jacq-Hergoualc’h; R. Hagesteijn; William Wood; B.G. Grijpstra; Robert Wessing; D.C. Geirnaert-Martin; Carl Lumholtz; P. van Emst

    1981-01-01

    - H.J.M. Claessen, David Lewis, From Maui to Cook: The discovery and settlement of the Pacific, Drawings by Walter Stackpool. Sydney: Doubleday, 1977. Bibliography. - P. van Emst, Carl Lumholtz, Among Cannibals. An account of four years travel in Australia and of camp life with the aborigines of Queensland. Firle: Caliban Books. 383 pp. Maps, illustrations and index. Reprinted from the first edition, London: John Murray. - D.C. Geirnaert-Martin, Robert Wessing, Cosmology and social behaviour ...

  6. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang Liwei-China's First Astronaut; and Chronology of the First

  7. Book Review

    Directory of Open Access Journals (Sweden)

    Salvatore Filippone

    2014-01-01

    Full Text Available The book by Arjen Markus is a veritable tour de force among the possibilities opened up by the latest incarnation of Fortran, the longest-lived programming language on the planet and still one of the favourites by scientific programmers. It is not an introduction to the syntax and semantics of the latest language standard: it is more of a gourmet cookbook showing off a wide range of examples of what the new features allow a daring programmer to do.

  8. Book Information

    Institute of Scientific and Technical Information of China (English)

    Qian; Fang

    2015-01-01

    Worlding Cities:Asian Experiments anthe Art of Being Global Author:Ananya Roy;Editor:Aihwa Ong Year:2012Publisher:Wiley-Blackwell ISBN:1405192763(376 pages,in English)From Dubai to Delhi and from Singapore to Shanghai,cities across Asia are sites of intense experiments with different ways of being global.This book intervenes in urban theory focused on established

  9. Book review

    Directory of Open Access Journals (Sweden)

    Agnieszka Szefer

    2012-10-01

    Full Text Available Sally Meets Harry: Practical Primer to English Pronunciation and Spelling Author: Marta Nowacka, Piotr Cymbalista and Grzegorz A. Kleparski Publisher: Wydawnictwo Uniwersytetu Rzeszowskiego ISBN: 978-837-33867-3-0 Pages: 208;How Much Wood Would a Woodchuck Chuck?’ English Pronunciation Practice Book Author: Anna Mańkowska, Marta Nowacka and Magdalena Kłoczowska Publisher: Konsorcjum Akademickie ISBN: 978-839-28763-2-8 Pages: 200.

  10. Book Information

    Institute of Scientific and Technical Information of China (English)

    Li; Caige

    2015-01-01

    The Cultural Gene of Ancient Chinese SpaceAuthor:Zhang Jie Year:2012Publisher:Tsinghua University Press ISBN:9787302273646(413 pages,in Chinese)From multiple perspectives of ancient astronomy,cultural geography and mountain modes,etiquette culture and system,artifacts and space archaeology,traditional painting,geomantic theory,etc.,this book systematically explores the main origins,concepts,con-

  11. Engineering mathematics pocket book

    CERN Document Server

    Bird, John

    2008-01-01

    This compendium of essential formulae, definitions, tables and general information provides the mathematical information required by students, technicians, scientists and engineers in day-to-day engineering practice. A practical and versatile reference source, now in its fourth edition, the layout has been changed and the book has been streamlined to ensure the information is even more quickly and readily available - making it a handy companion on-site, in the office as well as for academic study. It also acts as a practical revision guide for those undertaking BTEC Nationals, Higher Nationals and NVQs, where engineering mathematics is an underpinning requirement of the course.All the essentials of engineering mathematics - from algebra, geometry and trigonometry to logic circuits, differential equations and probability - are covered, with clear and succinct explanations and illustrated with over 300 line drawings and 500 worked examples based in real-world application. The emphasis throughout the book is on ...

  12. Book Review:

    Science.gov (United States)

    Truscott, J. G.

    2004-05-01

    A book of this nature is long overdue; as could be expected from the pedigree of the editors, the coverage is comprehensive and, thanks to the authors selected, is of high quality. The book is divided into five sections, the central three of which are concerned with the measurement techniques themselves. The invasive techniques of mechanical testing and bone histology are dealt with in great detail at a level suitable for postgraduate students looking for an introduction to these techniques at a practical level. In the section dealing with the measurement techniques which use ionizing radiation, the chapters on DXA, neutron activation and radiogrammetry are well detailed and again at the appropriate level for postgraduate students. However, the chapters dealing with quantitative CT techniques are missing the sort of information that would have given them more authority. There is no mention of reconstruction algorithms or some of the typical shortcomings (e.g. partial volume artefacts) of these techniques and, given the excellent quality of the rest of the book, this was disappointing. The third of these technique sections deals with methods that do not use ionizing radiation. As one might expect with these two editors, the chapter on ultrasound is excellent and the coverage thorough and deep. The chapter on MRI and bone is particularly useful and timely as little has been published in this area and the debate about how best to measure bone quality in vivo has recently been rejoined. The chapters on finite element modelling and vibration analysis give a useful overview of the topics and have comprehensive reference lists for anyone who wishes to deepen their studies. The book has a useful introductory section. Bone biology is discussed in some detail, providing sufficient knowledge for the reader to be able to understand the basis and significance of the measurement techniques that follow. Exhaustive coverage is given to biological and radiation safety issues which

  13. BOOK REVIEW: Supergravity Supergravity

    Science.gov (United States)

    Gregory, Ruth

    2013-02-01

    Supergravity is an essential ingredient in so many areas of ultra high energy physics, yet it is rarely taught systematically, even at the graduate level. Students most often have to learn along with applying, and must use the now classic older texts. For such core material, it is surprising that there are so few good texts on the subject. It is not necessarily that supergravity is so much more conceptually complex, rather that it is technical and therefore easy for a text to become dry, dense and rather indigestible. This book, written by two experts in the field, is therefore a breath of fresh air. It not only represents a comprehensive modern overview of the subject, but achieves this with clarity, accessibility, and even humour! To paraphrase the authors, if you are not impressed by this book, you should put it down and watch television instead. It starts by reviewing, or overviewing, aspects of field theory, basic supersymmetry and gravity that will be needed for the rest of the book. This first third or so of the book is very condensed, and will not be easy to follow for those who have not encountered the material before. However, the authors acknowledge this and give plenty of suggestions for more pedagogical texts in the relevant areas, thus it does not feel overly brief. The middle section deals with the construction of supergravity, starting with basic N = 1 supergravity in 4 and 11 dimensions and gradually extending the discussion to include matter multiplets. This part of the book systematically builds up understanding and construction of models, before moving on to superconformal methods. The purpose is not to cover all supergravity theories, but to focus on a few examples in detail, and to give sufficient expertise and information for the reader to be able to deal with any other models they might need. The final part of the book deals with applications, and includes two chapters on applications in adS/CFT, which will be of most interest to new

  14. Book Review:

    Science.gov (United States)

    Sanders, J. H.

    1984-01-01

    The NATO Advanced Study Institute held at Erice, Sicily, in November 1981 brought together specialists in precise measurement to present a tutorial introduction to quantum metrology and the measurement of the fundamental physical constants. Ever since the evolution of experimental physics as a scientific pursuit the measurement of the values of quantities accepted to be constants of nature has commanded the attention of some of the world's most accomplished workers in this field. Their efforts to seek out the sources of systematic error and to reduce the random errors have produced significant advances in techniques and a continual interest in their results from users and critics: as Raymond T Birge, who pioneered the evaluation of the 'best' values of the constants from the available measurements, observed (perhaps with tongue-in-cheek) "it is the continual variation in the values of these quantities that furnishes most of the interest in the subject". Long before the recognition of the fundamental constants the measurement of mass, length and time grew as a matter of necessity in organized communities, especially in agriculture, commerce and navigation. The adoption of standards, first local, then national, and now international, was a natural consequence. It is particularly relevant that the published proceedings of the NATO school opens with a historical survey by Pierre Giacomo of the Bureau International des Poids et Mesures, which places the subsequent papers in perspective. Measurements which realize the standards of length and time, and those from which values of the fundamental constants are derived, are of such a nature that a considerable background knowledge of physics is needed for their understanding. (The principle of the caesium frequency standard and the physics of the Josephson junction are a long haul from Michelson's measurement of the speed of light and the Millikan oil drop experiment familiar in the school books.) With this in mind, George

  15. Book Review:

    Science.gov (United States)

    Beenakker, C. W. J.

    2005-08-01

    Quantum Noise is advertised as a handbook, and this is indeed how it functions for me these days: it is a book that I keep within hand's reach, ready to be consulted on the proper use of quantum stochastic methods in the course of my research on quantum dots. I should point out that quantum optics, the target field for this book, is not my field by training. So I have much to learn, and find this handbook to be a reliable and helpful guide. Crispin Gardiner previously wrote the Handbook of Stochastic Methods (also published by Springer), which provides an overview of methods in classical statistical physics. Quantum Noise, written jointly with Peter Zoller, is the counterpart for quantum statistical physics, and indeed the two books rely on each other by frequent cross referencing. The fundamental problem addressed by Quantum Noise is how the quantum dynamics of an open system can be described statistically by treating the environment as a source of noise. This is a general problem in condensed matter physics (in particular in the context of Josephson junctions) and in quantum optics. The emphasis in this book in on the optical applications (for condensed matter applications one could consult Quantum Dissipative Systems by Ulrich Weiss, published by World Scientific). The optical applications centre around the interaction of light with atoms, where the atoms represent the open system and the light is the noisy environment. A complete description of the production and detection of non-classical states of radiation (such as squeezed states) can be obtained using one of the equivalent quantum stochastic formulations: the quantum Langevin equation for the field operators (in either the Ito or the Stratonovich form), the Master equation for the density matrix, or the stochastic Schrödinger equation for the wave functions. Each formulation is fully developed here (as one would expect from a handbook), with detailed instructions on how to go from one to the other. The

  16. Book Review:

    Science.gov (United States)

    Vespignani, A.

    2004-09-01

    Networks have been recently recognized as playing a central role in understanding a wide range of systems spanning diverse scientific domains such as physics and biology, economics, computer science and information technology. Specific examples run from the structure of the Internet and the World Wide Web to the interconnections of finance agents and ecological food webs. These networked systems are generally made by many components whose microscopic interactions give rise to global structures characterized by emergent collective behaviour and complex topological properties. In this context the statistical physics approach finds a natural application since it attempts to explain the various large-scale statistical properties of networks in terms of local interactions governing the dynamical evolution of the constituent elements of the system. It is not by chance then that many of the seminal papers in the field have been published in the physics literature, and have nevertheless made a considerable impact on other disciplines. Indeed, a truly interdisciplinary approach is required in order to understand each specific system of interest, leading to a very interesting cross-fertilization between different scientific areas defining the emergence of a new research field sometimes called network science. The book of Dorogovtsev and Mendes is the first comprehensive monograph on this new scientific field. It provides a thorough presentation of the forefront research activities in the area of complex networks, with an extensive sampling of the disciplines involved and the kinds of problems that form the subject of inquiry. The book starts with a short introduction to graphs and network theory that introduces the tools and mathematical background needed for the rest of the book. The following part is devoted to an extensive presentation of the empirical analysis of real-world networks. While for obvious reasons of space the authors cannot analyse in every detail all the

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    Cyril Skinner

    1968-10-01

    Full Text Available - Soebardi, Poerwanto Danoesoegondo, Bahasa Indonesia for beginners. Sydney University Press, 1966, Book I, 160 pp. - Soebardi, J.P. Sarumpaet, The structure of bahasa Indonesia. Department of Indonesian and Malayan Studies, University of Melbourne, 1966, 167 pp. Off-set Print. - Soebardi, J.P. Sarumpaet, Introduction to Bahasa Indonesia. Melbourne University Press, 1967, 111 pp., J.A.C. Mackie (eds. - Soebardi, T.S. Lie, Introducing Indonesian. Sydney, Angus & Robertson Ltd. Book I, 1965, 115 pp. Book II, 1966, 184 pp. - A. Teeuw, Joseph Verguin, Le Malais. Essai d’analyse fonctionnelle et structurale. Cahiers de l’Homme, Ethnologie - Géographie - Linguistique. Nouvelle Série VII. Mouton & Co. Paris, La Haye 1967, 146 pp. - R. Roolvink, Cyril Skinner, The civil war in Kelantan in 1839. Monographs of the Malaysian Branch of the Royal Asiatic Society, II, 1965. vii, 175 pp., 3 maps. - H.J. de Graaf, Generale missiven van Gouverneur-Generaal en Raden aan Heren XVII der Verenidge Oostindische Compagnie. Deel III: 1655-1674. Uitgegeven door Dr. W. Ph. Coolhaas. ‘s-Gravenhage. Rijks Geschiedkundige Publicatiën. Grote Serie 125. Verkrijkbaar bij Martinus Nijhoff. 1968. - Anthony Reid, G.J. Resink, Indonesia’s history between the myths: Essays in legal history and historical theory. Selected Studies on Indonesia, Vol. 7; The Hague, Van Hoeve, 1968, 457 pp. - R.F. Beerling, S. Takdir Alisjahbana, Values as integrating forces in personality, society and culture. University of Oxford Press, Kuala Lumpur, 1966, 248 bldz.

  18. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2011-01-01

    Full Text Available “Numerical Methods for Special Functions” by Gil, Seguar and Temme is a collection of methods and approaches for finding the most efficient and accurate ways of computing values of functions that have no general definition. “Numerical Methods for Special Functions” might appear at first glance to be a boring and perhaps dry subject for non-mathematicians, and indeed it is a little difficult to approach without being an expert in the area, but if you do find yourself in need of some hints for the best implementations available, this book might be a life saver.

  19. Golden book

    CERN Document Server

    2004-01-01

    On 19 October, CERN reached the climax of its Jubilee with the official celebration in the presence of very high representatives of the Member and Observer States. Above, one of the high moments of the day: the signing of the golden book by the King of Spain, Juan Carlos, and at his right the Director-General of CERN, Robert Aymar, the President of the Swiss Confederation, Joseph Deiss, and the President of the Republic of France, Jacques Chirac. A complete report of this event will be in the next issue of the Bulletin.

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Daniel Eltringham

    2016-05-01

    Full Text Available Book reviews of the following academic titles: 'Late Modernism' and The English Intelligencer: 'On the Poetics of Community' by Alex Latter, London: Bloomsbury Academic, 276 pp., 2015 'The Writing Occurs as Song: A Kelvin Corcoran Reader' by Andy Brown (ed., Bristol: Shearsman, 260 pp., 2014 'Out of Everywhere 2: Linguistically Innovative Poetry by Women in North America & the UK' by Emily Critchley (ed., Hastings: Reality Street, 362 pp., 2015  'Women’s Experimental poetry in Britain 1970–2010: Body, Time, Locale' by David Kennedy and Christine Kennedy, Liverpool: Liverpool University Press, 192 pp., 2013

  1. Newnes electronics assembly pocket book

    CERN Document Server

    Brindley, Keith

    2013-01-01

    Produced in association with the Engineering Training Authority with contributions from dozens of people in the electronics industry. The material covers common skills in electrical and electronic engineering and concentrates mainly on wiring and assembly. 'Newnes Electronics Assembly Pocket Book' is for electronics technicians, students and apprentices.

  2. Book Review

    Science.gov (United States)

    Kragh, Helge

    2015-11-01

    Ever since the days of William Blake there has been an underground resistance against the soulless yet triumphant science and its unholy alliance with money, technology and political power. With the nearly undisputed hegemony that science and technological innovation has attained in the post-World War II era, this kind of resistance has resulted in numerous books and articles that in different ways warn against the dark sides of science and the socio-economic system that nourishes a science in degeneration. Classical examples include Herbert Marcuse's One-Dimensional Man (1964), Jacques Ellul's The Technological Society (1965), Theodore Roszak's The Making of a Counter Culture (1968), and Paul Feyerabend's Science in a Free Society (1978). A fair part of the literature written by sociologists and philosophers is not only critical to trends in modern science, but tends to or is overtly anti-science. The book under review belongs in some respects to this heterogeneous literary tradition, but Twilight of the Scientific Age is primarily directed against the institutional system of science and its associated ideology and not against science itself. Indeed, the author is himself a practicing scientist, an astrophysicist, and he emphasizes several times that he firmly believes in science, even that he loves it. He is not a "stupid cultural relativist," he asserts (p. 11), but a critical freethinker independent of dogmatic beliefs.

  3. Book Review:

    Science.gov (United States)

    Das, Ashok

    2007-01-01

    It is not usual for someone to write a book on someone else's Ph.D. thesis, but then Feynman was not a usual physicist. He was without doubt one of the most original physicists of the twentieth century, who has strongly influenced the developments in quantum field theory through his many ingenious contributions. Path integral approach to quantum theories is one such contribution which pervades almost all areas of physics. What is astonishing is that he developed this idea as a graduate student for his Ph.D. thesis which has been printed, for the first time, in the present book along with two other related articles. The early developments in quantum theory, by Heisenberg and Schrödinger, were based on the Hamiltonian formulation, where one starts with the Hamiltonian description of a classical system and then promotes the classical observables to noncommuting quantum operators. However, Dirac had already stressed in an article in 1932 (this article is also reproduced in the present book) that the Lagrangian is more fundamental than the Hamiltonian, at least from the point of view of relativistic invariance and he wondered how the Lagrangian may enter into the quantum description. He had developed this idea through his 'transformation matrix' theory and had even hinted on how the action of the classical theory may enter such a description. However, although the brief paper by Dirac contained the basic essential ideas, it did not fully develop the idea of a Lagrangian description in detail in the functional language. Feynman, on the other hand, was interested in the electromagnetic interactions of the electron from a completely different point of view rooted in a theory involving action-at-a-distance. His theory (along with John Wheeler) did not have a Hamiltonian description and, in order to quantize such a theory, he needed an alternative formulation of quantum mechanics. When the article by Dirac was brought to his attention, he immediately realized what he was

  4. Balancing the books accounting for librarians

    CERN Document Server

    Kirk, Rachel A

    2012-01-01

    Balancing the Books: Accounting for Librarians fills the gap that exists in literature on library acquisitions accounting. By covering essential accounting concepts, budgeting, government regulations that pertain to libraries, as well as accounting measur

  5. The thirteen books of the elements

    CERN Document Server

    Euclid

    1956-01-01

    Volume 2 of 3-volume set containing complete English text of all 13 books of the Elements plus critical analysis of each definition, postulate, and proposition. Covers textual and linguistic matters; mathematical analyses of Euclid's ideas; classical, medieval, Renaissance and modern commentators; refutations, supports, extrapolations, reinterpretations and historical notes. Vol. 2 includes Books III-IX: Circles, relationships, rectilineal figures.

  6. The thirteen books of Euclid's elements

    CERN Document Server

    Euclid

    2012-01-01

    Volume 1 of 3-volume set containing complete English text of all 13 books of the Elements plus critical apparatus analyzing each definition, postulate, and proposition. Covers textual and linguistic matters; mathematical analyses of Euclid's ideas; commentators; refutations, supports, extrapolations, reinterpretations, and historical notes. Vol. 1 includes Introduction, Books I and II

  7. Book Information

    Institute of Scientific and Technical Information of China (English)

    Li; Min

    2015-01-01

    White Paper on Human Settlements:China’s Human Settlements Development Report Editor:Wang Yongbin Publisher:China Architecture and Building Press Year:2012ISBN:9787112148530(221 pages,i n Chinese)The White Paper on Human Settlements:China’s Human Settlements Development Report consists of six major parts:investigation,community,guidance,highlights,papers,and data,covering

  8. Book Review:

    Science.gov (United States)

    Kiefer, C.

    2005-10-01

    The most difficult unsolved problem in fundamental theoretical physics is the consistent implementation of the gravitational interaction into a quantum framework, which would lead to a theory of quantum gravity. Although a final answer is still pending, several promising attempts do exist. Despite the general title, this book is about one of them - loop quantum gravity. This approach proceeds from the idea that a direct quantization of Einstein's theory of general relativity is possible. In contrast to string theory, it presupposes that the unification of all interactions is not needed as a prerequisite for quantum gravity. Usually one divides theories of quantum general relativity into covariant and canonical approaches. Covariant theories employ four-dimensional concepts in its formulation, one example being the path integral approach. Canonical theories start from a classical Hamiltonian version of the theory in which spacetime is foliated into spacelike hypersurfaces. Loop quantum gravity is a variant of the canonical approach, the oldest being quantum geometrodynamics where the fundamental configuration variable is the three-metric. Loop quantum gravity has developed from a new choice of canonical variables introduced by Abhay Ashtekar in 1986, the new configuration variable being a connection defined on a three-manifold. Instead of the connection itself, the loop approach employs a non-local version in which the connection is integrated over closed loops. This is similar to the Wilson loops used in gauge theories. Carlo Rovelli is one of the pioneers of loop quantum gravity which he started to develop with Lee Smolin in two papers written in 1988 and 1990. In his book, he presents a comprehensive and competent overview of this approach and provides at the same time the necessary technical background in order to make the treatment self-contained. In fact, half of the book is devoted to 'preparations' giving a detailed account of Hamiltonian mechanics, quantum

  9. Cover Art, Consumerism, and YA [Young Adult] Reading Choices.

    Science.gov (United States)

    Kies, Cosette

    Cover art has long been used as a marketing device for books, particularly with books aimed at young adults (YAs) aged 12 to 18. An examination of some of the teen thrillers published by novelist Lois Duncan since the 1970s yields several discoveries about changes in cover art that come with various editions. Many covers have been resigned to…

  10. Book Review:

    Science.gov (United States)

    Barbour, J. B.

    2007-02-01

    These colloquium proceedings will be valuable, the blurb says, for graduate students and researchers in cosmology and theoretical astrophysics. Specifically, the book 'looks at both the strengths and weaknesses of the current big bang model in explaining certain puzzling data' and gives a 'comprehensive coverage of the expanding field of cosmology'. The reality is rather different. Conference proceedings rarely compare in value with a solid monograph or good review articles, and Current Issues in Cosmology is no exception. The colloquium was convened by the two editors, who have both long harboured doubts about the big bang, and was held in Paris in June 2004. The proceedings contain 19 presented papers and relatively brief summary comments by four panel speakers. The questions and answers at the end of each talk and a general discussion at the end were recorded and transcribed but contain little of interest. The nature of the colloquium is indicated by panellist Francesco Bertola's comment: 'While in the 1950s it was possible to speak of rival theories in cosmology, now the big-bang picture has no strong rivals. This is confirmed by the fact that out of 1500 members of the IAU Division VIII (Galaxies and the Universe) only a dozen, although bright people, devote their time to the heterodox views.' This was largely a platform for them to give their views. At least half of the dozen, all the 'usual suspects', were present: Geoffery and Margaret Burbidge, Jayant Narlikar, Halton Arp, Chandra Wickramasinghe and, in spirit only but playing a role somewhat like the ghost of Hamlet's father, the late Fred Hoyle. Doubters presented 12 of the 19 papers. Orthodoxy should certainly be challenged and the sociology of science questioned, but I found two main problems with this book. The papers putting the orthodox view are too short, even perfunctory. The most that a serious graduate student would get out of them is a reference to a far better review article or book on modern

  11. Book Review:

    Science.gov (United States)

    Dray, T.

    2006-06-01

    Null hypersurfaces are a mathematical consequence of the Lorentzian signature of general relativity; singularities in mathematical models usually indicate where the interesting physics takes place. This book discusses what happens when you combine these ideas. Right from the preface, this is a no-nonsense book. There are two principal approaches to singular shells, one distributional and the other 'cut and paste'; both are treated in detail. A working knowledge of GR is assumed, including familiarity with null tetrads, differential forms, and 3 + 1 decompositions. Despite my own reasonably extensive, closely related knowledge, there was material unfamiliar to me already in chapter 3, although I was reunited with some old friends in later chapters. The exposition is crisp, with a minimum of transition from chapter to chapter. In fact, my main criticism is that there is no clear statement of the organization of the book, nor is there an index. Everything is here, and the story is compelling if you know what to look for, although it is less easy to follow the story if you are not already familiar with it. But this is really a book for experts, and the authors certainly qualify, having played a significant role in developing and extending the results they describe. It is also entirely appropriate that the book is dedicated to Werner Israel, who pioneered the thin-shell approach to (non-null) singular surfaces and later championed the use of similar methods for analysing null shells. After an introductory chapter on impulsive signals, the authors show how the Bianchi identities can be used to classify spacetimes with singular null hypersurfaces. This approach, due to the authors, generalizes the framework originally proposed by Penrose [1]. While astrophysical applications are discussed only briefly, the authors point out that detailed physical characteristics of signals from isolated sources can be determined in this manner. In particular, they describe the behaviour

  12. BOOK REPORT

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    HAVE you ever wondered what Beijing might have looked like before it was covered with skyscrap- ers, overpasses, gigantic concrete structures and eight-lane avenues full of congested traffic? How life was in the old hutong when these narrow alleys were the city's predominant form of architecture, and not yet tourist attractions for hipster expatriates in search of that gritty lower-class vibe? And what did all those beautiful city gates.

  13. Book Review:

    Science.gov (United States)

    Unruh, W. G.

    2006-02-01

    Quantum mechanics is one of the most successful theoretical structures in all of science. Developed between 1925-26 to explain the optical spectrum of atoms, the theory over the succeeding 80 years has been extended, first to quantum field theories, gauge field theories, and now even string theory. It is used every day by thousands of physicists to calculate physical phenomena to exquisite precision, with no ambiguity in the results. To claim that this is a theory which is not understood by those physicists is absurd. And yet, as eminent a physicist as Richard Feynman, who did as much as anyone else to extend quantum theory to field theories and was a master at producing those exquisite calculations, could say that anyone who claimed they understood quantum theory clearly did not understand quantum theory. One hundred years ago Einstein postulated one of the most unsettling features of the theory, the wave-particle duality, with his particulate explanation for light of the photoelectric effect, and an explanation which was in direct conflict with Maxwell's brilliant development of a wave, or field, theory of light. Einstein believed that the particulate nature would ultimately be explainable by some sort of non-linear theory of electromagnetism, and was outraged by the acceptance of the community of the probabilistic quantum theory. His programme was of course dealt a (near?) fatal blow by Bell's discovery that the three desiderata - a theory which agrees with experiment, a theory which is local in its effects, and a theory in which nature, at its heart, is not probabilistic - are incompatible. That discomfort felt by Einstein and by Feynman is felt by numerous other people as well. This discomfort is heightened by the fact that the theory of gravity, another of Einstein's great achievements, has resisted all efforts at reconciliation with quantum mechanics. This book explores that discomfort, and tries to pin down what the locus of that discomfort is. For many

  14. Benthic Cover

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Benthic cover (habitat) maps are derived from aerial imagery, underwater photos, acoustic surveys, and data gathered from sediment samples. Shallow to moderate-depth...

  15. Comprehensive text book of applied physics

    CERN Document Server

    Kumar, Manoj

    2009-01-01

    ""This book is a comprehensive package for knowledge sharing on Applied Physics. The language of the book is simple and self explanatory, this will help the students to grasp the fundamentals of the subject easily. The book follows a to the point approach and lays stress on the understanding of the core concepts and sharpening the analytical ability of the students on the subject. The book covers wide range of multiple choice questions related to all the topics that is of a great help to the students appearing for competitive as well as state board examinations."

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. van Goor

    1997-07-01

    Full Text Available - Peter Boomgaard, Christine Dobbin, Asian entrepreneurial minorities; Conjoint communities in the making of the world economy, 1570-1940. Richmond: Curzon Press, 1996, xiii + 246 pp. [Nordic Institute of Asian Studies Monograph Series 71.] - Ian Brown, Fukuda Shozo, With sweat and abacus; Economic roles of Southeast Asian Chinese on the eve of World War II, edited by George Hicks. Singapore: Select Books, 1995, xii + 246 pp. - Ian Brown, George Hicks, Chinese organisations in Southeast Asia in the 1930s. Singapore: Select Books, 1996, xv + 168 pp. - Matthew I. Cohen, Laurie J. Sears, Shadows of empire; Colonial discourse and Javanese tales. Durham/London: Duke University Press, 1996, xxi + 349 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. II: Expansion and crisis. New Haven/London: Yale University Press, 1993, xv + 390 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. I: The lands below the winds. New Haven/London: Yale University Press, 1988, xvi + 275 pp. - David Henley, Saya S. Shiraishi, Young heroes; The Indnesian family in politics. Ithaca/New York: Southeast Asia Program, Cornell University, Southeast Asia Program Publications, 1997, 183 pp. [Studies on Southeast Asia 22.] - Gerrit Knaap, P. Jobse, Bronnen betreffende de Midden-Molukken 1900-1942. Den Haag: Instituut voor Nederlandse Geschiedenis, 1997. 4 volumes. Rijks Geschiedkundige Publicatiën, Kleine Serie, 81, 82, 83, 84. Volume 1 bewerkt door P. Jobse, 2 en 3 door Ch.F. van Fraassen, 4 door Ch.F van Fraassen en P. Jobse. xii + 578, xii + 578, xii + 711, x + 655, xi + 261 pp., Ch. F. van Fraassen (eds. - Indro Nugroho-Heins, Clara Brakel-Papenhuyzen, Classical Javanese dance; The Surakarta tradition and its terminology. Leiden: KITLV Press, 1995, xi + 252 pp. [Verhandelingen 155.] - László Sluimers, Shigeru Sato, War, nationalism and peasants; Java under the Japanese occupation, 1942-1945. Armonk, New

  17. The Economics of Books

    NARCIS (Netherlands)

    Canoy, M.F.M.; van Ours, J.C.; van der Ploeg, F.

    2005-01-01

    The tensions between books and book markets as expressions of culture and books as products in profit-making businesses are analysed and insights from the theory of industrial organisation are given.Governments intervene in the market for books through laws concerning prices of books, grants for aut

  18. Book Review:

    Science.gov (United States)

    Peacock, John

    2007-04-01

    ), but the latter is surprising in the context of a subject whose whole purpose is to observe the properties of primordial perturbations that may have arisen from inflation. Instead, the text concentrates on the technical heartland of the transport theory for CMB photons, and the Newtonian and relativistic theory for the development of CMB anisotropies, including polarization. It closes with more observationally-based chapters on general statistical aspects of the CMB sky, a digest of the recent results from WMAP, and an outlook. These are welcome, but the book really stands or falls on its treatment of the core physics of anisotropies. Without going too much into specifics, it can be fairly stated that the treatment given of the main material on CMB fluctuations is geared more to working professionals than to students. There is a good deal of useful technical detail, but it is not always derived systematically, and sometimes arises by reference to the research literature. There are no problem sets or worked examples, and not much attempt at intuitive illumination. As an example, one might point to the large-angle anisotropies of the CMB, which were first analysed in the classic Sachs Wolfe paper of 1967. The relativistic transport equation is there, but one looks in vain for the separation into the Sachs Wolfe effect proper (potential perturbations at last scattering) and the integrated effect of evolution since then. This latter ISW effect is in fact of huge interest in current research, since it is one of the methods for probing whether the vacuum energy differs from a cosmological constant. In general, the text seems strangely patchy on issues of contemporary interest, certainly in terms of its emphasis. It is as if the three authors contributed material separately without achieving a full integration. On the more positive side, the book has the advantage that it presents a Russian view of the subject. So much of the initial work on the `Relic Radiation' (a much

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Alistair Lamb

    1964-10-01

    Full Text Available - B.V.A. Röling, Paul Shepard, Psycholex. Megwa, New York, 1960. 144 blz. - L. Sluimers, J.F. Cady, Southeast Asia: Its historical development. New York etc., McGraw-Hill Book Company, 1964. XVII, 657, IX blz., foto, krtn. - H.J. de Graaf, Nicholas Tarling, Piracy and politics in the Malay world. A study of British imperialism in nineteenth-century Sout-East Asia. F.W. Cheshire, Melbourne, Canberra, Sydney, 1963. 273 pp., frontispiece, endpaper maps. - W. Brand, N.A. Simoniya, Overseas Chinese in Southeast Asia - A Russian study. Data Paper Number 45, Southeast Asia Program, Department of Far Eastern Studies, Cornell University Press, Ithaca, New York, December 1961, 151 blz. - B.H.M. Vlekke, Alistair Lamb, The China-India border, The origins of the disputed boundaries. Published for the Royal Institute of International Affairs by Oxford University Press, London 1964, XVI + 192 pp. - R.S. Karni, Beda Lim, Malaya, a background bibilography. Journal Malayan Branch, RAS, vol. XXXV, pts. 2 & 3, 1962; V. 199 pp. - L. Sluimers, R.K. Goldsen, Factors related to acceptance of innovation in Bang Chan, Thailand; Analysis of a survey conducted by the Cornell Cross-cultural Methodology Project, May 1955. Cornell Thailand Project Interim Report Series no. 3. Data Paper: No. 25 Southeast Asia Program Department of Far Eastern Studies Cornell University. 3de druk, Ithaca, Cornell University Press, 1963. VIII, 72, X blz., M. Rallis (eds.

  20. Book reviews

    Directory of Open Access Journals (Sweden)

    T. Abdel-Motey., C. Urfels., K. Rodriguez., J. Mardikian., J.A. Drobnicki., V. Diodato.

    2000-10-01

    Full Text Available Title:(1 The Library and Information Professional’s Guide to the Internet. (2 Reinvention of the Public Library for the 21st Century. (3 Public Library Collection Development in the Information Age. (4 Making Sense of Journals in the Life Science: From Specialty Origins to Contemporary Assortment. (5 The Holocaust: Memories, Research, Reference. (6 How to Index Your Local Newspaper Using WordPerfect or Microsoft Word for Windows. (7 Effective Utilization and Management of Emerging Information Technologies. (8 Information Technology and Organizations: Challenges of New Technologies. (9 Facilities Planning for School Media and Technology Centers. (10 Libraries Without Walls 2: The Delivery of Library Services to Distance Users. (11 New International Directions in HIV Prevention for Gay and Bisexual Men. (12 Soaring to Excellence Videos: Tools of Our Trade III: Books, the Internet, and Beyond.Author:(1Reviewed by Teresa Abdel-Motey. (2Review by Claire Urfels. (3Reviewed by Dr. Ketty Rodriguez. (4Reviewed by Jackie Mardikian. (5Reviewed by John A. Drobnicki.(6Reviewed by Dr. Virgil Diodato. (7Reviewed by Dr. Lisa M. Covi. (8Reviewed by Tom Zillner. (9Reviewed by Dr. W. Bernard Lukenbill. (10Reviewed by Dr. Elizabeth Buchanan. (11Reviewed by Aisha White. (12Reviewed by Phyllis Tragash

  1. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Qing Dynasty Archives On the Dalai lamasThe Dalai Lama was one of the two leaders of the Gelug (Yellow) Sect of Tibetan Buddhism. It won the honorific title of the Dalai lama in 1653 from Qing Emperor Shunzhi, and the Living Buddha had since been following the reincarnation system under the supervision of the Central Government. His soul boy was not legal until he won the confirmation of the Central Government. Whenever there is the need not to go through the set system, Central Government permission is a must.The Dalai Lama also did his best to seek authorization of the Central Government which would therefore issue him certificate of authority and seal of power.All these were recorded in archives, part of which are contained in the book. Its major chapters contain 154 pieces of archives related with certification of the Dalai Lama and the Panchen Erdeni under the reign of Qing Emperor Shunzhi, the demise of the Dalai Lama and the Panchen Erdeni, efforts made to look for their soul boys, selection of th

  2. Book Reviews

    Directory of Open Access Journals (Sweden)

    Hans Antlöv

    1996-04-01

    , vii + 231 pp., Ulricht Mai (eds. - Tineke Hellwig, Brigitte Müller, Op de wipstoel; De niet-gewettigde inheemse vrouw van de blanke Europeaan in Nederlands-Indië (1890-1940; Een literatuuronderzoek naar beeldvorming en werkelijkheid. Amsterdam: Vakgroep Culturele Antropologie/Sociologie der Niets-Westerse Samenlevingen, 1995, xii + 131 pp. - Jan van der Putten, Liaw Yock Fang, Standard Malay made simple. Singapore: Times Books International, 1988. - Jan van der Putten, Liaw Yock Fang, Standard Indonesian made simple, written with the assistance of Nini Tiley-Notodisuryo, Singapore: Times Books International, 1990. - Jan van der Putten, Liaw Yock Fang, Speak standard Malay; A beginner’s guide. Singapore: Times Books International, 1993, xxii + 280 pp. - Jan van der Putten, Liaw Yock Fang, Speak Indonesian; A beginner’s guide, written in collaboration with Munadi Padmadiwiria and Abdullah Hassan. Singapore: Times Books International, 1990. - Alle G. Hoekema, Chr.G.F. de Jong, Geschiedenis van de Nederlandse Zending op Zuid-Sulawesi 1852-1966; Een bronnenpublicatie. Oegstgeest: Raad voor de Zending der Nederlands Hervormde Kerk, 1995, xi + 524 pp. - George Hotze, Ronald G. Gill, De Indische stad op Java en Madura; Een morfologische studie van haar ontwikkeling. Delft: Publikatieburo Bouwkunde, Technische Universiteit Delft, 1995, 350 pp. - H.A.J. Klooster, Holk H. Dengel, Neuere Darstellung der Geschichte Indonesiens in Bahasa Inonesia; Entwicklung und Tendenzen der indonesischen Historiographie. Stuttgart: Steiner, 1994, vii + 269 pp. - Harry A. Poeze, Hans Antlöv, Imperial policy and Southeast Asian nationalism 1930-1957. Richmond: Curzon Press, 1995, xiii + 323 pp., Stein Tonnesson (eds. - P.W. Preston, Michael Hill, The politics of nation building and citizenship in Singapore. London: Routledge, 1995, x + 285 pp., Lian Kwen Fee (eds. - J.W. (Pim Schoorl, Michael Southon, The navel of the perahu; Meaning and values in the maritime trading economy of a Butonese

  3. Book Reviews

    Directory of Open Access Journals (Sweden)

    Adrianus Koster

    1981-01-01

    Full Text Available - H.J.M. Claessen, David Lewis, From Maui to Cook: The discovery and settlement of the Pacific, Drawings by Walter Stackpool. Sydney: Doubleday, 1977. Bibliography. - P. van Emst, Carl Lumholtz, Among Cannibals. An account of four years travel in Australia and of camp life with the aborigines of Queensland. Firle: Caliban Books. 383 pp. Maps, illustrations and index. Reprinted from the first edition, London: John Murray. - D.C. Geirnaert-Martin, Robert Wessing, Cosmology and social behaviour in a West Javanese settlement, Papers in International Studies, Southeast Asia Series no. 47, Ohio University Center for International Studies, Southeast Asia Program, 1978, Athens, Ohio. - B.G. Grijpstra, William Wood, Cultural-ecological perspectives in Southeast Asia, edited and with an introduction by William Wood, Papers in International Studies, Southeast Asia Studies no. 41, Ohio University Center for International Studies, Southeast Asia Program, 1977, Athens, Ohio. - R. Hagesteijn, M. Jacq-Hergoualc’h, L’armement et l’organisation de l’armée khmère aux XIIe et XIIIe siècles; d’après les bas-reliefs d’Angkor Vat, du Bayon et de Bantay Chmar. Paris: Presses Universitaires de France. - C.K. Jonker-de Putter, John Ingleson, Road to exile; The Indonesian nationalist movement, 1927-1934. ASAA Southeast Asia Publications Series, No. 1. Heinemann Educational Books (Asia Ltd., Singapore, 1979. xii + 254 blz. Bibliographie, index. - P.E. de Josselin de Jong, Roland Werner, Jah-het of Malaysia: art and culture, 1975. Kuala Lumpur: Penerbit Universiti Malaya. xxxv, 626 pp., 39 figs., 2 maps, 746 plates. - P.E. de Josselin de Jong, Roland Werner, Mah-Meri of Malaysia: Art and culture, 1974. Kuala Lumpur: Penerbit Universiti Malaya. xxvi, 485 pp., 13 figs., 3 maps, 460 plates. - Simon Kooijman, Peter Gathercole, The art of the Pacific Islands. National Gallery of Art, Washington, 1979, 365 pp., 386 illustrations + 6 sketch-maps., Adrienne L

  4. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2010-09-01

    upland Southeast Asia. (Guido Sprenger Guido Sprenger, Die Männer, die den Geldbaum fällten; Konzepte von Austausch und Gesellschaft bei den Rmeet von Takheung, Laos. (Oliver Tappe Review Essay Two books on East Timor. Carolyn Hughes, Dependent communities; Aid and politics in Cambodia and East Timor. David Mearns (ed., Democratic governance in Timor-Leste; Reconciling the local and the national. (Helene van Klinken Review Essay Two books on Islamic terror Zachary Abuza, Political Islam and violence in Indonesia. Noorhaidi Hasan, Laskar jihad; Islam, militancy, and the quest for identity in post-New Order Indonesia. (Gerry van Klinken Korte Signaleringen Janneke van Dijk, Jaap de Jonge en Nico de Klerk, J.C. Lamster, een vroege filmer in Nederlands-Indië. Griselda Molemans en Armando Ello, Zwarte huid, oranje hart; Afrikaanse KNIL-nazaten in de diaspora. Reisgids Indonesië; Oorlogsplekken 1942-1949. Hilde Janssen, Schaamte en onschuld; Het verdrongen oorlogsverleden van troostmeisjes in Indonesië. Jan Banning, Comfort women/Troostmeisjes. (Harry Poeze

  5. Book Review:

    Science.gov (United States)

    Carlip, S.

    2006-10-01

    The early 1980s, when I first learned theory, were desperate times for graduate students. We searched frantically for coherent introductions, passing tattered copies of review articles around like samizdat, struggling over obscure references to ancient models of strong interactions, and flocking to lectures—not least those by Joe Polchinski—that promised to really explain what was going on. If only this book had been around, it would have saved much grief. Volume I, The Bosonic String, offers a clear and well organized introduction to bosonic string theory. Topics range from the 'classical' (spectra, vertex operators, consistency conditions, etc.) to the 'modern' (D-branes first appear in an exercise at the end of chapter 1, noncommutative geometry shows up in chapter 8). Polchinski does not hesitate to discuss sophisticated matters—path integral measures, BRST symmetries, etc.—but his approach is pedagogical, and his writing is lucid, if sometimes a bit terse. Chapters end with problems that are sometimes difficult but never impossible. A very useful annotated bibliography directs readers to resources for further study, and a nearly 30-page glossary provides short but clear definitions of key terms. There is much here that will appeal to relativists. Polchinski uses the covariant Polyakov path integral approach to quantization from early on; he clearly distinguishes Weyl invariance from conformal invariance; he is appropriately careful about using complex coordinates on topologically nontrivial manifolds; he keeps the string world sheet metric explicit at the start instead of immediately hiding it by a gauge choice. Volume II includes an elegant introduction to anticommuting coordinates and superconformal transformations. A few conventions may cause confusion—%, Polchinski's stress energy tensor, for instance, differs from the standard general relativistic definition by a factor of -2π, and while this is briefly mentioned in the text, it could easily be

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Noorduyn

    1982-10-01

    Full Text Available - C. van Dijk, M.C. Ricklefs, A history of modern Indonesia. C. 1300 to the present, London and Basingstoke, The MacMillan Press Ltd., 1981. xii + 335 pp. MacMillan Asian Histories Series. - L.A. Hoedemaker, S.C. Graaf van Randwijck, Handelen en denken in dienst der zending (Oestgeest 1897-1942, 2 delen, Den Haag Boekencentrum, 1981. - G.J. Knaap, Hubert Jacobs SJ, Documenta Malucensia II (1577-1606, annotated by Hubert Jacobs SJ, Monumenta Missionum Societatis Iesu volumen XXXIX, Missiones Orientalis, Rome, Jesuit Historical Institute; 1980, XXXI + 65* + 794 blz. - David S. Moyer, H. Sutherland, The making of a bureaucratic elite; The colonial transformation of the Javanese Priyayi, Asian studies association of Australia, Southeast Asia publication series no. 2, Heinemann educational books (Asia, Singapore, Kuala Lumpur, Hong Kong, 1979, xx + 182 pp. - S.A. Niessen, Garrett Solyom, The world of the Javanese Keris, 1978, East-West Centre, Honolulu, Hawaii., Bronwen Solyom (eds. - S.A. Niessen, Anne Leonard, Patterns of Paradise; The styles and significance of bark cloth around the world, 1980, Field museum of natural history., John Terrell (eds. - S.A. Niessen, Kirk Endicott, Batek Negrito Religion, 1979, Oxford Clarendon Press. - J. Noorduyn, Olivier Carré, L’Islam et l’état dans le monde d’aujourd’hui, Paris, Presses Universitaires de France, 1982. 270 p. - H.A. Poeze, Joop Morriën, Indonesië los van Holland. De CPN en de PKI in hun strijd tegen het Nederlands kolonialisme, Pegasus Amsterdam, 1982, 272 pp.

  7. Book Reviews

    Directory of Open Access Journals (Sweden)

    J.G. Oosten

    1980-10-01

    Full Text Available - M.A. van Bakel, Frederic L. Pryor, The origins of the economy. A comparative study of distribution in primitive and peasant economies. Academic Press, New York 1977. XVIII + 475 blz. - H.J. de Graaf, W. Ph. Coolhaas, Generale missiven van Gouverneurs-Generaal en Raden aan heren XVII der Verenigde Oost-Indische Compagnie. Deel VII. 1713-1725. ‘s-Gravenhage 1979. Rijks geschiedkundige publicatiën. Grote Serie 164. - F.G.P. Jaquet, P. Sutikno, J. Bastin, Nineteenth century prints and illustrated books of Indonesia; with particular reference to the print collection of the Tropenmuseum, Amsterdam; a descriptive bibliography. Utrecht etc., Het Spectrum, 1979. XIV, 386 pp. Ills., B. Brommer (eds. - S. Kooijman, Adrienne L. Kaeppler, “Artificial curiosities” being an exposition of native manufactures collected on the three Pacific voyages of Captain James Cook, R.N. at the Bernice Pauahi Bishop Museum January 18, 1978 - August 31, 1978 on the occasion of the Bicentennial of the European discovery of the Hawaiian islands by Captain Cook - January 18, 1778. Bernice P. Bishop Museum special publication 65, Honolulu, Hawaii, 1978. - J.G. Oosten, Marcel Mauss, Seasonal variations of the Eskimo. A study in social morphology. Marcel Mauss in collaboration with Henri Beuchat. Translated, with a foreword by James J. Fox. Routledge & Kegan Paul, London, Boston and Henley 1979. - Jérôme Rousseau, W.F. Schneeberger, Contributions to the ethnology of central Northeast Borneo (parts of Kalimantan, Sarawak and Sabah. The University of Berne, Institute of Ethnology, Berne 1979. Series: Studia ethnologica Bernensia, no. 2. 143 pages. Maps, figures, plates.

  8. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-07-01

    W. Collinwood ,Modern Bahamian society. Parkersburg IA: Caribbean Books, 1989. 278 pp., Steve Dodge (eds -Peter Hulme, Pierrette Frickey, Critical perspectives on Jean Rhys. Washington DC: Three Continents Press, 1990. 235 pp. -Alvina Ruprecht, Lloyd W. Brown, El Dorado and Paradise: Canada and the Caribbean in Austin Clarke's fiction. Parkersburg IA: Caribbean Books, 1989. xv + 207 pp. -Ineke Phaf, Michiel van Kempen, De Surinaamse literatuur 1970-1985: een documentatie. Paramaribo: Uitgeverij de Volksboekwinkel, 1987. 406 pp. -Genevieve Escure, Barbara Lalla ,Language in exile: three hundred years of Jamaican Creole. Tuscaloosa AL: University of Alabama Press, 1990. xvii + 253 pp., Jean D'Costa (eds -Charles V. Carnegie, G. Llewellyn Watson, Jamaican sayings: with notes on folklore, aesthetics, and social control.Tallahassee FL: Florida A & M University Press, 1991. xvi + 292 pp. -Donald R. Hill, Kaiso, calypso music. David Rudder in conversation with John La Rose. London: New Beacon Books, 1990. 33 pp. -Mark Sebba, John Victor Singler, Pidgin and creole tense-mood-aspect systems. Amsterdam and Philadelphia: John Benjamins, 1990. xvi + 240 pp. -Dale Tomich, Pedro San Miguel, El mundo que creó el azúcar: las haciendas en Vega Baja, 1800-873. Río Piedras, Puerto Rico: Ediciones Huracán, 1989. 224 pp. -César J. Ayala, Juan José Baldrich, Sembraron la no siembra: los cosecheros de tabaco puertorriqueños frente a las corporaciones tabacaleras, 1920-1934. Río Piedras, Puerto Rico: Ediciones Huracán, 1988. -Robert Forster, Jean-Michel Deveau, La traite rochelaise. Paris: Kathala, 1990. 334 pp. -Ernst van den Boogaart, Johannes Menne Postma, The Dutch in the Atlantic slave trade, 1600-1815. Cambridge: Cambridge University Press, 1990. xiv + 428 pp. -W.E. Renkema, T. van der Lee, Plantages op Curacao en hun eigenaren (1708-1845: namen en data voornamelijk ontleend aan transportakten. Leiden, the Netherlands: Grafaria, 1989. xii + 87 pp. -Mavis C. Campbell, Wim

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    Full Text Available -Selwyn R. Cudjoe, John Thieme, The web of tradition: uses of allusion in V.S. Naipaul's fiction, -A. James Arnold, Josaphat B. Kubayanda, The poet's Africa: Africanness in the poetry of Nicolás Guillèn and Aimé Césaire. Westport CT: Greenwood, 1990. xiv + 176 pp. -Peter Mason, Robin F.A. Fabel, Shipwreck and adventures of Monsieur Pierre Viaud, translated by Robin F.A. Fabel. Pensacola: University of West Florida Press, 1990. viii + 141 pp. -Alma H. Young, Robert B. Potter, Urbanization, planning and development in the Caribbean, London: Mansell Publishing, 1989. vi + 327 pp. -Hymie Rubinstein, Raymond T. Smith, Kinship and class in the West Indies: a genealogical study of Jamaica and Guyana, Cambridge: Cambridge University Press, 1988. xiv + 205 pp. -Shepard Krech III, Richard Price, Alabi's world, Baltimore and London: Johns Hopkins University Press, 1990. xx + 445 pp. -Graham Hodges, Sandra T. Barnes, Africa's Ogun: Old world and new, Bloomington & Indianapolis: Indiana University Press, 1989. xi + 274 pp. -Pamela Wright, Philippe I. Bourgois, Ethnicity at work: divided labor on a Central American banana plantation, Baltimore MD: John Hopkins University Press, 1989. xviii + 311 pp. -Idsa E. Alegría-Ortega, Andrés Serbin, El Caribe zona de paz? geopolítica, integración, y seguridad, Caracas: Editorial Nueva Sociedad, 1989. 188 pp. (Paper n.p. [Editor's note. This book is also available in English: Caribbean geopolitics: towards security through peace? Boulder CO: Lynne Rienner, 1990. -Gary R. Mormino, C. Neale Ronning, José Martí and the émigré colony in Key West: leadership and state formation, New York; Praeger, 1990. 175 pp. -Gary R. Mormino, Gerald E. Poyo, 'With all, and for the good of all': the emergence of popular nationalism in the Cuban communities of the United States, 1848-1898, Durham NC: Duke University Press, 1989. xvii + 182 pp. -Fernando Picó, Raul Gomez Treto, The church and socialism in Cuba, translated from

  10. Traditional to Digital Books

    Institute of Scientific and Technical Information of China (English)

    JING XIAOLEI

    2010-01-01

    @@ A book fair wouldn't be a book fair without books.And while the number of book fairs in China has increased in recent years,the Guangzhou Book Fair has been helping to redefine the very nature of books by promoting digital works and reading technology.This year,the fair again set up an exclusive digital reading experience exhibition hall to showcase the host province's latest achievements in the field.

  11. The Economics of Books

    OpenAIRE

    Canoy, M.F.M.; Ours, J. C. van; van der Ploeg, F.

    2005-01-01

    The tensions between books and book markets as expressions of culture and books as products in profit-making businesses are analysed and insights from the theory of industrial organisation are given. Governments intervene in the market for books through laws concerning prices of books, grants for authors and publishers, a lower value-added tax, public libraries and education in order to stimulate the diversity of books on offer, increase the density of retail outlets and to promote reading. A...

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Ger P. Reesink

    1995-07-01

    Full Text Available - Rogier Busser, Peter Post, Japanse bedrijvigheid in Indonesië, 1868-1942; Structurele elementen van Japan’s vooroorlogse economische expansie in Zuidoost Azië. Proefschrift Vrije Universiteit, Amsterdam, 1991, xviii + 374 pp. - H.J.M. Claessen, Arne Aleksej Perminow, The long way home; Dilemmas of everyday life in a Tongan village. Oslo: Scandinavian University Press, 1993, 166 pp. - Aone van Engelenhoven, René van den Berg, Studies in Sulawesi linguistics III. Jakarta: Badan Penyelenggara Seri Nusa, Universitas Katolik Indonesia Atma Jaya, 1994, xii + 116 pp. [NUSA, Linguistic Studies of Indonesian and Other Languages in Indonesia 36.] - Will Derks, Wolfgang Marschall, Texts from the Islands; Oral and written traditions of Indonesia and the Malay world, (Procedings of the 7th European Colloquium on Indonesia and Malay Studies, Berne, June 1989 1994, iii + 411 pp. [Ethnologica Bernensia 4]. - Michael Kaden, Krishna Sen, Indonesian Cinema; Framing the New Order, London: Zed Books, 1994, x + 188 pp. - Nico Kaptein, Mona Abaza, Indonesian Students in Cairo; Islamic education perceptions and exchanges, Paris: Association Archipel, 1994, 198 pp. [Cahier d’Archipel 23.] - P. Keppy, Chris Manning, Indonesia assessment 1993; Labour: Sharing in the benefits of growth? Canberra: Australian National University, 1993, xxi + 326 pp., Joan Hardjono (eds. - Anke Niehof, Jan-Paul Dirkse, Development and social welfare; Indonesia’s experiences under the New Order, Leiden: KITLV Press, 1993, xi + 295 pp., Frans Hüsken, Mario Rutten (eds. - Hetty Nooy-Palm, Michale C. Howard, Textiles of Southeast Asia; An annotated and illustrated bibliography. Bangkok: White Lotus, 1994, 212 pp. + 64 pp. pf photographs in colour. - Harry A. Poeze, Hans van Miert, Een koel hoofd en een warm hart; Nationalisme, Javanisme en jeugdbeweging in Nederlands-Indië, 1918-1930. Amsterdam: De Bataafsche Leeuw, 1995, 424 pp. - Ger P. Reesink, Jürg Wassmann, Historical atlas of

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    F.L. van Holthoon

    1970-01-01

    Full Text Available - Yvan Simonis, Bertel Nathhorst, Formal or structural studies of traditional tales. The usefulness of some methodological proposals advanced by Vladimir Propp, Alan Dundes, Claude Levi-Strauss and Edmund Leach. Acta Universitatis Stockholmiensis, Stockhlom Studies in Comparative Religion, 9 - Stockholm 1969. 80 p. bibliogr., index. - A.J.F. Köbben, G.P. Murdock, Ethnographic atlas. University of Pittsburgh Press, 1967. 128 pp. - J. Blauw, Banton Michael, Anthropological approaches to the study of religion. Tavistock Publications, London, 1966. XZII en 176p. - C. Baks, J.F. Boissevain, Netwerken en quasi-groepen; enkele beschouwingen over de plaats van de Niet-Groepen in de Sociale Wettenschappen. Oratie. Van Gorcum & Comp., Assen 1968. 44 pp. - C.J. Lammers, Tom Burns, Industrial man. Penguin Modern Sociology Readings. Harmondsworth, Middlesex: Penguin Books Ltd. 1969. 414 pp. - P. van Daalen, M.M. Albinski, Maatschappelijke behoefte aan sociologen. Rede Katholieke Universiteit te Nijmegen. Van Gorcum, Assen 1969. 37 blz. - W. Brand, Louise B. Young, Population in perspective. Oxford University Press, New York/London/Toronto, 1968. 460 blz. - J.H.B. den Ouden, C. Baks, Afschaffing van Pacht. Een onderzoek naar de sociale gevolgen van de afschaffing van pacht in twee dorpen van Zuid-Gujerat, India. Publikatie no. 13. Afdeling Zuid- en Zuidoost-Azië. Antropologisch-Sociologisch Centrum. Universiteit van Amsterdam. 1969. 228 pp. - Mohan K. Gautam, William H. Newell, A study of Gaddi scheduled tribe - and affiliated castes. Census of India 1961. Vol. XX, Part V-B. Himachal Pradesh. Report on scheduled castes and scheduled tribes. Government of India Press, Simla. 1967. I-IV plus 104 pp. with 14 black and white illustrations, appendices and bibliography. - P.J. van Winter, Monica Wilson, The Oxford history of South Africa. Vol. I, South Africa to 1870. Clarendon Press, Oxford 1969. XXXIII, 502 p., Leonard Thompson (eds. - Jan Knappert, Hasani bin

  14. „Alle Männer sind ‚potentielle Vergewaltiger‘“? – Einige nicht! Book cover Sexual violence against women: How men can be protected from becoming aggressors

    Directory of Open Access Journals (Sweden)

    Arnfried Bintig

    2003-11-01

    Full Text Available Das 2002 erschienene Buch Sexuelle Gewalt gegen Frauen von Susanne Kade ist ein umfangreicher und detaillierter Bericht über eine – theoretisch fundierte – empirische Untersuchung möglicher (Sozialisations- Bedingungen, unter denen sich Männer „sexuell gewaltlos“ verhalten, ergänzt um Überlegungen, wie solche Bedingungen bei Jungen und Männern präventiv gefördert werden können. Zentrales Anliegen der Autorin ist die durch einen Perspektivenwechsel (von der potentiellen Täterschaft aller Männer hin zur sexuellen Gewaltlosigkeit einiger mögliche Ressourcenorientierung bei der Präventionsarbeit.Susanne Kade’s book, published in 2002, gives a comprehensive and detailed account of an empirical survey which investigates the (possible conditions of socialisation under which men behave sexually in a non-violent way. The solidly theorised study makes suggestions for the preventive provision of such conditions for boys and men. Kade’s novel point of departure is away from the potential guilt of all men, towards the sexual non-violence of some. Her central aim is to orient the reader towards resources that can be helpful in therapeutic social work.

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-10-01

    : KITLV Press, 2002, viii + 246 pp. [Proceedings 5.], Nico Kaptein (eds -Anton Ploeg, William C. Clarke, Remembering Papua New Guinea; An eccentric ethnography. Canberra: Pandanus Books, Research School of Pacific and Asian Studies, Australian National University, 2003, 178 pp. -Nathan Porath, Gerco Kroes, Same hair, different hearts; Semai identity in a Malay context; An analysis of ideas and practices concerning health and illness. Leiden: Research School of Asian, African and Amerindian Studies (CNWS, Universiteit Leiden, 2002, 188 pp. -Guido Sprenger, Grant Evans, Laos; Culture and society. Chiang Mai: Silkworm Books, 1999, xi + 313 pp. -Gerard Termorshuizen, Dik van der Meulen, Multatuli; Leven en werk van Eduard Douwes Dekker. Nijmegen: SUN, 2002, 912 pp. -Paige West, Karl Benediktsson, Harvesting development; The construction of fresh food markets in Papua New Guinea. Copenhagen: Nordic Institute of Asian Studies/Ann Arbor: University of Michigan Press, 2002, xii + 308 pp. -Edwin Wieringa, Amirul Hadi, Islam and state in Sumatra; A study of seventeenth-century Aceh. Leiden: Brill, 2004, xiii + 273 pp. [Islamic History and Civilization, 48.] -Robin Wilson, Pamela J. Stewart ,Remaking the world; Myth, mining and ritual change among the Duna of Papua New Guinea. Washington: Smithsonian Institution Press, 2002, xvi + 219 pp. [Smithsonian Series in Ethnographic Enquiry.], Andrew Strathern (eds

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2002-01-01

    Full Text Available -Stephen J. Appold, Heidi Dahles ,Tourism and small entrepreneurs; Development, national policy, and entrepreneurial culture: Indonesian cases. Elmsford, New York: Cognizant Communication Corporation, 1999, vi + 165 pp., Karin Bras (eds -Jean-Pascal Bassino, Peter Boothroyd ,Socioeconomic renovation in Vietnam; The origin, evolution and impact of Doi Moi. Singapore: Institute of Southeast Asian Studies, 2001, xv + 175 pp., Pham Xuan Nam (eds -Peter Boomgaard, Patrick Vinton Kirch, The wet and the dry; Irrigation and agricultural intensification in Polynesia. Chicago: The University of Chicago Press, 1994, xxii + 385 pp. -A.Th. Boone, Chr.G.F. de Jong, De Gereformeerde Zending in Midden-Java 1931-1975; Een bronnenpublicatie. Zoetermeer: Boekencentrum, 1997, xxiv + 890 pp. [Uitgaven van de Werkgroep voor de Geschiedenis van de Nederlandse Zending en Overzeese Kerken, Grote Reeks 6.] -Okke Braadbaart, Colin Barlow, Institutions and economic change in Southeast Asia; The context of development from the 1960s to the 1990s. Cheltenham: Edward Elgar, xi + 204 pp. -Freek Colombijn, Abidin Kusno, Behind the postcolonial; Architecture, urban space, and political cultures in Indonesia. London: Routledge, 2000, xiv + 250 pp. -Raymond Corbey, Michael O'Hanlon ,Hunting the gatherers; Ethnographic collectors, agents and agency in Melanesia, 1870s -1930s. Oxford: Bergahn Books, 2000, xviii + 286 pp. [Methodology and History in Anthropology 6.], Robert L. Welsch (eds -Olga Deshpande, Hans Penth, A brief histroy of Lan Na; Civilizations of North Thailand. Chiang Mai: Silkworm Books, 2000, v + 74 pp. -Aone van Engelenhoven, I Ketut Artawa, Ergativity and Balinese syntax. Jakarta: Badan Penyelenggaran Seri NUSA, Universitas Katolik Indonesia Atma Jaya, 1998, v + 169 pp (in 3 volumes. [NUSA Linguistic Studies of Indonesian and Other Languages in Indonesia 42, 43, 44.] -Rens Heringa, Jill Forshee, Between the folds; Stories of cloth, lives, and travels from Sumba

  17. CERN Book fair

    CERN Multimedia

    CERN Central Library and IT Department Bookshop

    2004-01-01

    The CERN Library, in conjunction with the IT Department Bookshop, is organizing a book fair on the 28th and 29th October. Some 15 major publishers will be represented, including 6 who will be here in person, and more than 700 of their latest titles will be on display (for sale or order). The major topics covered will be computing, physics, technology, mathematics, engineering and popular science. Those present at this event will include Alpha Science, Cambridge University Press, Elsevier, Institute of Physics, Microsoft Press, O'Reilly, OLF Switzerland, Oxford University Press, McGraw-Hill, Springer, Pearson, Thali Switzerland, Wiley, World Scientific and Ebooks Corporation. The fair will take place on the first floor of the Main Building (bldg.60), Salle des Pas Perdus, and will be open from 10.00 to 17.00 on both days. In addition, EBooks Corporation will describe their electronic book system; insight into this is available at http://www.eblib.com/ We look forward to your support for this initiative. Sh...

  18. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2005-01-01

    Full Text Available -Monika Arnez, Niels Mulder, Southeast Asian images; Towards civil society? Chiang Mai: Silkworm Books, 2003, ix + 253 pp. -Adriaan Bedner, Connie Carter, Eyes on the prize; Law and economic development in Singapore. The Hague: Kluwer Law International, xviii + 307 pp. [The London-Leiden series on law, administration and development 7.] -Amrit Gomperts, J.R. van Diessen ,Grote atlas van Nederlands Oost-Indië/Comprehensive atlas of the Netherlands East Indies. Zierikzee: Asia Maior, Utrecht: Koninklijk Nederlands Aardrijkskundig Genootschap (KNAG, 2004, 480 pp. (editors, with the collaboration of R.C.M. Braam, W. Leijnse, P.A. Levi, J.J. Reijnders, R.P.G.A. Voskuil and M.P.B. Ziellemans, F.J. Ormeling (eds -Stuart R. Harrop, Adriaan Bedner ,Towards integrated environmental law in Indonesia? Leiden: Research school CNWS, School of Asian, African and Amerindian studies, 2003, 161 pp. [CNWS publications 127.], Nicole Niessen (eds -David Henley, Paul H. Kratoska ,Locating Southeast Asia: Geographies of knowledge and politics of space. Singapore: Singapore University Press, 2005, xi + 326 pp., Remco Raben, Henk Schulte Nordholt (eds -Gerry van Klinken, Anthony J. Langlois, The politics of justice and human rights; Southeast Asia and universalist theory. Cambridge: Cambridge University Press, 2001, xi + 214 pp. [Cambridge Asia-Pacific studies.] -Koh Keng We, Jurrien van Goor, Prelude to colonialism; The Dutch in Asia. Hilversum: Verloren, 2004, 127 pp. -Lim Beng Soon, Thomas H. Slone, Prokem; An analysis of a Jakartan slang. Oakland: Masalai Press, 2003, 95 pp. -Lim Beng Soon, Neil Khor Jin Keong ,The Penang Po Leung Kuk; Chinese women, prostitution and a welfare organisation. Kuala Lumpur; The Malaysian branch of the Royal Asiatic society (MBRAS, 2004, VII + 181 pp., Khoo Keat Siew (eds -Dick van der Meij, J. Thomas Lindblad ,Macht en majesteit; Opstellen voor Cees Fasseur bij zijn afscheid als hoogleraar in de geschiedenis van Indonesië aan de

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    R.A. Römer

    1963-10-01

    Full Text Available - A.J.C. Lach de Bére, Fernand van Langenhove, Consciences Tribales et Nationales en Afrique Noire. Institut Royal des Relations Internationales, Bruxelles. Martinus Nijhoff, ‘s-Gravenhage, 1960; 444 blz. - J.H. Scherer, A.H.J. Prins, The Swahili-speaking peoples of Zanzibar and the E. African Coast (Arabs, Shirazi and Swahili. Ethnographic Survey of Africa: East Central Africa, part XII. Uitgave van het International African Institute, London, 1961. 143 pp., m. kaart. - P. Driessens, Carol Brubaker, Geesten van het woud. Servire Luxe Pockets nr. 66. Servire, Den Haag 1963. 175 pp., 24 foto’s. - Joh. J. Hanrath, Indonesian Economics. The concept of dualism in theory and policy. Den Haag (W. van Hoeve 1961. 443 pp. - W. Ph. Coolhaas, H.R.C. Wright, East-Indian economic problems of the age of Cornwallis and Raffles. Luzac, London, 1961; 271 pp. - H.J. de Graaf, M.A.P. Meilink-Roelofsz, Asian trade and European influence in the Indonesian Archipelago between 1500 and about 1630. Academisch Proefschrift Amsterdam (S.U.. M. Nijhoff, ‘s-Gravenhage 1962. 471 pp. - Logemann, Herbert Feith, The decline of constitutional democracy in Indonesia. Cornell University Press, Ithaca, New York, 1962. XX en 608 blz. - F.D.K. Bosch, G. Coedés, Les peuples de la péninsule indochinoise. 228 pp., 16 pl., 1 carte; Ed. Dunod, Paris, 1962. - L. Sluimers, Sirdar Ikbal Ali Shah, Viet-nam. London, Octagon Press, 1960. XV, 232 blz., krt. - L. Sluimers, J.G. Keyes, A bibliography of North Vietnamese Publications in the Cornell University Library. Ithaca, Cornell University, 1962. Data paper: Number 47. Southeast Asia Program. Department of Asian Studies. Cornell University. X, 116 blz., X. - A.F.P. Hulsewé, G.P. Oery, The Man-Shu (Book of the Southern Barbarians, translated by Gordon H. Luce, edited by G.P. Oery; Data Paper Nr. 44, Southeast Asia Program, Dept. of Far Eastern Studies, Cornell Univ., Ithaca, N.Y.; 1961. (X + 116 pp., 1 map. - C.H.M. Palm, Felix M

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Danker H. Schaareman

    1980-01-01

    Full Text Available - H.J.M. Claessen, Jan van Bremen, Symposion. Tijdschrift voor Maatschappijwetenschap. Onder redactie van Jan van Bremen, Cees Cruson, Helle Snel, Jojada Verrips, Willem Wolters en Ton Zwaan. Uitgave: Stichting voor Maatschappijwetenschappelijk Onderzoek., Cees Cruson, Helle Snel (eds. - H.J.M. Claessen, Neil Lifuka, Logs in the current of the sea. Neil Lifuka’s story of Kioa and the Vaitupu colonists. Edited and introduced by Klaus-Friedrich Koch. With a foreword by Professor H.E. Maude. Cambridge, Mass.: Langdon Associates Press. 1978. - H.J.M. Claessen, R.R. Nayacakalou, Leadership in Fiji. 1975. Melbourne etc.: Oxford University Press. 170 pp. Appendices, tables, notes. - H.J.M. Claessen, Michael W. Young, The ethnography of Malinowski; The Trobriand Islands 1915-1918. London: Routledge and Kegan Paul, 1979. Bibliography, Index, illustrations. - P.E. de Josselin de Jong, G.B. Milner, Natural symbols in South East Asia. School of Oriental and African Studies, London 1978. 181 p., 13 plates. - P. Kloos, G.N. Appell, Ethical dilemmas in anthropological inquiry: A case book, Waltham (Mass., Crossroads Press, 1978, xii + 291 pp. - David S. Moyer, M.B. Hooker, A concise legal history of South-East Asia. Oxford: Clarendon Press, 1978. 289 pp. - J.G. Oosten, Henri J.M. Claessen, The early state. Mouton Publishers. The Hague, The Netherlands 1978. XII + 690 pages., P. Skalník (eds. - J.G. Oosten, Jean Poirier, Ethnologie Régionale 2. Asie-Amérique-Mascareignes. Sous la direction de Jean Poirier. Encyclopédie de la Pleiade. Gallimard, Paris 1978. - J.G. Oosten, A. de Ruyter, Een speurtocht naar het denken. Een inleiding tot het structuralisme van Claude Lévi Strauss. Van Gorcum & Comp. N.V., Assen 1979. Serie: Terreinverkenningen in de Culturele Anthropologie, nr. 16. - Anton Ploeg, Raymond C. Kelly, Etoro Social Structure. A study in structural contradiction. Foreword by Marshall Sahlins. The University of Michigan Press. Ann Arbor, 1974, 1977

  1. Book Reviews

    Directory of Open Access Journals (Sweden)

    Brian Swann

    1983-10-01

    Full Text Available - G.J. Abbink, J.M. Schoffeleers, Missie en Ontwikkeling in Oost-Afrika. Een ontmoeting van culturen, Nijmegen-Baarn: Katholiek Studiecentrum - Ambo, 1983, 167 pp., H. Obdeijn (eds. - Gary Brana-Shute, Barry B. Levine, Benjy Lopez: A picaresque tale of emigration and return. Basic Books, 1980. 240 pages, bibliography, no index. - Victoria M. Clara van Groenendael, Günter Spitzing, Das indonesische Schattenspiel Bali - Java - Lombok, Köln: Dumont, 1981, 236 pages, photographs, illustrations, map, tables, glossary, bibliography, index. Dumont-Taschenbücher 110. - Dirk van Dusseldorp, B. Galjart, Participation of the poor in development. Contributions to a seminar. 325 pp. Leiden development studies 2, Institute of cultural and social studies, University of Leiden, Leiden 1982., D. Buys (eds. - C. van Dijk, R. de Bruin, Islam en nationalisme in door Japan bezet Indonesië: 1942-1945, ‘s-Gravenhage: Staatsuitgeverij, 1982. Rijksinstituut voor Oorlogsdocumentatie, Cahiers over Nederland en de Tweede Wereldoorlog, nr. 3. - R. Hagesteijn, H.B. Sarkar, Literary heritage of Southeast Asia. Calcutta, Firma KLM Private Limited, 265 pages. - M. Hekker, S. Price, Afro-American arts of the Suriname rain forest. University of California Press, Berkeley/Los Angelos/London, 1981. 237 pp. Maps, Ill., R. Price (eds. - M. Hekker, S.R. Siregar, Adat, Islam and Christianity in a Batak Homeland. Athens, Ohio 1981. Papers in International studies, Southeast Asia series no. 57, Ohio University. 108 pp. - P.E. de Josselin de Jong, Wazir-Jahan Begum Karim, Ma’ Betisék concepts of living things, 1981. New Jersey: Athlone Press. London school of economics monographs on social anthropology no. 54. xv, 270 pp., 3 maps, 6 figs., 11 tables. - Peter Kloos, Paul Alexander, Sri Lanka Fishermen. Rural capitalism and peasant society. Canberra, Australian National University Monographs no. 7, 1982, 328 pp. - Peter Kloos, James Brow, Vedda villages of Anuradhapura. The

  2. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-01-01

    Jeroen Kemperman. Leiden: KITLV Press, 2002, 570 pp. [Verhandelingen 206.] -Gerry van Klinken, Grayson Lloyd ,Indonesia today; Challenges of history. Singapore: Institute of Southeast Asian studies, 2001, 359 pp., Shannon Smith (eds -Johanna van Reenen, Frédéric Durand, Timor Lorosa'e, pays au carrefour de l'Asie et du Pacifique; Un atlas géo-historique. Marne-la-Vallée: Presses Universitaires de Marne-la-Vallée, 2002, 208 pp. -William R. Roff, Mona Abaza, Debates on Islam and knowledge in Malaysia and Egypt; Shifting worlds. London: RoutledgeCurzon, 2002, xix + 304 pp. -Mariëtte van Selm, Chr. van Fraassen ,G.E. Rumphius, De Ambonse eilanden onder de VOC, zoals opgetekend in 'De Ambonse landbeschrijving'. Utrecht: Landelijk Steunpunt Educatie Molukkers, 2002, 254 pp., H. Straver (eds -K. Thirumaran, Prema-Chandra Athukorala, Crisis and recovery in Malaysia; The role of capital controls. Cheltenham: Elgar, 2001, xii + 159 pp. -K. Thirumaran, John Hilley, Malaysia; Mahathirism, hegemony and the new opposition. London: Zed books, 2001, xiii + 305 pp. -Reina van der Wiel, Damien Kingsbury ,Foreign devils and other journalists. Clayton VIC: Monash Asia Institute, 2000, vi + 277 pp. [Monash papers on Southeast Asia 52.], Eric Loo, Patricia Payne (eds -Jennifer Fraser, Philip Yampolsky, Music of Indonesia. Washington DC: Smithsonian Folkways recordings, 1991-2000, 20 compact discs plus a CD of selections from the series, Discover Indonesia. All with accompanying booklets. -Robert Wessing, Nicola Tannenbaum ,Founders' cults in Southeast Asia; Ancestors, polity, and identity. New Haven CT: Yale University Southeast Asian studies, 2003, xi + 373 pp. [Yale Southeast Asia studies Monograph 52.], Cornelia Ann Kammerer (eds -Robert Wessing, Henri Chambert-Loir ,The potent dead; Ancestors, saints and heroes in contemporary Indonesia. Crows Nest, New South Wales: Allen and Unwin, Honolulu: University of Hawai'i Press, 2002, xxvi + 243 pp. [Southeast Asia publications series

  3. Book Review

    Science.gov (United States)

    1999-07-01

    The International Cryogenic Engineering Conferences (ICEC) are held biennially and are medium-scale events (a few hundred participants) involving a wide range of cryogenic specialists. The Proceedings of the 17th Conference reflects this range clearly, comprising four sections. The first, and shortest, presents the texts of (some of) the plenary invited papers and covers topics ranging from `The first collection of liquid hydrogen' to `The application of bulk high-temperature superconductors'. Then follow three sections of approximately equal length (250--300 pages each) covering, respectively, refrigeration, superconductivity and cryogenics. The rapid recent development of closed cycle refrigerators is reflected in the content of the first section and is a firm indicator that the topic of cryogenic engineering is spreading out from its current twin, but limited, areas of the research laboratory and the large-scale particle or energy research facility. Expansion into both industry, commerce and medicine is apparent, as is the provision of facilities for other technologies (for example, high-field magnets for NMR, extending to 1 GHz). Later in this volume some of these future applications are described. The Kleemenko cycle, as lucidly explained by Bill Little, consists of a development of the Joule--Thomson expansion technique for cooling in which the expansion and cooling of a single component gas is replaced by the expansion and cooling of a mixture of gas and liquid phase. Pulse tube coolers now come in a variety of forms and sizes, in single stage and double stage forms, providing a lowest temperature so far of around 2 K with 2 stages or 20 K with a single stage. The ability of this design is to reduce mechanical vibration levels well below those achievable with conventional Gifford--McMahon or Stirling cycle coolers and this volume includes a review of developments of these types, as well as a number of research papers setting out the leading edge of

  4. The Shrinking Scholarly Book.

    Science.gov (United States)

    Heller, Scott

    1999-01-01

    Economic pressures in the publishing industry are causing faculty to write shorter books. The authors want their books to be readable, and publishers want to reduce costs and make the books affordable for a wider audience, including students. Brief but broad surveys, short introductory primers, quick biographies, and books with very basic themes…

  5. BOOK REVIEW: Complete Physics

    Science.gov (United States)

    Carson, Simon

    2000-03-01

    ', begins with an emphasis on the correct use of units in calculations that is very good (although again only really appropriate for more able students) and considers scientific notation and SI units. The use of triangles for rearranging three variable equations is introduced without any discussion of how to do the algebra properly. I found this rather out of place in a book of this level; I should personally hope to see those intending to pursue the subject beyond GCSE capable of rearranging equations without recourse to methods which convey no understanding of the physical relationship. The section on the `History of Key Ideas' has a double page spread on `Forces, Motion and Energy', `Rays, Waves and Particles' and `The Earth and Beyond', followed by a chronology of physics from 400 BC to 1990. These sections are necessarily very brief. The final section, `Experimental Physics', has some useful reminders for students about investigative work and a photocopiable checklist. The book has some very attractive features. Most pages include a boxed list of `essentials' that are useful either in skimming the text to find useful information or in revision. Each double page spread into which the material is arranged includes some fairly straightforward questions to test the basic ideas. Each section ends with a set of examination questions and with a checklist of ideas that can be photocopied for students to tick off what has been covered. The contents pages of the book may also be photocopied for students to check their progress. Given that this is a brand new book, I found the inclusion of a spread on ticker-tape rather old-fashioned: video is a much better way of analysing motion. The language of the text, too, can be rather dry and academic, and the organization reflects a traditional approach to the physics curriculum. The book would be most useful, I think, to able students studying single-subject physics courses at GCSE or to those beginning A-level. At £14.00 a copy, it

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1996-07-01

    . xiv + 217 pp., Lou Anne Barclay (eds -Catherine Levesque, Allison Blakely, Blacks in the Dutch world: The evolution of racial imagery in a modern society. Bloomington: Indiana University Press, 1993. xix + 327 pp. -Dennis J. Gayle, Frank Fonda Taylor, 'To hell with paradise': A history of the Jamaican tourist industry. Pittsburgh: University of Pittsburgh Press, 1993. ix + 239 pp. -John P. Homiak, Frank Jan van Dijk, Jahmaica: Rastafari and Jamaican society, 1930-1990. Utrecht: ISOR, 1993. 483 pp. -Peter Mason, Arthur MacGregor, Sir Hans Sloane: Collector, scientist, antiquary, founding Father of the British Museum. London: British Museum Press, 1994. -Philip Morgan, James Walvin, The life and times of Henry Clarke of Jamaica, 1828-1907. London: Frank Cass, 1994. xvi + 155 pp. -Werner Zips, E. Kofi Agorsah, Maroon heritage: Archaeological, ethnographic and historical perspectives. Kingston: Canoe Press, 1994. xx + 210 pp. -Michael Hoenisch, Werner Zips, Schwarze Rebellen: Afrikanisch-karibischer Freiheitskampf in Jamaica. Vienna Promedia, 1993. 301 pp. -Elizabeth McAlister, Paul Farmer, The uses of Haiti. Monroe ME: Common Courage Press, 1994. 432 pp. -Robert Lawless, James Ridgeway, The Haiti files: Decoding the crisis. Washington DC: Essential Books, 1994. 243 pp. -Bernadette Cailler, Michael Dash, Edouard Glissant. Cambridge: Cambridge University Press, 1995. xii + 202 pp. -Peter Hulme, Veronica Marie Gregg, Jean Rhys's historical imagination: Reading and writing the Creole. Chapel Hill: University of North Carolina Press, 1995. xi + 228 pp. -Silvia Kouwenberg, Francis Byrne ,Focus and grammatical relations in Creole languages. Amsterdam/Philadelphia: John Benjamins, 1993. xvi + 329 pp., Donald Winford (eds -John H. McWhorter, Ingo Plag, Sentential complementation in Sranan: On the formation of an English-based Creole language. Tübingen: Max Niemeyer, 1993. ix + 174 pp. -Percy C. Hintzen, Madan M. Gopal, Politics, race, and youth in Guyana. San Francisco: Mellen

  7. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Bastin

    1982-04-01

    . - F.G.P. Jaquet, H.J. de Graaf, Wonderlijke verhalen uit de Indische historie, ‘s-Gravenhage, Moesson 1981. 173 pp. Ills. - F.G.P. Jaquet, J. Landwehr, De Nederlander uit en thuis; spiegel van het dagelijks leven uit bijzondere zeventiende-eeuwse boeken. Alphen aan den Rijn, Sijthoff, 1981. 200 pp. Ills. - P.E. de Josselin de Jong, Michael G. Peletz, Social history and evolution in the interrelationship of adat and Islam in Rembau, Negeri Sembilan, Research Notes and Discussions Paper no. 27, Institute of Southeast Asian Studies, Singapore 1981. 59 pages. - P.E. de Josselin de Jong, Anthony Reid, Perceptions of the past in Southeast Asia, Heinemann Educational Books for Asian Studies Asociation of Australia, Singapore 1979. 436 pp. Bibliographical Appendix, Index, 3 maps., David Marr (eds. - J.E. van Lohuizen-de Leeuw, J. Bastin, Prints of Southeast Asia in the India Office Library - The East India Company in Malaysia and Indonesia 1786-1824, Her Majesty’s Stationery Office, London, 1979, XIII + 228 pp. including 98 pls., frontispiece in colour., P. Rohatgi (eds. - Anke Niehof, Victor T. King, Essays on Borneo Society, Hull Monographs on South-East Asia 7, Oxford University Press, 1978, 256 pp. - C.H.M. Nooy-Palm, Renato Rosaldo, Ilongot headhunting 1883-1974, a study in society and history. Stanford University Press, Stanford, California, 1980. 313 pp., maps, photographs and diagrams. Chronological and general index. - Els Postel-Coster, Clio Presvelou, The household, women and agricultural development, Proceedings of a symposium organised by the Department of Home Economics, Agricultural University, Wageningen, Miscellaneous Papers 17, 1980, Landbouwhogeschool Wageningen, The Netherlands., Saskia Spijkers-Zwart (eds. - G.J. van Reenen, Claudine Salmon, Les Chinois de Jakarta; Temples et vie collective [The Chinese of Jakarta; Temples and communal life], Etudes insulindiennes - Archipel 1, Association Archipel, Paris, 1980 (deuxième impression, xxviii + 358 pp

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    R. de Ridder

    1986-01-01

    (50 pp. - R. de Ridder, Dennis Tedlock, The spoken word and the work of interpretation, Philadelphia: University of Pennsylvania Press, 1983. ix + 365 pp., 8 ill. - R. de Ridder, Dennis Tedlock, Popol Vuh, The definitive edition of the Mayan Book of the Dawn of Life and the Glories of Gods and Kings, New York: Simon and Schuster, 1985. 380 pp., 32 ill. - G. van Roon, Dietmar Rothermund, Die Peripherie in der Weltwirtschaftskrise: Afrika, Asien und Lateinamerika 1929-1939, Paderborn: Ferdinand Schýningh, 1983, 295 pp. - Thilo C. Schadeberg, Gýnter Dabitz, Geschichte der erforschung der Nuba-Berge, Arbeiten aus dem Seminar fýr Výlkerkunde der Johann Wolfgang Goethe-Universitýt Frankfurt am Main, Band 17, Wiesbaden: Franz Steiner Verlag, 1985. 280 pp., maps, tables, illus. - L. van Vroonhoven, Ger van Roon, Derde Wereld in depressie, Leiden: Nijhoff, 1985, 139 p. - Wim van Zanten, Nigel Phillips, Sijobang, sung narrative poetry of West Sumatra, Cambridge Studies in Oral and Literate Culture, no. 1, Cambridge: Cambridge University Press, 1981. xi + 255 pp., photos, texts and translations, short glossary of Minangkabau words, Bibliography, index.

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-07-01

    Full Text Available -Bill Maurer, Mimi Sheller, Consuming the Caribbean: From Arawaks to Zombies. New York: Routledge, 2003. ix + 252 pp. -Norman E. Whitten, Jr., Richard Price ,The root of roots: Or, how Afro-American anthropology got its start. Chicago: Prickly Paradigm Press/University of Chicago Press, 2003. 91 pp., Sally Price (eds -Holly Snyder, Paolo Bernardini ,The Jews and the expansion of Europe to the West, 1450-1800. New York: Berghahn Books, 2001. xv + 567 pp., Norman Fiering (eds -Bridget Brereton, Seymour Drescher, The mighty experiment: Free labor versus slavery in British emancipation. New York: Oxford University Press, 2002. 307 pp. -Jean Besson, Kathleen E.A. Monteith ,Jamaica in slavery and freedom: History, heritage and culture. Kingston; University of the West Indies Press, 2002. xx + 391 pp., Glen Richards (eds -Michaeline A. Crichlow, Jean Besson, Martha Brae's two histories: European expansion and Caribbean culture-building in Jamaica. Chapel Hill: University of North Carolina Press, 2002. xxxi + 393 pp. -Christopher Schmidt-Nowara, Joseph C. Dorsey, Slave traffic in the age of abolition: Puerto Rico, West Africa, and the Non-Hispanic Caribbean, 1815-1859. Gainesville: University Press of Florida, 2003. xvii + 311 pp. -Arnold R. Highfield, Erik Gobel, A guide to sources for the history of the Danish West Indies (U.S. Virgin Islands, 1671-1917. Denmark: University Press of Southern Denmark, 2002. 350 pp. -Sue Peabody, David Patrick Geggus, Haitian revolutionary studies. Bloomington: Indiana University Press, 2002. xii + 334 pp. -Gerdès Fleurant, Elizabeth McAlister, Rara! Vodou, power, and performance in Haiti and its Diaspora. Berkeley: University of California Press, 2002. xviii + 259 pp. and CD demo. -Michiel Baud, Ernesto Sagás ,The Dominican people: A documentary history. Princeton NJ: Marcus Wiener, 2003. xiii + 278 pp., Orlando Inoa (eds -Samuel Martínez, Richard Lee Turits, Foundations of despotism: Peasants, the Trujillo regime

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    Janet Rodenburg

    1992-04-01

    Full Text Available - Leonard Y. Andaya, H.A. Poeze, Excursies in Celebes; Een bundel bijdragen bij het afscheid van J. Noorduyn als directeur-secretaris van het Koninklijk Instituut voor Taal-, Land- en Volkenkunde. Leiden: KITLV Uitgeverij, 1991, 348 pp., P. Schoorl (eds. - Anne Booth, Adrian Clemens, Changing economy in Indonesia Volume 12b; Regional patterns in foreign trade 1911-40. Amsterdam: Royal Tropical Institute, 1992., J.Thomas Lindblad, Jeroen Touwen (eds. - A.P. Borsboom, James F. Weiner, The empty place; Poetry space, and being among the Foi of Papua New Guinea. Bloomington: Indiana University Press, 1991. - Martin van Bruinessen, Ozay Mehmet, Islamic identity and development; Studies of the Islamic periphery. London and New York: Routledge, 1990 (cheap paperback edition: Kula Lumpur: Forum, 1990, 259 pp. - H.J.M. Claessen, Timothy Earle, Chiefdoms: power, economy, and ideology. A school of American research book. Cambridge: Cambridge University Press, 1991. 341 pp., bibliography, maps, figs. - H.J.M. Claessen, Henk Schulte Nordholt, State, village, and ritual in Bali; A historical perspective. (Comparitive Asian studies 7. Amsterdam: VU University press for the centre for Asian studies Amsterdam, 1991. 50 pp. - B. Dahm, Ruby R. Paredes, Philippine colonial democracy. (Monograph series 32/Yale University Southeast Asia studies. New Haven: Yale Center for international and Asia studies, 1988, 166 pp. - Eve Danziger, Bambi B. Schieffelin, The give and take of everyday life; Language socialization of Kaluli children. (Studies in the social and cultural foundations of language 9. Cambridge: Cambridge University Press, 1991. - Roy Ellen, David Hicks, Kinship and religion in Eastern Indonesia. (Gothenburg studies in social anthropology 12. Gothenburg: Acta Universitatis Gothoburgensis, 1990, viii 132 pp., maps, figs, tbls. - Paul van der Grijp, Pierre Lemonnier, Guerres et festins; Paix, échanges et competition dans les highlands de Nouvelle

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2003-01-01

    Full Text Available -Timothy Barnard, J.M. Gullick, A history of Selangor (1766-1939. Kuala Lumpur: Malaysian branch of the Royal Asiatic Society, 1989, vi + 220 pp. [MBRAS Monograph 28.] -Okke Braadbaart, Michael L. Ross, Timber booms and institutional breakdown in Southeast Asia. Cambridge: Cambridge University Press, 2001, xvi + 237 pp. -H.J.M. Claessen, Patrick Vinton Kirch ,Hawaiki, ancestral Polynesia; An essay in historical anthropology. Cambridge: Cambridge University Press, 2001, xvii + 375 pp., Roger C. Green (eds -Harold Crouch, R.E. Elson, Suharto; A political biography. Cambridge: Cambridge University Press, 2001, xix + 389 pp. -Kees van Dijk, H.W. Arndt ,Southeast Asia's economic crisis; Origins, lessons, and the way forward. Singapore: Institute of Southeast Asian studies, 1999, ix + 182 pp., Hal Hill (eds -Kees van Dijk, Sebastiaan Pompe, De Indonesische algemene verkiezingen 1999. Leiden: KITLV Uitgeverij, 1999, 290 pp. -David van Duuren, Albert G. van Zonneveld, Traditional weapons of the Indonesian archipelago. Leiden: Zwartenkot art books, 2001, 160 pp. -Peter van Eeuwijk, Christian Ph. Josef Lehner, Die Heiler von Samoa. O Le Fofo; Monographie über die Heiler und die Naturheilmethoden in West-Samoa. Frankfurt am Main: Lang, 1999, 234 pp. [Mensch und Gesellschaft 4.] -Hans Hägerdal, Frans Hüsken ,Reading Asia; New research of Asian studies. Richmond: Curzon, 2001, xvi + 338 pp., Dick van der Meij (eds -Terence E. Hays, Jelle Miedema ,Perspectives on the Bird's head of Irian Jaya, Indonesia; Proceedings of the conference, Leiden, 13-17 October 1997. Amsterdam: Rodopi, 1998, xiii + 982 pp. (editors with the assistance of Connie Baak, Cecilia Odé, Rien A.C. Dam (eds -Menno Hekker, Peter Metcalf, They lie, we lie; Getting on with anthropology. London: Routledge, 2002, ix + 155 pp. -David Henley, Foong Kin, Social and behavioural aspects of malaria control; A study among the Murut of Sabah. Phillips, Maine: Borneo research council , 2000, xx

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-01-01

    Full Text Available -Louis Allaire, Samuel M. Wilson, Hispaniola: Caribbean chiefdoms in the age of Columbus. Tuscaloosa: University of Alabama Press, 1990. xi + 170 pp. -Douglas Melvin Haynes, Philip D. Curtin, Death by migration: Europe's encounter with the tropical world in the nineteenth century. Cambridge: Cambridge University Press, 1989. xviii + 251 pp. -Dale Tomich, J.H. Galloway, The sugar cane industry: An historical geography from its origins to 1914. Cambridge: Cambridge University Press, 1989. xii + 266 pp. -Myriam Cottias, Dale Tomich, Slavery in the circuit of sugar: Martinique and the world economy, 1830 -1848. Baltimore: John Hopkins University Press, 1990. xiv + 352 pp. -Robert Forster, Pierre Dessalles, La vie d'un colon à la Martinique au XIXe siècle. Pré-senté par Henri de Frémont. Courbevoie: s.n., 1984-1988, four volumes, 1310 pp. -Hilary Beckles, Douglas V. Armstrong, The old village and the great house: An archaeological and historical examination of Drax Hall Plantation, St Ann's Bay, Jamaica. Chicago: University of Illinois Press, 1990. xiii + 393 pp. -John Stewart, John A. Lent, Caribbean popular culture. Bowling Green OH: Bowling Green State University Popular Press, 1990. 157 pp. -W. Marvin Will, Susanne Jonas ,Democracy in Latin America: Visions and realities. New York: Bergin & Garvey Publishers, 1990. viii + 224 pp., Nancy Stein (eds -Forrest D. Colburn, Kathy McAfee, Storm signals: Structural adjustment and development alternatives in the Caribbean. London: Zed books, 1991. xii + 259 pp. -Derwin S. Munroe, Peggy Antrobus ,In the shadows of the sun: Caribbean development alternatives and U.S. policy. Carmen Diana Deere (coordinator, Peter Phillips, Marcia Rivera & Helen Safa. Boulder CO: Westview Press, 1990. xvii + 246 pp., Lynne Bolles, Edwin Melendez (eds -William Roseberry, Louis A. Pérez, Jr., Lords of the mountain: Social banditry and peasant protest in Cuba, 1878-1918. Pittsburgh: University of Pittsburgh Press, 1989

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-07-01

    Full Text Available -Peter Hulme, Stephen Greenblatt, New World Encounters. Berkeley: University of California Press, 1993. xviii + 344 pp. -Nigel Rigby, Alan Riach ,The radical imagination: Lectures and talks by Wilson Harris. Liège: Department of English, University of Liège, xx + 126 pp., Mark Williams (eds -Jonathan White, Rei Terada, Derek Walcott's poetry: American Mimicry. Boston: North-eastern University Press, 1992. ix + 260 pp. -Ray A. Kea, John Thornton, Africa and Africans in the making of the Atlantic world, 1400-1680. Cambridge: Cambridge University Press, 1992. xxxviii + 309 pp. -B.W. Higman, Barbara L. Solow, Slavery and the rise of the Atlantic system. Cambridge: Cambridge University Press, 1991. viii + 355 pp. -Sidney W. Mintz, Michael Mullin, Africa in America: Slave acculturation and resistance in the American South and the British Caribbean, 1736-1831. Urbana: University of Illinois Press. 412 pp. -Karen Fog Olwig, Corinna Raddatz, Afrika in Amerika. Hamburg: Hamburgisches Museum für Völkerkunde, 1992. 264 pp. -Lee Haring, William Bascom, African folktales in the new world. Bloomington: Indiana University Press, 1992. xxv + 243 pp. -Frank Jan van Dijk, Dale A. Bisnauth, History of religions in the Caribbean. Kingston: Kingston Publishers, 1989. 225 pp. -Gloria Wekker, Philomena Essed, Everyday racism: Reports from women of two cultures. Alameda CA: Hunter House, 1990. xiii + 288 pp.''Understanding everyday racism: An interdisciplinary theory. Newbury Park CA: Sage, 1991. x + 322 pp. -Deborah S. Rubin, Vron Ware, Beyond the Pale: White women, racism, and history. London: Verso, 1992. xviii + 263 pp. -Michael Hanchard, Peter Wade, Blackness and race mixture: The dynamics of racial identity in Colombia. Baltimore: John Hopkins University Press, 1993. xv + 415 pp. -Rosalie Schwartz, Louis A. Pérez, Jr., Slaves, sugar, & colonial society: Travel accounts of Cuba, 1801-1899. Wilmington DE: SR Books, 1992. xxvi + 259 pp. -Susan Eckstein, Sandor

  14. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-01-01

    Full Text Available -Peter Hulme, Simon Gikandi, Writing in limbo: Modernism and Caribbean literature. Ithaca: Cornell University Press, 1992. x + 260 pp. -Charles V. Carnegie, Alistair Hennessy, Intellectuals in the twentieth-century Caribbean (Volume 1 - Spectre of the new class: The Commonwealth Caribbean. London: Macmillan, 1992. xvii 204 pp. -Nigel Rigby, Anne Walmsley, The Caribbean artists movement, 1966-1972: A literary and cultural history. London: New Beacon Books, 1992. xx + 356 pp. -Carl Pedersen, Tyrone Tillery, Claude McKay: A black poet's struggle for identity. Amherst: University of Massachusetts Press, 1992. xii + 235 pp. -Simone Dreyfus, Irving Rouse, The Tainos: Rise and decline of the people who greeted Columbus. New Haven: Yale University Press, 1992. xii + 211 pp. -Louis Allaire, Antonio M. Stevens-Arroyo, Cave of the Jagua: The mythological world of the Taino. Alburquerque: University of New Mexico Press, 1988. xiii + 282 pp. -Irving Rouse, William F. Keegan, The people who discovered Columbus: The prehistory of the Bahamas. Gainesville: University of Florida Press, 1992. xx + 279 pp. -Neil L. Whitehead, Philip P. Boucher, Cannibal encounters: Europeans and Island Caribs, 1492-1763. Baltimore: John Hopkins University Press, 1992. xii + 217 pp. -Peter Kloos, Kaliña, des amérindiens à Paris: Photographies du prince Roland. Présentées par Gérard Collomb. Paris: Créaphis, 1992. 119 pp. -Maureen Warner-Lewis, Alan Gregor Cobley ,The African-Caribbean connection: Historical and cultural perspectives. Bridgetown, Barbados: Department of History, University of the West Indies, Cave Hill, 1990. viii + 171 pp., Alvin Thompson (eds -H. Hoetink, Jean-Luc Bonniol, La couleur comme maléfice: une illustration créole de la généalogie des 'Blancs' et des 'Noirs'. Paris: Albin Michel, 1992. 304 pp. -Michael Aceto, Richard Price ,Two evenings in Saramaka. Chicago and London: University of Chicago Press, 1991. xvi + 417 pp., Sally Price (eds -Jorge P

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-07-01

    Full Text Available -Gesa Mackenthun, Stephen Greenblatt, Marvelous Possessions: The wonder of the New World. Chicago: University of Chicago Press, 1991. ix + 202 pp. -Peter Redfield, Peter Hulme ,Wild majesty: Encounters with Caribs from Columbus to the present day. An Anthology. Oxford: Oxford University Press, 1992. x + 369 pp., Neil L. Whitehead (eds -Michel R. Doortmont, Philip D. Curtin, The rise and fall of the plantation complex: Essays in Atlantic history. New York: Cambridge University Press, 1990. xi + 222 pp. -Roderick A. McDonald, Hilary McD.Beckles, A history of Barbados: From Amerindian settlement to nation-state. Cambridge: Cambridge University Press, 1990. xv + 224 pp. -Gertrude J. Fraser, Hilary McD.Beckles, Natural rebels; A social history of enslaved black women in Barbados. New Brunswick NJ and London: Rutgers University Press and Zed Books, 1990 and 1989. ix + 197 pp. -Bridget Brereton, Thomas C. Holt, The problem of freedom: Race, labor, and politics in Jamaica and Britain, 1832-1938. Baltimore: John Hopkins University Press, 1991. xxxi + 517 pp. -Peter C. Emmer, A. Meredith John, The plantation slaves of Trinidad, 1783-1816: A mathematical and demographic inquiry. Cambridge: Cambridge University Press, 1988. xvi + 259 pp. -Richard Price, Robert Cohen, Jews in another environment: Surinam in the second half of the eighteenth century. Leiden: E.J. Brill, 1991. xv + 350 pp. -Russell R. Menard, Nigel Tattersfield, The forgotten trade: comprising the log of the Daniel and Henry of 1700 and accounts of the slave trade from the minor ports of England, 1698-1725. London: Jonathan Cape, 1991. ixx + 460 pp. -John D. Garrigus, James E. McClellan III, Colonialism and science: Saint Domingue in the old regime. Baltimore: John Hopkins University Press, 1992. xviii + 393 pp. -Lowell Gudmundson, Richard H. Collin, Theodore Roosevelt's Caribbean: The Panama canal, the Monroe doctrine, and the Latin American context. Baton Rouge: Louisiana State University

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    Joseph Aquilina

    1976-01-01

    .J. Zoetmulder, Himansu Bhusan Sarkar, Corpus of the inscriptions of Java (Corpus Inscriptionum Javanicorum (up to 928 A.D., K.L. Mukhopadhyay, Calcutta, 1972. Vol. I 314 pp., Vol. II 359 pp. - J.G. Oosten, Wilhelmina van Wetering, Hekserij bij de Djuka. Een sociologische benadering. Academisch proefschrift, gestencilde uitgave, 1973. - Willem F.L. Buschkens, Richard Price, Maroon societies, rebel slave communities in the Americas. Anchor Books, Anchor Press/Doubleday Garden City, New York 1973. 429 pag., 7 ill.

  17. "Lolita": Genealogy of a Cover Girl

    Science.gov (United States)

    Savage, Shari L.

    2015-01-01

    At the publication of Vladimir Nabokov's controversial novel "Lolita" (1958), the author insisted that a girl never appear on the cover. This discourse analysis of 185 "Lolita" book covers, most of which feature a girl, considers the genealogy of "Lolita" in relation to representation, myth, and tacit knowledge…

  18. Books Are Good Friends

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Books are our friends because they are bridges to knowledge.Knowledge is valuable because it enriches our life and brings us happiness.Almost all great men in the history of mankind loved books.We have every reason to believe it is the knowledge in books that led them to success.There is no genius without books.Because books give them knowledge and knowledge gives them

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    studies. New Haven, 1990. xiii + 369 pp., W.J. O’Malley, A. Weidemann (eds. - Gisele de Meur, F. Tjon Sie Fat, Representing kinship; Simple models of elementary structures. 1990. (Doctoral thesis. Leiden, published by the author. - Toon van Meijl, Maurice Godelier, Big men and great men; Personifications of power in Melanesia, Cambridge/Paris: Cambridge University Press/Editions de la maison des sciences de l’Homme, 1991, xviii, 328 pp., maps, tables, figures, bibliography, index., Marilyn Strathern (eds. - J.A. de Moor, B.A. Hussainmiya, Orang rejimen; The Malays of the Ceylon rifle regiment. Bangi: Universiti Kebangsaan Malaysia, 1990, 185 pp. - Pieter Muysken, J.M.W. Verhaar, Melanesian pidgin and tok pisin; Studies in language companion series 20. Amsterdam: Benjamins, 1990, xiv + 409 pp. - Niels Mulder, Paul Voogt, Thailand. Amsterdam/’s-Gravenhage: Koninklijk Instituut voor de Tropen/NOVIB, 1991. 70 pp. + kaart, slappe kaft., Han ten Brummelhuis, Irene Stengs (eds. - Ton van Naerssen, George Cho, The Malaysian economy; Spatial perspectives. London: Routledge. 1990, 300 pp. - Julianti Parani, J.R. van Diessen, Jakarta/Batavia. Het centrum van het Nederlandse koloniale rijk in Azië en zijn cultuurhistorische nalatenschap. Cantecleer Kunst - Reisgidsen. De Bilt: Cantecleer, 1989. 343 pp. - A. Ploeg, Christopher J. Healey, Pioneers of the mountain forest, University of Sydney, 1985, Oceania Monographs no. 29, v + 64 pp., plates, figures, maps. - Els Postel-Coster, Carla Risseeuw, The fish don’t talk about the water; Gender transformation, power and resistance among women in Sri Lanka, Leiden: E.J.Brill, 1988, 415 pp., also published as Gender transformation, power and resistance among women in Sri Lanka; The fish don’t speak about the water, New Delhi: Manohar Book service, 1991. Ca. 400 pp., - Willem van Schendel, Mya Tan, Myanmar dilemmas and options; The challenge of economic transition in the 1990’s. Singapore: Institute of Southeast Asian studies, 1990

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Arvind N. Das

    1988-01-01

    /Oxford/New York: Oxford University Press, 1986, xiv + 55 pp., 164 ills., bibl., index, map; hard cover. - David S. Moyer, H.T. Wilson, Tradition and innovation: The idea of civilization as culture and its significance. The international library of phenomenology and moral science, Routledge & Kegan Paul, London, 1984, X + 208 pp. - J.G. Oosten, Edmund Leach, Structuralist interpretations of biblical myth, Cambridge University Press, 1983., D. Alan Aycock (eds. - Frank Perlin, Arvind N. Das, The `Longue Durée’: Continuity and change in Changel; Historiography of an Indian village from the 18th towards the 21st century, CASP 14, Rotterdam, 1986, vii + 94pp., 1 map. - Herman Slaats, Recht in ontwikkeling: Tien agrarisch-rechtelijke opstellen, uitgegeven door de Vakgroep Agrarisch Recht, Landbouw-universiteit Wageningen, Deventer: Kluwer, 1986, VI + 172 blz., 2 appendixes. - A.A. Trouwborst, Léon de Sousberghe, Don et contre-don de la vie; Structure élémentaire de parenté et union préférentielle, Studia Instituti Anthropos 49, Anthropos-Institut, St. Augustin, 1986, 155 pp. - Pieter van de Velde, R.H. Barnes, Contexts and levels; Anthropological essays on hierarchy, Oxford: JASO occasional papers 4. Paperback, vii + 219 pp., separate bibliographies and name and subject indexes., D. de Coppet, R.J. Parkin (eds. - Neil Lancelot Whitehead, C.J.M.R. Gullick, Myths of a minority - the changing traditions of the Vincentian Caribs, Van Gorcum, Assen, 1985.

  1. The thirteen books of the elements

    CERN Document Server

    Euclid

    1956-01-01

    Volume 3 of three-volume set containing complete English text of all 13 books of the Elements plus critical apparatus analyzing each definition, postulate, and proposition in great detail. Covers textual and linguistic matters; mathematical analyses of Euclid's ideas; classical, medieval, Renaissance and modern commentators; refutations, supports, extrapolations, reinterpretations and historical notes. Vol. 3 includes Books 10-13: Commensurable magnitudes, solids, cones, cylinders.

  2. Newnes audio and Hi-Fi engineer's pocket book

    CERN Document Server

    Capel, Vivian

    2013-01-01

    Newnes Audio and Hi-Fi Engineer's Pocket Book, Second Edition provides concise discussion of several audio topics. The book is comprised of 10 chapters that cover different audio equipment. The coverage of the text includes microphones, gramophones, compact discs, and tape recorders. The book also covers high-quality radio, amplifiers, and loudspeakers. The book then reviews the concepts of sound and acoustics, and presents some facts and formulas relevant to audio. The text will be useful to sound engineers and other professionals whose work involves sound systems.

  3. Newnes passive and discrete circuits pocket book

    CERN Document Server

    MARSTON, R M

    2000-01-01

    Newnes Passive and Discrete Circuits Pocket Book is aimed at all engineers, technicians, students and experimenters who can build a design directly from a circuit diagram. In a highly concise form Ray Marston presents a huge compendium of circuits that can be built as they appear, adapted or used as building blocks. The devices used have been carefully chosen for their ease of availability and reasonable price. The selection of devices has been thoroughly updated for the second edition, which has also been expanded to cover the latest ICs.The three sections of the book cover: Moder

  4. Cover Picture.

    Science.gov (United States)

    Breuning; Ruben; Lehn; Renz; Garcia; Ksenofontov; Gütlich; Wegelius; Rissanen

    2000-07-17

    The cover picture shows how both, fine arts and science, avail themselves of a system of intertwined symbolic and iconic languages. They make use of a common set of abstracted signs to report on their results. Thus, already in 1925, Wassily Kandinsky painted a masterpiece (bottom), which now, 75 years later, might be regarded as a blueprint for a scientific project. In his painting, Kandinsky pictured a grid-shaped sign that resembles in effect an actual molecular switch. Apparently following an enigmatic protocol, the groups of Lehn and Gütlich (see p. 2504 ff. for more details) constructed a grid-type inorganic architecture that operates as a three-level magnetic switch (center) triggered by three external perturbations (p, T, hnu). The switching principle is based on the spin-crossover phenomenon of Fe(II) ions and can be monitored by Mössbauer spectroscopy (left) and magnetic measurements (rear). Maybe not by chance, the English translation of the title of the painting "signs" is a homonym of "science", since both presented works are a product of the insatiable curiosity of man and his untiring desire to recognize his existence.

  5. Sganzerla Cover

    Directory of Open Access Journals (Sweden)

    Victor da Rosa

    2014-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-7917.2014v19n1p158 Neste artigo, realizo uma leitura do cinema de Rogério Sganzerla, desde o clássico O bandido da luz vermelha até os documentários filmados na década de oitenta, a partir de duas noções centrais: cover e over. Para isso, parto de uma controvérsia com o ensaio de Ismail Xavier, Alegorias do subdesenvolvimento, em que o crítico realiza uma leitura do cinema brasileiro da década de sessenta através do conceito de alegoria; depois releio uma série de textos críticos do próprio Sganzerla, publicados em Edifício Sganzerla, procurando repensar as ideias de “herói vazio” ou “cinema impuro” e sugerindo assim uma nova relação do seu cinema com o tempo e a representação; então busco articular tais ideias com certos procedimentos de vanguarda, como a falsificação, a cópia, o clichê e a colagem; e finalmente procuro mostrar que, no cinema de Sganzerla, a partir principalmente de suas reflexões sobre Orson Welles, a voz é usada de maneira a deformar a interpretação naturalista.

  6. BookFinder.com

    CERN Document Server

    BookFinder.com is produced by the bibliophiles at 13th Generation Media of Berkeley, California. Our goal is to provide fellow readers unbiased realtime information about books available online. Rather than selling books ourselves (does the world rea Amazon.com wannabe?), we've teamed up with over 15,000 of the finest booksellers online to bring you the largest book catalog available anywhere, either online or offline.

  7. Companionship of Books

    Institute of Scientific and Technical Information of China (English)

    薛美娟

    2012-01-01

    A man may usually be known by the books he reads as well as by the company he keeps; for there is a companionship of books as well as of men~ and one should always live in the best company, whether it be of books or of men.

  8. Book review: Physics of tsunamis

    Science.gov (United States)

    Geist, Eric L.

    2017-01-01

    “Physics of Tsunamis”, second edition, provides a comprehensive analytical treatment of the hydrodynamics associated with the tsunami generation process. The book consists of seven chapters covering 388 pages. Because the subject matter within each chapter is distinct, an abstract appears at the beginning and references appear at the end of each chapter, rather than at the end of the book. Various topics of tsunami physics are examined largely from a theoretical perspective, although there is little information on how the physical descriptions are applied in numerical models.“Physics of Tsunamis”, by B. W. Levin and M. A. Nosov, Second Edition, Springer, 2016; ISBN-10: 33-1933106X, ISBN-13: 978-331933-1065

  9. Astronomical Knowledge from Holy Books

    Science.gov (United States)

    Farmanyan, Sona V.; Devrikyan, Vardan G.; Mickaelian, Areg M.

    2016-10-01

    We investigate religious myths related to astronomy from different cultures in an attempt to identify common subjects and characteristics. The paper focuses on astronomy in religion. The initial review covers records from Holy books about sky related superstitious beliefs and cosmological understanding. The purpose of this study is to introduce sky related religious and national traditions (particularly based on different calendars; Solar or Lunar). We carried out a comparative study of astronomical issues contained in a number of Holy books. We come to the conclusion that the perception of celestial objects varies from culture to culture, and from religion to religion and preastronomical views had a significant impact on humankind, particularly on religious diversities. We prove that Astronomy is the basis of cultures, and that national identity and mythology and religion were formed due to the special understanding of celestial objects.

  10. Love British Books 2012

    OpenAIRE

    Middleton, Paul; Puzzovio, Carolyn

    2012-01-01

    The book is a catalogue of an exhibition of British books to be held in Armenia in June 2012 at the 'Armenian Society for Cultural Relations with Foreign Countries'. This is an event arranged with the Armenian Ministry of Culture as part of the UNESCO: 'Yerevan, International Book Capital 2012' & the Armenian 2012 celebrations to mark the 500th anniversary of the first printed book in the Armenian language. The catalogue describes all the books in the exhibition, with a photograph of each and...

  11. BOOK REVIEW: Two Books about FRBR, Compared

    Directory of Open Access Journals (Sweden)

    Christine Schwartz

    2008-09-01

    Full Text Available This article reviews 2 books on FRBR published in the past year. Although both books aim to be introductions to FRBR, their approaches are very different. One is sort of a FRBR study guide with commentary, the other a collection of essays. Robert Maxwell's book, FRBR: A Guide for the Perplexed, takes the study guide approach. Arlene Taylor edited Understanding FRBR: What It Is and How It Will Affect Our Retrieval Tools, a book of essays about FRBR and FRAD, written by cataloging experts, aimed at a broader audience, not just the cataloging specialist. The first seven chapters lay out the basics: introductions to FRBR and FRAD, FRBR research, FRBR and the history of cataloging, FRBR and RDA. These chapters provide an excellent introduction for those new to FRBR. The last seven chapters each look at different types of resources in relation to FRBR.

  12. BOOK REVIEW: Quantum Squeezing

    Science.gov (United States)

    Zubairy, Suhail

    2005-05-01

    Langevin formalism for squeezing in lasing systems. In the last article of this part, Wiseman deals with squeezing systems when the system's environment can be deliberately engineered so that the feedback is important. The third part of the book includes four articles dealing with the applications of quantum squeezing. In the first article, Yuen presents a discussion of communications and measurement using squeezed states and discusses the advantages of using nonclassical light over classical light in communications and measurement. In the second article, Swain deals with the interaction of squeezed light with the atomic systems and presents a review of novel phenomena in spectroscopy. This chapter on two-level atomic system is followed by Ficek's article on squeezed-light based spectroscopy in three-level atomic systems. In the last article, Reid again addresses the advantages of squeezed light in communications, but her emphasis is different from that of Yuen's article. Here she discusses EPR correlations for squeezed light and presents squeezed-light based methods for quantum cryptography. All the authors are leading figures in the field of squeezed states who have made pioneering contributions to various aspects of the field over the years. This is reflected in the authoritative style with which all the articles are written. These articles are rich in content, easy to read and cover a broad base. The emphasis is however on the theoretical aspects with occasional references to experimental work. This book is an excellent collection of articles on quantum squeezing that are highly useful both for beginners who would like to learn about squeezing and its applications, as well as for experts who would like to learn about the frontiers.

  13. AQA GCSE computer science student's book

    CERN Document Server

    Cushing, Steve

    2013-01-01

    Written by a subject expert and experienced author, AQA GCSE Computer Science Student's Book guide you through the differently assessed elements of the specification and covers Component 1: Practical Programming (controlled assessment) and Component 2: Computing Fundamental s (examined component). - Provides strategies for teachers and students for tackling the practical elements of the course. - Supports students in understanding the theoretical aspects of the course and developing key skills. - Covers the key aspects of designing a solution, solution development, programming techniques, and

  14. U. S. Department of Energy project book

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    This book covers representative projects in each program within the Department of Energy. The projects included were selected to provide an insight into the wide spectrum of projects authorized and under way in the Department. The projects described do not cover all projects authorized - they are merely representative. Descriptions, goals, and status are given for 29 energy projects, 4 scientific projects, and 5 defense projects. (RWR)

  15. The copyright book a practical guide

    CERN Document Server

    Strong, William S

    2014-01-01

    Through five editions since 1981, this book has offered the most comprehensive accessible guide available to all aspects of copyright law. Now, with the sixth edition, The Copyright Book has been thoroughly updated to cover copyright for the Internet age, discussing a range of developments in the law since 2000. The only book written for nonlawyers that covers the entire field of copyright law, it is essential reading for authors, artists, creative people in every medium, the companies that hire them, users of copyrighted material, and anyone with an interest in copyright law from a policy perspective. New material includes greatly expanded coverage of infringement and fair use, with detailed discussion of recent decisions, including the Grateful Dead, Google, and HathiTrust cases. The new edition considers such topics as open access, the defeat of the Stop Online Piracy Act (SOPA), file sharing, e-reserves, the status of "orphan works," and the latest developments under the Digital Millennium Copyright Act (...

  16. MacBook Pro portable genius

    CERN Document Server

    Gruman, Galen

    2013-01-01

    Learn the skills, tools and shortcuts you need in order to make the most of your MacBook Pro This easy-to-use, compact guide skips the fluff and gets right to the essentials so that you can maximize all the latest features of the MacBook Pro. Packed with savvy insights and tips on key tools and shortcuts, this handy book aims to help you increase your productivity and save you time and hassle. From desktop sharing and wireless networking to running Windows applications and more, this book shows you what you want to know. Includes the latest version of OS X, iCloud, FaceTime, and moreCovers al

  17. The Language of Man. Book 3.

    Science.gov (United States)

    Littell, Joseph Fletcher, Ed.

    Book 3 from "The Language of Man" textbook series contains four sections, each of which includes several articles. The articles cover semantics, use of the dictionary and encyclopedia, use of figurative language, and coping with the mass media. The sections are augmented with humorous features, examples from real life, and graphics. The style is…

  18. A Comprehensive Book on Autism Spectrum Disorders

    Science.gov (United States)

    Mohammadi, Mohammad-Reza, Ed.

    2011-01-01

    The aim of the book is to serve for clinical, practical, basic and scholarly practices. In twentyfive chapters it covers the most important topics related to Autism Spectrum Disorders in the efficient way and aims to be useful for health professionals in training or clinicians seeking an update. Different people with autism can have very different…

  19. Newnes circuit calculations pocket book with computer programs

    CERN Document Server

    Davies, Thomas J

    2013-01-01

    Newnes Circuit Calculations Pocket Book: With Computer Programs presents equations, examples, and problems in circuit calculations. The text includes 300 computer programs that help solve the problems presented. The book is comprised of 20 chapters that tackle different aspects of circuit calculation. The coverage of the text includes dc voltage, dc circuits, and network theorems. The book also covers oscillators, phasors, and transformers. The text will be useful to electrical engineers and other professionals whose work involves electronic circuitry.

  20. Elements of Mathematics, Book 11: Finite Probability Spaces.

    Science.gov (United States)

    Exner, Robert; And Others

    One of 12 books developed for use with the core material (Book O) of the Elements of Mathematics Program, this text covers material well beyond the scope of the usual secondary mathematics sequences. These materials are designed for highly motivated students with strong verbal abilities; mathematical theories and ideas are developed through…

  1. Cesar Chavez and La Causa: Books for Children and Teenagers.

    Science.gov (United States)

    Garza de Cortes, Oralia

    1995-01-01

    Evaluates biographies of Cesar Chavez for children and teenagers and provides descriptions of recent books on the children of migrant farm workers. The books, mostly published in the 1990s, cover Chavez's rise as a farm worker activist and include several new works that address the social history of Chavez and the farm workers' struggle. (GR)

  2. BOOK REVIEW: Modern Supersymmetry

    Science.gov (United States)

    Kulish, Petr P.

    2006-12-01

    S/CFT correspondence. The author explains clearly most of the arguments in discussions and refers for further details to original papers (with corresponding arXiv numbers), selected lists of which appear at the end of each chapter (there are more than 300 references in the book). Considered as a whole the book covers primers on quantum fields, Feynman diagrams, renormalization procedure and renormalization groups, as well as the representation theory of classical linear Lie algebras. Some necessary information on irreducible representations of su(N), so(N) and sp(2N) is given in an appendix. There are in the text short historical and biographical notes concerning those scientists who made important contributions to the subject of the monograph: S Coleman, Yu Golfand, E Witten and others. Most of the seventeen chapters contain a few exercises to check the reader's understanding of the corresponding material. This monograph will be useful for graduate students and researchers in the field of elementary particles.

  3. English Book Club

    CERN Multimedia

    English Book Club

    2012-01-01

    The CERN English Book Club will hold its 2012 AGM at 17h30 on Monday 5th March in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before February 27th. The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  4. English Book Club

    CERN Multimedia

    CERN English Book Club

    2010-01-01

    AGM  --  AGM  -- 2010 --  AGM  --  AGM The CERN ENGLISH BOOK CLUB will hold its 2010 AGM at 18h00 on Monday November 22nd in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before November 12th. AGM  --  AGM  -- 2010 --  AGM  --  AGM The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.  

  5. Astronomical Knowledge in Holy Books

    Science.gov (United States)

    Farmanyan, Sona V.; Mickaelian, Areg M.

    2015-08-01

    We investigate religious myths related to astronomy from different cultures in an attempt to identify common subjects and characteristics. The paper focuses on astronomy in religion. The initial review covers records from Holy books about sky related superstitious beliefs and cosmological understanding. The purpose of this study is to introduce sky related religious and national traditions (particularly based on different calendars; Solar or Lunar). We carried out a comparative study of astronomical issues contained in a number of Holy books: Ancient Egyptian Religion (Pyramid Texts), Zoroastrianism (Avesta), Hinduism (Vedas), Buddhism (Tipitaka), Confucianism (Five Classics), Sikhism (Guru Granth Sahib), Christianity (Bible), Islam (Quran), Druidism (Mabinogion) and Maya Religion (Popol Vuh). These books include various information on the creation of the Universe, Sun and Moon, the age of the Universe, Cosmic sizes, understanding about the planets, stars, Milky Way and description of the Heavens in different religions. We come to the conclusion that the perception of celestial objects varies from culture to culture, and from religion to religion and preastronomical views had a significant impact on humankind, particularly on religious diversities. We prove that Astronomy is the basis of cultures, and that national identity and mythology and religion were formed due to the special understanding of celestial objects.

  6. Electrical engineer's reference book

    CERN Document Server

    Laughton, M A

    1985-01-01

    Electrical Engineer's Reference Book, Fourteenth Edition focuses on electrical engineering. The book first discusses units, mathematics, and physical quantities, including the international unit system, physical properties, and electricity. The text also looks at network and control systems analysis. The book examines materials used in electrical engineering. Topics include conducting materials, superconductors, silicon, insulating materials, electrical steels, and soft irons and relay steels. The text underscores electrical metrology and instrumentation, steam-generating plants, turbines

  7. Give a Book, Take a Book | Poster

    Science.gov (United States)

    Collection has begun for the 15th Annual Book & Media Swap sponsored by the Scientific Library. NCI at Frederick staff can use this opportunity to clear out personal book and DVD shelves of unwanted materials, donate them to the swap, and then receive “new” materials in return. The library staff will collect materials through Tuesday, Oct. 27. Kick-off day for the event is Wednesday, Oct. 28, 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549.

  8. Old Books and E-Books

    OpenAIRE

    Darnton, Robert

    2007-01-01

    The crisis in academic publishing has reached a point where young scholars in many fields of the humanities may no longer be able to communicate their research in the time-honoured manner - that is, in the form of a traditional codex printed by a university press. Sooner or later, most monographs will probably have to be published on the Internet. What form will they take? A tentative answer to that question is provided by a sketch for an electronic book about publishing and the book trade in...

  9. BOOK REVIEW: Principles of Plasma Spectroscopy

    Science.gov (United States)

    Osterheld, A. L.

    1998-08-01

    This book gives a comprehensive treatment of plasma spectroscopy, the quantitative study of line and continuous radiation from high temperature plasmas. This highly interdisciplinary field combines elements of atomic, plasma and statistical physics, and has wide application to simulations and diagnostics of laboratory and astrophysical plasmas. Plasma spectroscopy is naturally intertwined with magnetic and inertial fusion energy science. Radiative processes in plasmas are important in the design of fusion facilities, and can be used to diagnose and control conditions in fusion plasmas. In turn, fusion scientists and facilities have played a central role in developing plasma spectroscopy theory and applications. The book covers radiation from plasmas, spectral line broadening, atomic processes in plasmas and level kinetic models, radiative transfer and applications to spectroscopic plasma diagnostics. It is successful both as an introductory text and as a source book of theoretical and experimental research. The book presents a broad development of the theoretical foundations of these topics, and discusses the seminal papers and critical experiments. There is a strong emphasis on applications of plasma spectroscopy, primarily to plasma diagnostics and calculations of radiative cooling rates. Extensive references (current through the end of 1995) point readers to original material and detailed discussions of advanced topics. Of course, a single text cannot treat all aspects of plasma spectroscopy in depth. The strongest and most detailed section of the book is a long chapter on spectral line broadening. For me, the most significant omission is lack of a discussion of laser assisted transitions which can occur in plasmas produced by high intensity lasers. The book was intentionally written to be accessible to young researchers and graduate students. The level is roughly that of a graduate text. It assumes some familiarity with quantum mechanics and statistical

  10. 2010 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2011-10-01

    This Renewable Energy Data Book for 2010 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  11. 2012 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2013-10-01

    This Renewable Energy Data Book for 2012 provides facts and figures in a graphical format on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  12. 2013 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Esterly, S.

    2014-12-01

    This Renewable Energy Data Book for 2013 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  13. 2011 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2012-10-01

    This Renewable Energy Data Book for 2011 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  14. ATLAS Colouring Book

    CERN Multimedia

    Anthony, Katarina

    2016-01-01

    The ATLAS Experiment Colouring Book is a free-to-download educational book, ideal for kids aged 5-9. It aims to introduce children to the field of High-Energy Physics, as well as the work being carried out by the ATLAS Collaboration.

  15. The Book Club Exploded

    Science.gov (United States)

    Hoffert, Barbara

    2006-01-01

    One leader, 12 readers, and a few well-thumbed copies of Jane Austen's "Pride and Prejudice." That is all a book club once required, but this is no longer the case. This article describes how the runaway popularity of book clubs has brought with it a whole new set of possibilities. Thematic discussion? A fiction/nonfiction mix? Videoconferencing?…

  16. Books in the Family.

    Science.gov (United States)

    Swinger, Alice K.

    1989-01-01

    Opportunities for parents to encourage reading in the family are noted and ways to enhance the reading experience are discussed, including writing letters to book characters, singing combined with reading aloud, supplementing school subjects with enjoyable reading, sharing books at family gatherings, and using family experiences for book…

  17. Strawberry Square. Song Book.

    Science.gov (United States)

    Larson, Tom

    Designed to accompany a series of 33 television programs in music education for kindergarten and first grade children, this song book (containing sheet music) correlates with activities in the teacher's guide. Titles of songs included in the book are: Let a Song Tell a Story (short and long versions); If I Had a Hammer; A Happy Street; Let the…

  18. Books in Our Future.

    Science.gov (United States)

    Boorstin, Daniel J.

    This study explores the changing role of the book in the future. The report draws on interviews with authors, publishers, booksellers, computer experts, librarians, scientists, educators, and scholars and on the experience of the Library of Congress staff. The first part, "The Culture of the Book: Today and Tomorrow," includes sections…

  19. Data communications pocket book

    CERN Document Server

    Tooley, Michael

    2014-01-01

    Data Communications Pocket Book, Second Edition presents information relevant to data communication. The book provides tabulated reference materials with a brief description and diagrams. The coverage of the text includes abbreviations, terminal control codes, and conversion tables. The text will be of great use to individuals involved in the interconnection of computer systems.

  20. English Book Club

    CERN Multimedia

    English Book Club

    The minutes of the AGM held on Tuesday November 17th can now be found on the club web-site: http://club-englishbookclub.web.cern.ch. A new version of the club’s book data-base is also available on the web: http://club-englishbookclub.web.cern.ch/club-englishbookclub/Export/index.html The last book selection for 2009 is done and the order for the new books has been placed, with luck they will be on the shelves before the end of year break. The English Book Club has a growing collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  1. Death, Children, and Books.

    Science.gov (United States)

    Carr, Robin L.

    The books listed in this annotated bibliography are intended to help children understand the reality of death and deal with the mystery and emotions that accompany it. Each entry indicates the genre and reading level of the book and provides a brief description of the attitude toward death that it conveys. The selections include fables, fantasy,…

  2. More than Comic Books

    Science.gov (United States)

    Boerman-Cornell, Bill

    2013-01-01

    Graphic novels (book-length fiction or nonfiction narratives told using the conventions of a comic book) bring together text and image in a way that seems to capture students' imaginations. Right now, there is little more than anecdotal research about how graphic novels can be used within specific middle school and high school disciplines. As…

  3. The Obama Books Boom

    Science.gov (United States)

    Roach, Ronald

    2009-01-01

    As Barack Obama's rise to power inspires a flood of books, scholars hope the publishing trend will yield serious analysis. Barack Obama's rise from Illinois politics to the U.S. presidency has inspired authors to produce a flood of books chronicling the 44th commander in chief's life story and political career. Obama's political odyssey invites…

  4. Astronomy books in Spanish

    Science.gov (United States)

    Fierro, Julieta

    Great cultures have created language. They have discovered its strength among other reasons for education. For a long time the Bible was one of the few books available in western culture, its influence is beyond any doubt. Many developing nations have no science books in their mother tongue. They might carry a few translations but these do not convey the local culture so it is harder for students to grasp the concepts and to build on what they know. Books, even if they are extremely simple, should be written in local languages because that will facilitate the conveying of knowledge and the creation of scientific culture. In the books examples that pertain to every day local life must be given, in particular examples that have to do with women. Women play a central role in developing nations by child bearing; if they become literate they will influence enormously the quality of their children's education, in particular their science comprehension. In Mexico a collection that includes astronomy books has recently been edited by the National Council for Culture and Arts. The books are small and light, which encourages middle-school students to carry them around and read them while traveling in public transportation, such as the subway. Every other page is a new subject, that carries illustrations, abstracts and conclusions. The astronomy books are on search for extraterrestrial life, the stars and the universe. These books are distributed nation-wide and are inexpensive. They have been written by Mexican astronomers.

  5. China Connections Reference Book.

    Science.gov (United States)

    Kalat, Marie B.; Hoermann, Elizabeth F.

    This reference book focuses on six aspects of the geography of the People's Republic of China. They are: territory, governing units, population and land use, waterways, land forms, and climates. Designed as a primary reference, the book explains how the Chinese people and their lifestyles are affected by China's geography. Special components…

  6. Problem Book in Quantum Field Theory

    CERN Document Server

    Radovanovič, Voja

    2008-01-01

    The Problem Book in Quantum Field Theory contains about 200 problems with solutions or hints that help students to improve their understanding and develop skills necessary for pursuing the subject. It deals with the Klein-Gordon and Dirac equations, classical field theory, canonical quantization of scalar, Dirac and electromagnetic fields, the processes in the lowest order of perturbation theory, renormalization and regularization. The solutions are presented in a systematic and complete manner. The material covered and the level of exposition make the book appropriate for graduate and undergraduate students in physics, as well as for teachers and researchers. The new edition is a corrected paperback edition for students.

  7. Talking about Books: Karen Hesse.

    Science.gov (United States)

    Beck, Cathy; Gwyn, Linda; Koblitz, Dick; O'Connor, Anne; Pierce, Kathryn Mitchell; Wolf, Susan

    1999-01-01

    Presents an interview with Karen Hesse, author of 12 books of fiction for young, middle, and older readers, and winner of the 1998 Newbery Award. Offers an overview of Hesse's books, organized into picture books, transition chapter books, and novels. Presents a discussion of the themes found in her books, highlighting children's discussion…

  8. Land Cover - Minnesota Land Cover Classification System

    Data.gov (United States)

    Minnesota Department of Natural Resources — Land cover data set based on the Minnesota Land Cover Classification System (MLCCS) coding scheme. This data was produced using a combination of aerial photograph...

  9. Closing the Book

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ When Bertelsmann Direct Group,the music and book direct-marketing arm of German media conglomerate Bertelsmann AG,launched its business in China in 1995,it seemed like a winning idea.The company's book clubs,a catalog mail-order operation offering cut-price books in return for a monthly membership fee,had proven a hugely lucrative business in Europe;and China,with its huge,highly literate population,seemed an ideal market for expansion.

  10. Book Presentation | 27 February

    CERN Multimedia

    The CERN Library

    2013-01-01

    "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo" by Luciano Maiani and Romeo Bassoli, published by Mondadori. On Wednesday 27 February Luciano Maiani will present the book "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo". More information here. The presentation will take place in the Council Chamber at 16.00 and will be followed by a debate and book signing. The book will be on sale. You are cordially invited.

  11. Book review: Rogue waves in the ocean

    Science.gov (United States)

    Geist, Eric L.

    2011-01-01

    Rogue Waves in the Ocean (2009) is a follow-on text to Extreme Ocean Waves (2008) edited by Pelinovsky and Kharif, both published by Springer. Unlike the earlier text, which is a compilation of papers on a variety of extreme waves that was the subject of a scientific conference in 2007, Rogues Waves in the Ocean is written, rather than edited, by Kharif, Pelinovsky, and Slunyaev and is focused on rogue waves in particular. The book consists of six chapters covering 216 pages. As the subject matter of each chapter is distinct, references appear at the end of each chapter rather than at the end of the book. The preface shows how each of the chapters relates to the larger study of rogue waves. The result is a book with a nice mix of eyewitness observations, physical theory, and statistics.

  12. Adapting to e-books

    CERN Document Server

    Miller, William

    2013-01-01

    Electronic books are now having a major impact on library collections. This book provides models for acquisitions policies and reports on several surveys of faculty and librarian attitudes toward e-books. It discusses issues in acquiring cataloguing and collection development regarding this important new library resource.Its subject matter deals with the different types of e-books, statistical data available for e-book usage, the development of e-book collections, learning environments, integrating e-books into local catalogues, acquisitions and usage monitoring of e-books.Thi

  13. Smart Book Charts

    Science.gov (United States)

    Chinnapongse, Ronald L.

    2015-01-01

    Smart book charts for TPSM: Heatshield for Extreme Entry Environment Technology (HEEET), Conformal Ablative TPS (CA-TPS), 3D Woven Multifunctional Ablative TPS (3D MAT), and Adaptable, Deployable, Entry and Placement Technology (ADEPT).

  14. Recensione / Recension / Book review

    Directory of Open Access Journals (Sweden)

    Bravo Fabio

    2010-03-01

    Full Text Available Book review of:Sette R., Cases on Technologies for Teaching Criminology and Victimology: Methodologies and practices, IGI Global – Information Science Reference, Hershey PA, 2010

  15. The book house

    DEFF Research Database (Denmark)

    Jensen, Niels Henrik; Agger, Steen

    1989-01-01

    The BOOK HOUSE (and its predecessor, the BOOK AUTOMAT) are computer systems aimed at supporting library users in finding fiction. They are examples of systems using a cognitive work analysis as the basis for design and evaluation - and build on studies of the information retrieval task using actual...... user-librarian negotiations. These studies led to the identification of a set of strategies for searching and retrieving literature as well as a mutri-kimensional framework for classifying fiction. Both of these have been necessary prerequisites for the design of the BOOK HOUSE, a flexible on-line data...... base retrieval system for novice users - both adults and children. The use of icons within a spatial metaphor to facilitate direct manipulation of the displayed objects on the screen forms the basis for the interface in guiding the users' navigation in the BOOK HOUSE. This report, one of three...

  16. New Fashioned Book Burning.

    Science.gov (United States)

    Gardner, Robert

    1997-01-01

    Reports on results of a teacher's experiment in book burning as a lesson accompanying the teaching of Ray Bradbury's "Fahrenheit 451." Discusses student reactions and the purpose of or justification for the experimental lesson. (TB)

  17. Climate Record Books

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Climate Record Books contain daily, monthly, seasonal, and annual averages, extremes, or occurrences. Most data are sequential by period of record 1871-1910,...

  18. Book Reviews 2015

    Directory of Open Access Journals (Sweden)

    Hilling Axel

    2015-12-01

    Full Text Available This section contains three book reviews. First the book Swedish Taxation, Development since 1862 is reviewed. This volume comprises six studies that examine the development of Swedish taxation from 1862 to 2013, and will likely be of great value in future Nordic tax research because of its comprehensiveness. The second review is about a book written in Swedish:Momsfri sjukvård (The VAT exemption for health care. This volume discusses a topical issue and presents convincing recommendations for changes in the Swedish VAT legislation. Finally, the Danish book International Skatteret, i et dansk perspektiv (International Tax Law, in a Danish perspective is presented as highly recommended literature for students and practitioners in the field of international tax law. This volume discusses and illustrates general matters in international tax law, as well as specific matters relevant for Danish international tax law.

  19. Books 'n' stuff

    DEFF Research Database (Denmark)

    Christoffersen, Ellen

    2007-01-01

    The book "Kommunikations-Controlling" by Manfred Piwinger/Viktor Porák (eds.) is an interim report in which several authors analyse the state of the art in the discussion of communications controlling.......The book "Kommunikations-Controlling" by Manfred Piwinger/Viktor Porák (eds.) is an interim report in which several authors analyse the state of the art in the discussion of communications controlling....

  20. New Economics Books

    OpenAIRE

    Economics Library, Journal of

    2016-01-01

    A wide ranged Editor Selection of economic books published within the last 3 months by the publishers (for now; Cambridge University Press, Edward Elgar, Elsevier, MIT Press, Palgrave MacMillan, Springer, Wiley, and World Scientific) which are reached out “the consensus of no copyright infringement exists” could be found under this title. Afterwards, JEL will continue to publish the economic books published within the last 3 months as listing them in its quarter edition. This is expected to e...

  1. Book Review: Stop, Write!

    Directory of Open Access Journals (Sweden)

    Hans Thulesius

    2013-06-01

    Full Text Available This book on writing grounded theory is intended for the empirical GT researcher who wants to pursue his/her research until publication. It is the first book devoted entirely to such a crucial issue as writing grounded theory. Thus, Stop, Write: Writing Grounded Theory, is a practical book that fills a gap in GT methodology. In the first chapter of the book, Dr. Glaser says, “Stop unending conceptualization, unending data coverage, and unending listening to others who would egg you on with additional data, ideas and/or requirements or simply wait too long”. The book teaches the reader how to actually write a grounded theory by “simply” writing up the sorted memos. This requires efficient sorting that is dealt with in chapter two on Sorting Memos, which includes precious repetition from Theoretical Sensitivity (1978. How writing can be done effectively is outlined in chapter three The Working Paper. Then follows chapter four on how to rework the first draft with the different tasks of editing for language and professionalism. Thereafter Dr. Glaser discusses Writing Problems in chapter five where he gives useful guidance on how to overcome writing blocks and problems with supervisors and dissertation committees. The book also deals with publishing and with collaboration as experienced between Barney Glaser and the cofounder of grounded theory, Anselm Strauss.

  2. Book Review: The Institutional Repository

    Directory of Open Access Journals (Sweden)

    Isabel Galina

    2007-03-01

    Full Text Available At a time when the future nature of scholarly communication and publishing are being debated this book serves as a useful reference guide for one of the key aspects- the institutional repository. Institutional repositories are a popular recent development for distributing and communicating research. They are a useful academic tool for administrating and publishing electronic resources produced by university members in order to increase access to these, both at an institutional and global level. However, there is still no general concensus about the characteristics of an institutional repository. What types of material are deposited? Who is responsible for building and maintaing a repository, how will copyright be managed, who will cover installation and maintenance costs? How will quality, integrity and preservation of the materials be assured?

  3. Biomass Energy Data Book: Edition 2

    Energy Technology Data Exchange (ETDEWEB)

    Wright, Lynn L [ORNL; Boundy, Robert Gary [ORNL; Badger, Philip C [ORNL; Perlack, Robert D [ORNL; Davis, Stacy Cagle [ORNL

    2009-12-01

    The Biomass Energy Data Book is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Biomass Program in the Energy Efficiency and Renewable Energy (EERE) program of the Department of Energy (DOE). Designed for use as a convenient reference, the book represents an assembly and display of statistics and information that characterize the biomass industry, from the production of biomass feedstocks to their end use, including discussions on sustainability. This is the second edition of the Biomass Energy Data Book which is only available online in electronic format. There are five main sections to this book. The first section is an introduction which provides an overview of biomass resources and consumption. Following the introduction to biomass, is a section on biofuels which covers ethanol, biodiesel and bio-oil. The biopower section focuses on the use of biomass for electrical power generation and heating. The fourth section is on the developing area of biorefineries, and the fifth section covers feedstocks that are produced and used in the biomass industry. The sources used represent the latest available data. There are also four appendices which include frequently needed conversion factors, a table of selected biomass feedstock characteristics, assumptions for selected tables and figures, and discussions on sustainability. A glossary of terms and a list of acronyms are also included for the reader's convenience.

  4. Biomass Energy Data Book: Edition 4

    Energy Technology Data Exchange (ETDEWEB)

    Boundy, Robert Gary [ORNL; Diegel, Susan W [ORNL; Wright, Lynn L [ORNL; Davis, Stacy Cagle [ORNL

    2011-12-01

    The Biomass Energy Data Book is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Biomass Program in the Energy Efficiency and Renewable Energy (EERE) program of the Department of Energy (DOE). Designed for use as a convenient reference, the book represents an assembly and display of statistics and information that characterize the biomass industry, from the production of biomass feedstocks to their end use, including discussions on sustainability. This is the fourth edition of the Biomass Energy Data Book which is only available online in electronic format. There are five main sections to this book. The first section is an introduction which provides an overview of biomass resources and consumption. Following the introduction to biomass, is a section on biofuels which covers ethanol, biodiesel and bio-oil. The biopower section focuses on the use of biomass for electrical power generation and heating. The fourth section is on the developing area of biorefineries, and the fifth section covers feedstocks that are produced and used in the biomass industry. The sources used represent the latest available data. There are also two appendices which include frequently needed conversion factors, a table of selected biomass feedstock characteristics, and discussions on sustainability. A glossary of terms and a list of acronyms are also included for the reader's convenience.

  5. Biomass Energy Data Book: Edition 1

    Energy Technology Data Exchange (ETDEWEB)

    Wright, Lynn L [ORNL; Boundy, Robert Gary [ORNL; Perlack, Robert D [ORNL; Davis, Stacy Cagle [ORNL; Saulsbury, Bo [ORNL

    2006-09-01

    The Biomass Energy Data Book is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of the Biomass Program and the Office of Planning, Budget and Analysis in the Department of Energy's Energy Efficiency and Renewable Energy (EERE) program. Designed for use as a desk-top reference, the book represents an assembly and display of statistics and information that characterize the biomass industry, from the production of biomass feedstocks to their end use. This is the first edition of the Biomass Energy Data Book and is currently only available online in electronic format. There are five main sections to this book. The first section is an introduction which provides an overview of biomass resources and consumption. Following the introduction to biomass is a section on biofuels which covers ethanol, biodiesel and BioOil. The biopower section focuses on the use of biomass for electrical power generation and heating. The fourth section is about the developing area of biorefineries, and the fifth section covers feedstocks that are produced and used in the biomass industry. The sources used represent the latest available data. There are also three appendices which include measures of conversions, biomass characteristics and assumptions for selected tables and figures. A glossary of terms and a list of acronyms are also included for the reader's convenience.

  6. Biomass Energy Data Book: Edition 3

    Energy Technology Data Exchange (ETDEWEB)

    Boundy, Robert Gary [ORNL; Davis, Stacy Cagle [ORNL

    2010-12-01

    The Biomass Energy Data Book is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Biomass Program in the Energy Efficiency and Renewable Energy (EERE) program of the Department of Energy (DOE). Designed for use as a convenient reference, the book represents an assembly and display of statistics and information that characterize the biomass industry, from the production of biomass feedstocks to their end use, including discussions on sustainability. This is the third edition of the Biomass Energy Data Book which is only available online in electronic format. There are five main sections to this book. The first section is an introduction which provides an overview of biomass resources and consumption. Following the introduction to biomass, is a section on biofuels which covers ethanol, biodiesel and bio-oil. The biopower section focuses on the use of biomass for electrical power generation and heating. The fourth section is on the developing area of biorefineries, and the fifth section covers feedstocks that are produced and used in the biomass industry. The sources used represent the latest available data. There are also four appendices which include frequently needed conversion factors, a table of selected biomass feedstock characteristics, and discussions on sustainability. A glossary of terms and a list of acronyms are also included for the reader's convenience.

  7. Seeing into Books: Lessons from Rare Book School

    Science.gov (United States)

    Hendrickson, Lois G.

    2012-01-01

    Recently, the author spent a week at Rare Book School (RBS) immersed in a course entitled "Teaching the History of the Book;" an investigation into different ways of thinking about, designing, and conducting a course on the history of the book. The goal was to learn how to convert teaching and outreach experiences in rare book collections from a…

  8. BOOK REVIEW: The Current Comparator

    Science.gov (United States)

    Petersons, Oskars

    1989-01-01

    This 120-page book is a concise, yet comprehensive, clearly-written and well-illustrated monograph that covers the subject matter from basic principles through design, construction and calibration details to the principal applications. The book will be useful, as a primer, to the uninitiated and, as a reference book to the practitioner involved with transformer-type ratio devices. The length of the book and the style of presentation will not overburden any informed reader. The described techniques and the cited references are primarily from the work at the National Research Council, Canada (NRC). Any omissions, however, are not serious with respect to coverage of the subject matter, since most of the development work has been done at NRC. The role of transformers and transformer-like devices for establishing accurate voltage and current ratios has been recognized for over half a century. Transformer techniques were much explored and developed in the fifties and sixties for accuracy levels suitable for standards laboratories. Three-winding voltage transformers were developed for scaling of impedances in connection with the calculable Thompson Lampard capacitor; three-winding current transformers or current comparators were initially explored for the calibration of current transformers and later for specialized impedance measurements. Extensive development of the current comparator and its applications has been and is still being conducted at the NRC by a team that was started and, until his retirement, led by N L Kusters. The team is now led by W J M Moore. He and P N Miljanic, the authors of this book, have had the principal roles in the development of the current comparator. It is fortunate for the field of metrology that considerabe resources and a talented group of researchers were available to do this development along with mechanisms that were available to transfer this technology to a private sector instrument manufacturer and, thus, disseminate it world wide

  9. Higher GCSE mathematics for CCEA practice book

    CERN Document Server

    Connolly, Anne; Liggett, Robin

    2014-01-01

    Help students build their confidence with hundreds of practice questions covering everything on the course, guiding them towards their target grades . This practice book offers complete support for the Higher tier of the CCEA GCSE Mathematices specification. It has been written to cover all the units of the specification and to accompany the endorsed textbook. It has been written by an experienced teacher and examiner. - Enable students to practice and consolidate what they have learnt throughout the course with hundreds of questions. - Help develop students'skills and prepare them effectively

  10. Foundation GCSE mathematics for CCEA practice book

    CERN Document Server

    Liggett, Linda; Lambert, Elaine

    2013-01-01

    Help students build their confidence with hundreds of practice questions covering everything on the course, guiding them towards their target grades . This practice book offers complete support for the foundation tier of the CCEA GCSE Mathematices specification. It has been written to cover all the units of the specification and to accompany the endorsed textbook. It has been written by experienced teachers and examiners. - Enable students to practice and consolidate what they have learnt throughout the course with hundreds of questions. - Help develop students'skills and prepare them effectiv

  11. Book review: Safety of Biologics Therapy

    Directory of Open Access Journals (Sweden)

    Robak T

    2017-01-01

    Full Text Available Tadeusz Robak Department of Hematology, Medical University of Lodz and Copernicus Memorial Hospital, Lodz, PolandSafety of Biologics Therapy: Monoclonal Antibodies, Cytokines, Fusion Proteins, Hormones, Enzymes, Coagulation Proteins, Vaccines, Botulinum Toxins (Cham, Switzerland: Springer International Publishing; 2016 by Brian A Baldo from the Molecular Immunology Unit, Kolling Institute of Medical Research, Royal North Shore Hospital of Sydney, and the Department of Medicine, University of Sydney, Australia, is a book that belongs on the shelf of everyone in the field of biologic therapies research and clinical practice. In writing this book, the author’s intention was to produce an up-to-date text book on approved biologic therapies, as far as that is possible in this time of rapidly evolving developments in biotherapeutic research and the introduction of new and novel agents for clinical use.The monograph comprises 610 pages in 13 chapters, each including a summary and further reading suggestions. All chapters include a discussion of basic and clinical material. Well-designed, comprehensive tables and color figures are present throughout the book. The book itself examines the biologic products that have regulatory approval in the USA and/or European Union and that show every indication of remaining important therapies. It covers in great detail all the latest work on peptide hormones and enzymes, monoclonal antibodies, fusion proteins, and cytokine therapies. Beyond that, it also presents the latest information on blood coagulation proteins, vaccines, botulinum neurotoxins, and biosimilars. 

  12. BOOK REVIEW: NMR Imaging of Materials

    Science.gov (United States)

    Blümich, Bernhard

    2003-09-01

    Magnetic resonance imaging (MRI) of materials is a field of increasing importance. Applications extend from fundamental science like the characterization of fluid transport in porous rock, catalyst pellets and hemodialysers into various fields of engineering for process optimization and product quality control. While the results of MRI imaging are being appreciated by a growing community, the methods of imaging are far more diverse for materials applications than for medical imaging of human beings. Blümich has delivered the first book in this field. It was published in hardback three years ago and is now offered as a paperback for nearly half the price. The text provides an introduction to MRI imaging of materials covering solid-state NMR spectroscopy, imaging methods for liquid and solid samples, and unusual MRI in terms of specialized approaches to spatial resolution such as an MRI surface scanner. The book represents an excellent and thorough treatment which will help to grow research in materials MRI. Blümich developed the treatise over many years for his research students, graduates in chemistry, physics and engineering. But it may also be useful for medical students looking for a less formal discussion of solid-state NMR spectroscopy. The structure of this book is easy to perceive. The first three chapters cover an introduction, the fundamentals and methods of solid-state NMR spectroscopy. The book starts at the ground level where no previous knowledge about NMR is assumed. Chapter 4 discusses a wide variety of transformations beyond the Fourier transformation. In particular, the Hadamard transformation and the 'wavelet' transformation are missing from most related books. This chapter also includes a description of noise-correlation spectroscopy, which promises the imaging of large objects without the need for extremely powerful radio-frequency transmitters. Chapters 5 and 6 cover basic imaging methods. The following chapter about the use of relaxation and

  13. When Do Children Read Books?

    Science.gov (United States)

    van Ours, Jan C.

    2008-01-01

    This paper investigates the reading of fiction books by 15 year olds in 18 OECD countries. It appears that girls read fiction books more often than boys, whereas boys read comic books more often than girls. Parental education, family structure, and the number of books and televisions at home influence the intensity with which children read fiction…

  14. ENGLISH BOOK CLUB

    CERN Multimedia

    English Book Club

    2009-01-01

    http://club-englishbookclub.web.cern.ch A note to our members Dear Members, Many thanks to all of you who have paid up now. However, there are still some late payers and Morna would appreciate knowing if they will pay for 2009/2010 or if they have left the club. At the AGM on 17 November it was decided that a 3 month delay for key reimbursement will be given to all present and past members, BUT after 31.3.2010 no reimbursement will be given out. We are in the process of making changes to the access to the club for paid-up, active members only. Some of you have told Morna you will pay on your next visit to CERN, that is ok but please try to do this by 15 December if possible. A new version of the club’s book data-base is available on the web: http://club-englishbookclub.web.cern.ch/club-englishbookclub/Export/index.html The English Book Club has a growing collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books...

  15. Year book Australia 1986

    Energy Technology Data Exchange (ETDEWEB)

    Castles, I. (comp.)

    1986-01-01

    The Year Book is the principal reference work produced by the Central Office of the Australian Bureau of Statistics (ABS). It provides a comprehensive and detailed statistical review of all asepcts of the economy and social conditions of Australia. In addition, it contains descriptive matter dealing with Australia's history, geography, physiography, climate and meteorology, government, defence, international relations, culture and environment. The first Official Year Book was published early in 1908. This is the seventieth Year Book issued under the authority of the Commonwealth Government and follows a similar pattern to previous editions. However chapters have been revised and new material has been added. Most of the statistics contained in this volume relate to the years ended June or December 1984 to 1985. More detailed, and in most cases more recent, statistics are available in other ABS publications.

  16. Book reviews 2016

    Directory of Open Access Journals (Sweden)

    Hilling Axel

    2016-11-01

    Full Text Available This section contains reviews of two Swedish books on international taxation. First, the book Skatteavtal och generalklausuler, Ett komparativt perspektiv (Tax Agreements and General Anti-Avoidance Regulations, A Comparative Perspective is recommended for those who study and work with international tax law. The book analyses how tax treaties’ function to limit contracting states’ taxing powers relates to national GAARs. A comparative analysis is made between Sweden and Canada. In the second review, the doctoral dissertation EU-domstolens restirktionsprövning i mal om de grundläggande frihterna och direkta skatter (The EU Court of Justice’s examination of the restriction requirement in its direct tax case law is reviewed. The dissertation systemizes relevant CJEU’s case law and analyzes the Courts reasoning in deciding whether or not certain tax regulation is in conflict with EU fundamental freedoms.

  17. Interactive Sample Book (ISB)

    DEFF Research Database (Denmark)

    Heimdal, Elisabeth Jacobsen; Lenau, Torben Anker; Guglielmi, Michel

    2009-01-01

    involving designers and engineers. It is carried out by Elisabeth Heimdal as her Master thesis from Design & Innovation, The Technical University of Denmark. Collaboration partners are the design bureau Diffus, textile designer Priya Mani, master student in medialogy at AAU Marija Andonovska and DTU......, with the aim of exploring and communicating some of the possibilities within interactive textiles. The applications for interactive textiles range from medical applications to architecture, and from the fashion industry to costume design. In relation to the sample book, focus will be on texture, lightning...... and senses in relation to integrated decoration and function primarily to indoor applications. The result of the project will be a number of interactive textiles, to be gathered in an interactive sample book (ISB), in a similar way as the sample books of wallpapers one can take home from the shop and choose...

  18. Check Out These Books

    Science.gov (United States)

    Collins, Michelle (Editor); Mulenburg, Gerald

    2002-01-01

    The book entitled "Fusion Leadership: Unlocking the Subtle Forces that Change People and Organizations Richard L. Daft and Robert H. Lengel (1998) Berett-Koehler Publishers, Inc." was Reviewed by Dr. Michelle Collins, NASA Headquarters. If you've already read books on leadership and organizational change by authors such as Moshe Rubinstein and Iris Firstenberg, Peter Senge, Tom Peters, and Steven Covey, and you were thinking of rereading them, you don't have to do that now. Just read this book instead. It's a fusion of many of their same concepts presented from a different view. The book does not explore any particular subject in depth. Rather the authors "skim" many subjects and concepts, interlacing them to develop the concept of "Fusion Leadership". The fundamental concept of treating people as people rather than machines is the main theme. "Fusion Leadership" is the process of fusing people together by nurturing six "subtle" forces: mindfulness, courage, vision, heart, communication, and integrity. To do so, hierarchy is diminished and responsibility both for oneself as well as for the team is emphasized. There are a number of organizations and managers that will find such a change threatening. The concepts behind such a management style are straightforward and the benefits are intuitive once you've reflected on them; however, the obvious benefits of the behavioral change proposed in Fusion Leadership can be completely lost in a fear-based system. The concept of caring about people in one's organization was the common thread in Chris Turner's book All Hat, No Cattle (see book review, ASK 5). Much is being written about the re-humanizing of the workplace, but the basis of it is so common sense that one wonders what's taking so long for the workplace to change? Whether you're in a position to change your organization or simply your project team, you'll find the concepts in fusion leadership equally applicable.

  19. Newnes microprocessor pocket book

    CERN Document Server

    Money, Steve

    2014-01-01

    Newnes Microprocessor Pocket Book explains the basic hardware operation of a microprocessor and describes the actions of the various types of instruction that can be executed. A summary of the characteristics of many of the popular microprocessors is presented. Apart from the popular 8- and 16-bit microprocessors, some details are also given of the popular single chip microcomputers and of the reduced instruction set computer (RISC) type processors such as the Transputer, Novix FORTH processor, and Acorn ARM processor.Comprised of 15 chapters, this book discusses the principles involved in bot

  20. Chemistry WebBook

    Science.gov (United States)

    SRD 69 NIST Chemistry WebBook (Web, free access)   The NIST Chemistry WebBook contains: Thermochemical data for over 7000 organic and small inorganic compounds; thermochemistry data for over 8000 reactions; IR spectra for over 16,000 compounds; mass spectra for over 33,000 compounds; UV/Vis spectra for over 1600 compounds; electronic and vibrational spectra for over 5000 compounds; constants of diatomic molecules(spectroscopic data) for over 600 compounds; ion energetics data for over 16,000 compounds; thermophysical property data for 74 fluids.

  1. CMS Comic Book

    CERN Multimedia

    Gill, Karl Aaron

    2006-01-01

    Titled "CMS Particle Hunter," this colorful comic book style brochure explains to young budding scientists and science enthusiasts in colorful animation how the CMS detector was made, its main parts, and what scientists hope to find using this complex tool. Book invites young students to get involved in particle physics themselves to join the adventure. Written by Dave Barney and Aline Guevera. Layout and drawings by Eric Paiharey and Frederic Vignaux. Available in English, French, German, Italian, Spanish and Portuguese. Year Produced: 2006. Update: September 2013.

  2. The MCAT Physics Book

    CERN Document Server

    Biehle, Garrett

    2012-01-01

    Comprehensive, Rigorous Prep for MCAT Physics. The MCAT Physics Book offers the most comprehensive and rigorous analysis of MCAT physics available. Including,. Features:. * 500 MCAT-style practice problems and detailed solutions to all problems. * 49 MCAT-style passages. Illustrations and tables are included wherever necessary to focus and clarify key ideas and concepts. Dr. Biehle's classic MCAT Physics Book presents a clear, insightful analysis of MCAT physics. His lively prose and subtle wit make this challenging topic more palatable. Dr. Biehle received his Ph.D. from Caltech (California I

  3. Web designer's idea book

    CERN Document Server

    McNeil, Patrick

    2014-01-01

    Discover the latest trends in web design! Looking for inspiration for your latest web design project? Expert Patrick McNeil, author of the popular Web Designer's Idea Book series, is back with all new examples of today's best website design. Featuring more than 650 examples of the latest trends, this fourth volume of The Web Designer's Idea Book is overflowing with visual inspiration. Arranged categorically, this fully illustrated guide puts important topics like design styles, elements, themes and responsive design at your fingertips. This new volume also includes a detailed discussion o

  4. Book Review of : The Theory of Corporate Finance

    OpenAIRE

    Georges Dionne

    2011-01-01

    The book proposes an original contribution to the economics and finance literature by developing the foundations of corporate finance. It also covers in detail various corporate governance issues faced by organizations. The common treatment of corporate finance and corporate governance started with the contribution of Williamson (Journal of Finance, 1988), who argued that corporate finance and corporate governance must be treated simultaneously because they are complementary. This book fills ...

  5. Using Book Data Providers to Improve Services to Patrons

    Directory of Open Access Journals (Sweden)

    Mike Beccaria

    2009-03-01

    Full Text Available At Paul Smith's College, I recently implemented a "New Books" display using open APIs and an image scroller. In this article I'll give a brief overview of Google Book Search, OpenLibrary and Worldcat, explain how I created this New Books Widget using book cover data, and provide readers with some practical and simple code to show how to collect this data. This article will be of interest to anyone who wants to read about a brief overview of current state of free book data service providers. Additionally, beginner programmers will likely find the examples at the end of the article helpful when getting started with projects of their own.

  6. Thomson Reuters to release Book Citation Index later this year

    Science.gov (United States)

    Aldred, Maxine

    2011-08-01

    Thomson Reuters will launch its new Book Citation Index later this year. Projected to include 25,000 volumes from major publishers and university presses in science, social science, and the humanities, the Book Citation Index will cover scholarly books (both series and nonseries) that present original research or literature reviews. The current effort regarding the science section is focused on books published from 2005 to the present. AGU has sent copies of its catalog for inclusion in the Book Citation Index, but the final selection will be made by Thomson Reuters, using its internal selection criteria, which may be found at http://wokinfo.com/wok/media/pdf/BKCI-SelectionEssay_web.pdf.

  7. Books for Summer Reading.

    Science.gov (United States)

    Phi Delta Kappan, 1995

    1995-01-01

    Recommends many books for summer reading enjoyment, concentrating on historical and contemporary fiction. Different cultures clash in William T. Vollman's "Fathers and Crows" and John Demos's adventuresome "Unredeemed Captive." Other suggestions: "Snow Falling on Cedar Mountain" (David Gutterman) and "Foxfire" (Joyce Carol Oates). For professional…

  8. On Japanese Children's Books.

    Science.gov (United States)

    Watanare, Shigeo

    This report, given at a special meeting held in Tehran, presents data and facts concerning yearly publications (books, magazines, and textbooks), translations, and illustrations of Japanese children's literature. The report then discusses at length recent trends in children's literature and library activities for children in the past, present, and…

  9. Bonus Activity Book.

    Science.gov (United States)

    Learning, 1993

    1993-01-01

    Elementary level activity book presents suggestions for teaching students about endangered and threatened species worldwide. Students learn about what is causing the rapid extinction rate and what needs to be done. They also discover the value of rainforests and why conservationists are fighting to save them. (SM)

  10. Books, Biodiversity, and Beyond!

    Science.gov (United States)

    Governor, Donna; Helms, Sarah

    2007-01-01

    Reading in science class does not have to be boring, but it is no secret to students or teachers that textbooks are not much fun to read. It is always a challenge for teachers to find reading materials that would grab the interests of their students. In this article, the author relates how she used Biodiversity, a nonfiction book by Dorothy…

  11. China resource book

    NARCIS (Netherlands)

    Trouwborst, K.O.; Eijndthoven, van P.J.

    1999-01-01

    The China Resource Book explains the organisation of the agricultural production in China and relates it to China's efforts to eradicate poverty and achieve self-sufficiency in food. It also highlights the variety of environmental problems, which haverisen since the rapid industrial development in t

  12. Vietnam in Childrens' Books.

    Science.gov (United States)

    United Nations Children's Fund, New York, NY. United States Committee.

    Twenty-five nonfiction and 18 fiction and folklore listings are included in this bulletin on Vietnam in childrens' books. Slides, filmstrips, and film listings are also included. Each listing is accompanied by a brief annotation. Subjects include customs and culture, the country and the people, Ho Chi Min, the Vietnamese revolution, Vietnamese…

  13. Basic Drafting: Book Two.

    Science.gov (United States)

    Davis, Ronald; And Others

    The second of a two-book course in drafting, this manual consists of 12 topics in the following units: sketching techniques, geometric constructions, orthographic views, dimensioning procedures, basic tolerancing, auxiliary views, sectional views, inking tools and techniques, axonometrics, oblique, perspective, and computer-aided drafting.…

  14. Medical Physics Data Book,

    Science.gov (United States)

    The Medical Physics Data Book is a collection of physical and chemical data useful in medical physics . The information has been extracted from other...ionizing Radiation. Carried out by the Medical Physics Data Group of the American Association of Physicists in Medicine, this compilation is meant to

  15. Bridging Inequity With Books.

    Science.gov (United States)

    Krashen, Stephen

    1998-01-01

    Providing rich supply of high-interest story books is more feasible policy for literacy education than urgent exhortations to improve teacher quality. Free reading profoundly improves students' reading and writing ability, spelling, grammar, and vocabulary. The quality of a country s or state's school libraries significantly predicts its reading…

  16. Book on CPC Published

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    A book that answers 13 questions about how the Communist Party of China(CPC) works in China and why the Party has made great achievements in the past decades has been recently published by the Beijing-based New World Press.

  17. CMS Comic Book Brochure

    CERN Document Server

    2006-01-01

    To raise students' awareness of what the CMS detector is, how it was constructed and what it hopes to find. Titled "CMS Particle Hunter," this colorful comic book style brochure explains to young budding scientists and science enthusiasts in colorful animation how the CMS detector was made, its main parts, and what scientists hope to find using this complex tool.

  18. The Comic Book Project

    Science.gov (United States)

    Bitz, Michael

    2008-01-01

    The Comic Book Project (CBP) celebrates its eighth anniversary this year. The project, which just originated with one school in New York City, had grown to encompass thousands of students nationwide. The goal of the CBP is not to create comics the "Marvel way" or to develop the next Stan Lee. Rather, the goal is to give students the opportunity to…

  19. Administration Trip Books

    Science.gov (United States)

    2007-11-02

    Plan. (h) Army Community of Excellence. (i) Child development services. k. The Assistant Secretary of the Army for Manpower and Reserve Affairs ( ASAM ...RA) will — (1) Provide information as requested when the information falls under the purview of the ASAM &RA. (2) Provide recurring trip book

  20. Hurrah for Chapter Books.

    Science.gov (United States)

    Jones, Glenowyn L.

    This annotated bibliography contains a list of 42 recent Chapter Books. The bibliography is divided into the following topics: Adventure-Survival (3 titles); Autobiography-Biography (3 titles); Death (1 title); Easy Readers (8 titles); Good Reading (12 titles); Historical Fiction (10 titles); Mystery (3 titles); Newbery Award Winner, 2000; and…

  1. The enemies of books

    CERN Document Server

    Blades, William

    2012-01-01

    A fascinating look at the myriad enemies of the printed book, from fire, to neglect, to children, to the bookworm, to plain old ignorance. A passionate litany against all who would see printed literature destroyed, written by English printer and bibliographer William Blades.

  2. Spoken Russian; Book Two.

    Science.gov (United States)

    Bloomfield, Leonard; Petrova, Luba

    This course in spoken Russian is intended for use in introductory conversational classes. Book II in the two volume series is divided into three major parts, each containing five learning units and one unit devoted to review. Each unit contains sections including (1) basic sentences, (2) word study and review of basic sentences, (3) listening…

  3. Best Books 2010

    Science.gov (United States)

    Jones, Trevelyn; Toth, Luann; Charnizon, Marlene; Grabarek, Daryl; Fleishhacker, Joy

    2010-01-01

    This article presents the 62 books chosen by "School Library Journal's" editors as the best of the year. While novels include some historical settings and contemporary concerns, it is fantasy that continues to reign supreme. More original, and more creative than ever, it includes selections that are frightening, edgy, wildly funny, electrifying,…

  4. Book Catalog Use Study

    Science.gov (United States)

    Sacco, Concetta N.

    1973-01-01

    Technological developments of the past twenty years have resulted in renewed interest in book-form catalogs. Users were surveyed at two libraries to determine that their satisfaction with bibliographical data, entry points, and physical form. (17 references) (Author/DH)

  5. Bold Books for Teenagers

    Science.gov (United States)

    Gallo, Don

    2005-01-01

    "Bold Books for Teenagers" provides dynamic, informative viewpoints on important issues in publishing and teaching contemporary literature, especially literature for adolescents. Reviews of young adult literature also appear in this column. This article examines how English teachers can help students explore their interests without promoting any…

  6. OpenBook WordPress Plugin: Open Source Access to Bibliographic Data

    Directory of Open Access Journals (Sweden)

    John Miedema

    2008-09-01

    Full Text Available OpenBook is a WordPress PHP plugin that implements the Open Library APIs to insert book covers, titles, authors and publishers into web pages. The motive behind the development was to provide an easy alternative to the common practice of linking to Amazon. Open Library was selected as a data source because it is both open source and open data.The plugin is useful for book reviewers, library webmasters, anyone who wants to put book covers and data on their WordPress blog or website. The plugin also allows users to add links to publisher websites, a feature that was considered significant to independent publishers.

  7. The Burden of the Book

    DEFF Research Database (Denmark)

    Damkjær, Maria

    2012-01-01

    Review of Leah Price, How to Do Things with Books in Victorian Britain (Princeton University Press, 2012)......Review of Leah Price, How to Do Things with Books in Victorian Britain (Princeton University Press, 2012)...

  8. Exploring Cultural Diversity (Children's Books).

    Science.gov (United States)

    Galda, Lee; Cotter, Janet

    1992-01-01

    Reviews 57 children's books, combining realistic fiction, nonfiction, poetry, literary folklore, and folklore from people and places around the world, that reveal the cultural wonders of the world. Offers suggestions on how to group these books within thematic units. (MG)

  9. Moving from Books to Bytes.

    Science.gov (United States)

    Albanese, Andrew Richard

    2001-01-01

    This academic library book buying survey examines full-text databases; electronic journals; top circulating subjects; price increases for serials and resulting subscription cuts; the influence of digital choices on purchasing decisions; circulation versus use statistics; and electronic books. (LRW)

  10. TM4Book: Visualization transforms

    DEFF Research Database (Denmark)

    2011-01-01

    XSLT-scripts til visualisering af semantiske strukturer i teksteditoren TM4Book: plot, storyline og timeline......XSLT-scripts til visualisering af semantiske strukturer i teksteditoren TM4Book: plot, storyline og timeline...

  11. WormBook: the online review of Caenorhabditis elegans biology.

    Science.gov (United States)

    Girard, Lisa R; Fiedler, Tristan J; Harris, Todd W; Carvalho, Felicia; Antoshechkin, Igor; Han, Michael; Sternberg, Paul W; Stein, Lincoln D; Chalfie, Martin

    2007-01-01

    WormBook (www.wormbook.org) is an open-access, online collection of original, peer-reviewed chapters on the biology of Caenorhabditis elegans and related nematodes. Since WormBook was launched in June 2005 with 12 chapters, it has grown to over 100 chapters, covering nearly every aspect of C.elegans research, from Cell Biology and Neurobiology to Evolution and Ecology. WormBook also serves as the text companion to WormBase, the C.elegans model organism database. Objects such as genes, proteins and cells are linked to the relevant pages in WormBase, providing easily accessible background information. Additionally, WormBook chapters contain links to other relevant topics in WormBook, and the in-text citations are linked to their abstracts in PubMed and full-text references, if available. Since WormBook is online, its chapters are able to contain movies and complex images that would not be possible in a print version. WormBook is designed to keep up with the rapid pace of discovery in the field of C.elegans research and continues to grow. WormBook represents a generic publishing infrastructure that is easily adaptable to other research communities to facilitate the dissemination of knowledge in the field.

  12. Book Review: New Perspectives on Technical Editing

    Science.gov (United States)

    Murphy, A. J. (Ed.); Sterken, Christiaan

    2012-08-01

    skills, or do not have a very broad knowledge base. The language fluency of every contributor makes this book a pleasure to read, and this particular volume of Baywood's Technical Communications Series is very well edited. The subject index covers almost 8 two-column pages.

  13. Book Review: Mastering Windows Network Forensics and Investigation, 2/e

    Directory of Open Access Journals (Sweden)

    John C. Ebert

    2012-12-01

    Full Text Available Anson, S., Bunting, S., Johnson, R., & Pearson, S. (2012. Mastering Windows Network Forensics and Investigation, 2nd ed. Indianapolis: John Wiley & Sons. 674 pages, ISBN: 978-1-118-16382-5, $59.99 USA/$71.99 CAN.Reviewed by John C. Ebert, Metropolitan State University (eberjo@metrostate.eduThe book is available as a paperback and e-book. The e-book versions allow you to preview several chapters at any of a number of online vendors. The e-book prices vary from the same as the soft cover version ($59.99 to about $38.99. Some of the vendor's e-books retain the color illustrations found in the print version, but others produce them in grey scale, so you might want to look out for that. The book is divided into four parts (17 chapters plus two appendices.I am compelled to give the book illustrations a highly unfavorable assessment regarding their readability qualities. Their content is otherwise fine and meaningful. Time and again the illustrations are so miniscule that even those of us with the best of vision will be seriously challenged. I hold out the recommendation to review your e-book options over the hardcopy edition. At least in an e-book you have the hope of doing a page-zoom. Review your e-book providers carefully; some I reviewed had "fuzzy graphics." Notwithstanding the problem illustrations, I still recommend this book for its in-the-trenches information and the desktop reference it will become.(see PDF for full review

  14. Best in show [artists' book

    OpenAIRE

    Wood, Philippa

    2011-01-01

    This limited edition artists' book explores the phenomenon of prize vegetable growing. Each replica seed packet is over-printed with data that relates to a current world record holder. Further facts appear on the back to help put the statistics into context. The book was produced for a 'call for entries' to submit books that responded to the theme of 'crop'. Concertina book – machine stitched. Printed inkjet, letterpress, typewriter.

  15. Book Reviews Volume 3

    OpenAIRE

    2016-01-01

    Book Reviews Denis McQuail Media Performance: Mass Communication and the Public Interest, Reviewed by Farrel Corcoran. James Donald, Sentimental Education: Schooling, Popular Culture and the Regulation of Liberty London, Reviewed by Sheelagh Drudy Robert Chapman Selling The Sixties: The Pirates and Pop Music Radio, Reviewed by Pat Dunne Bob Franklin, ed. Televising Democracies with a foreword by Bernard Weatherhill , Reviewed by Brian Farrell Tim Congdon et al Paying for Broadc...

  16. The Delights of Books

    Institute of Scientific and Technical Information of China (English)

    徐保国

    2005-01-01

    Books are to mankind what memory is to the individual.They contain the history of our race,the discoveries we have made,the accumulated knowledge and experience of ages;they picture for us the marvels and beauties of nature,help us in our difficulties, comfort us in sorrow and in suffering,change hours of weariness into moments of delight,store our minds with ideas,

  17. Book History and Ideological Hierarchies

    Science.gov (United States)

    Dilevko, Juris; Dali, Keren

    2006-01-01

    The evolving field of Book History has had difficulty in integrating the experiences of immigrant culture. In explaining the origins of print culture in North America, Book History has a tendency to associate lowbrow with immigrants and their struggles to establish a foothold in a new land. Book History therefore symbolically defines immigrant…

  18. The Real E-books.

    Science.gov (United States)

    Ditlea, Steve

    2000-01-01

    Focuses on the "real" e-books. Discusses Stephen King's novella released exclusively for electronic publication, and discusses experiences of another author writing on a specialized subject. Presents a brief background of e-books. Examines the differences between Portable Document Format (PDF) technology and the new Open eBook (OEB) standard.…

  19. The Pricing of Economics Books.

    Science.gov (United States)

    Laband, David; Hudson, John

    2003-01-01

    Examines the pricing and other characteristics of books. Notes substantial increases in book prices between 2000 and 1985 data. Suggests a major factor is the increasing importance of foreign presses that sell books at higher prices. Indicates that discount on paperbacks appear to have been relatively stable in the two years studied. (JEH)

  20. [Young children and books].

    Science.gov (United States)

    Diatkine, R; Bonnafé, M; Roy, J; Camus, C; Brandao, C

    1986-01-01

    Children come into contact very early with the written language. The work of Emilia Ferreiro, a student of Piaget, has shown that from early on, well before they can read, they know that the written word has a meaning. Their successive hypotheses show an elaboration which does not occur by chance. Experience shows that babies have a specific interest for a book as an object. They recognize the value of the pictures, as much representations of their mental representations as are words, whereas these two capacities evolve in a complementary fashion. The capacity to be interested by a narrative introduces a new form of organization in the chain of representations, whether they refer to absent or imaginary objects. A good story has a special place among the narratives the child hears, which actually have the specific structures of the written language. The authors of this work report a number of examples of very young children who are put in contact with books. They see in this a new model for mental health work which can be set up by virtue of meetings outside the school rooms, the mental health services, and even of the libraries, by people of different professional skills, in order to loosen the vice of the children's daily routine, and to give the child time to dream with the books, and to draw the adults in to a salutary disorder.

  1. Pi a source book

    CERN Document Server

    Berggren, Lennart; Borwein, Peter

    2004-01-01

    This book documents the history of pi from the dawn of mathematical time to the present. One of the beauties of the literature on pi is that it allows for the inclusion of very modern, yet accessible, mathematics. The articles on pi collected herein include selections from the mathematical and computational literature over four millennia, a variety of historical studies on the cultural significance of the number, and an assortment of anecdotal, fanciful, and simply amusing pieces. For this new edition, the authors have updated the original material while adding new material of historical and cultural interest. There is a substantial exposition of the recent history of the computation of digits of pi, a discussion of the normality of the distribution of the digits, new translations of works by Viete and Huygen, as well as Kaplansky's never-before-published "Song of Pi." From the reviews of earlier editions: "Few mathematics books serve a wider potential readership than does a source book and this particular on...

  2. BOOK REVIEW: Experimental Stochatics (2nd edition)

    Science.gov (United States)

    Wiberg, P.

    2004-05-01

    Otto Moeschlin and his co-authors have written a book about simulation of stochastic systems. The book comes with a CD-ROM that contains the experiments discussed in the book, and the text from the book is repeated on the CD-ROM. According to the authors, the aim of the book is to give a quick introduction to stochastic simulation for `all persons interested in experimental stochastics'. To please this diverse audience, the authors offer a book that has four parts. Part 1, called `Artificial Randomness', is the longest of the four parts. It gives an overview of the generation, testing and basic usage of pseudo random numbers in simulation. Although algorithms for generating sequences of random numbers are fundamental to simulation, it is a slightly unusual choice to give it such weight in comparison to other algorithmic topics. The remaining three parts consist of simulation case studies. Part 2, `Stochastic Models', treats four problems---Buffon's needle, a queuing system, and two problems related to the kinetic theory of gases. Part 3 is called `Stochastic Processes' and discusses the simulation of discrete time Markov chains, birth--death processes, Brownian motion and diffusions. The last section of Part 3 is about simulation as a tool to understand the traffic flow in a system controlled by stoplights, an area of research for the authors. Part4 is called `Evaluation of Statistical Procedures'. This section contains examples where simulation is used to test the performance of statistical methods. It covers four examples: the Neymann--Pearson lemma, the Wald sequential test, Bayesian point estimation and Hartigan procedures. The CD-ROM contains an easy-to-install software package that runs under Microsoft Windows. The software contains the text and simulations from the book. What I found most enjoyable about this book is the number of topics covered in the case studies. The highly individual selection of applications, which may serve as a source of inspiration

  3. BOOK REVIEW: Solitons, Instantons, and Twistors Solitons, Instantons, and Twistors

    Science.gov (United States)

    Witt, Donald M.

    2011-04-01

    Solitons and instantons play important roles both in pure and applied mathematics as well as in theoretical physics where they are related to the topological structure of the vacuum. Twistors are a useful tool for solving nonlinear differential equations and are useful for the study of the antiself-dual Yang-Mills equations and the Einstein equations. Many books and more advanced monographs have been written on these topics. However, this new book by Maciej Dunajski is a complete first introduction to all of the topics in the title. Moreover, it covers them in a very unique way, through integrable systems. The approach taken in this book is that of mathematical physics à la field theory. The book starts by giving an introduction to integrable systems of ordinary and partial differential equations and proceeds from there. Gauge theories are not covered until chapter 6 which means the reader learning the material for the first time can build up confidence with simpler models of solitons and instantons before encountering them in gauge theories. The book also has an extremely clear introduction to twistor theory useful to both mathematicians and physicists. In particular, the twistor theory presentation may be of interest to string theorists wanting understand twistors. There are many useful connections to research into general relativity. Chapter 9 on gravitational instantons is great treatment useful to anyone doing research in classical or quantum gravity. There is also a nice discussion of Kaluza-Klein monopoles. The three appendices A-C cover the necessary background material of basic differential geometry, complex manifolds, and partial differential equations needed to fully understand the subject. The reader who has some level of expertise in any of the topics covered can jump right into that material without necessarily reading all of the earlier chapters because of the extremely clear writing style of the author. This makes the book an excellent reference on

  4. Indesign in easy steps covers versions CS3, CS4, and CS5

    CERN Document Server

    Shufflebotham, Robert

    2011-01-01

    If your aim is to get started with the basics; become a competent and confident user; and then to master InDesign - this book is for you. The book builds from the basics, such as the Working Environment, Building Pages, Text, character and Paragraph settings. Then, it continues to cover more and more of the extensive range of functionality InDesign has to offer. By following the book's logical structure you can develop the core skills needed to master the software. Areas covered include: Tables and Tabs; Table of Contents, Indexing and Books; Printing and Exporting; Transformations and Transpa

  5. Book selling and e-books in Sweden

    Directory of Open Access Journals (Sweden)

    Elena Maceviciute

    2015-07-01

    Full Text Available This paper addresses the issue of the understanding of the book-selling situation as Swedish booksellers see it. It pursues the answers to the following questions: 1. What are the perceptions of Swedish booksellers of the impact of e-books on their business? 2. What drivers are important for Swedish booksellers for adopting and developing e-book sales through their own sales channels? 3. What do they perceive as barriers to e-book selling through their own channels? The authors have employed the analysis of the secondary statistical data and a survey of Swedish booksellers to answer their questions. The results of the investigation have shown that the Swedish booksellers do not feel their bookshops, or business in general, are threatened by e-books. The opinions on e-books do not differ between the few selling e-books and others who do not offer this product. The reasons for selling e-books are well-functioning routines and personal interest in the product. The reasons for not selling the books are the lack of demand and technical resources as well as contractual agreements with e-book publishers or vendors. So, technical resources for e-book sales, routines, and contracts with publishers are the main premises for this activity. The biggest barriers to e-book sales are: a the price as one can see not only in the answers of the booksellers, but also in the drop of sales obviously related to the rise of prices during 2014; b lack of demand from customers who do not enquire about e-books in bookshops. This leads to the belief that e-books will be sold mostly online either directly from publishers and authors or through online booksellers. However, an equal number of booksellers believe that physical bookshops will be selling printed books and e-books in the future. The future of e-books seems to be quite secure and non-threatening to printed books from the point of view of booksellers. The growth of e-book sales is quite slow and the respondents

  6. Hands on with ASP.NET MVC covering MVC 6

    CERN Document Server

    Sahay, Rahul

    2014-01-01

    MVC (Model-View-Controller) is the popular Microsoft technology which enables you to build dynamic, data-driven, mobile websites, TDD site. Hands-On with ASP.NET MVC is not only written for those who are going to have affair with MVC for the 1st time, rather it is written in such a way that even experienced professional will love reading this book. This book covers all the tiny steps on using MVC at its best. With complete practical tutorials to illustrate the concepts, you will step by step build one End to End application which covers below mentioned techniques - Controllers, Views, Models,

  7. CERN Scientific Book Fair 2008

    CERN Multimedia

    DSU Unit

    2008-01-01

    The CERN Bookshop and CERN Library invite you to attend the 2008 CERN Book Fair 2008, a three-day scientific book festival offering you the opportunity to meet key publishers and electronic book suppliers and to browse and purchase books at significant discounts. Some ten companies will be participating and will bring with them a selection of titles in physics, technology, mathematics, engineering and popular science. There will also be a number of tie-in events intended to give you an insight into the writing and publishing process from authors within our own community. Come along and meet the authors, discuss your book ideas with the publishers’ representatives or simply browse the books on offer. The Fair will take place in Building 500 in the area near the Main Auditorium, and special presentations (as detailed below) will be held in rooms nearby or in the Library. Participating publishers and book traders include: Cambridge ...

  8. Landfill Top Covers

    DEFF Research Database (Denmark)

    Scheutz, Charlotte; Kjeldsen, Peter

    2011-01-01

    is landscaped in order to fit into the surrounding area/environment or meet specific plans for the final use of the landfill. To fulfill the above listed requirements landfill covers are often multicomponent systems which are placed directly on top of the waste. The top cover may be placed immediately after...... the landfill section has been filled or several years later depending on the settlement patterns. Significant differential settlements may disturb the functioning of the top cover. The specific design of the cover system depends on the type of waste landfilled (municipal, hazardous, or inert waste...... however, top covers may be the only environmental protection measure. In some landfill regulations (for instance the Subtitle D landfills receiving municipal solid waste in the USA) it is required to minimize infiltration into the waste layers. Therefore top covers containing liner components...

  9. Do Adolescents Prefer Electronic Books to Paper Books?

    Directory of Open Access Journals (Sweden)

    Margaret K. Merga

    2015-11-01

    Full Text Available While electronic books offer a range of benefits and may be supposed to be more appealing to young people than paper books, this assumption is often treated as fact by educational researchers. Understanding adolescents’ true current preferences is essential, as incorrect assumptions can lead to decisions which restrict adolescent access to their preferred book mode. The belief that adolescents prefer electronic books to paper books has already led to some school libraries being expunged of paper books. As adolescents show a higher level of aliteracy than younger children, and regular reading offers a broad range of benefits for young people, it is imperative that school’s decisions around providing access to books are responsive to adolescent students’ genuine preferences. This paper analyses the current and relevant academic research around adolescent preferences for book modes, finding that, at present, the contention that adolescents prefer electronic books is not supported by the available research. In addition, there are a number of issues identified that make analyzing the findings in this area problematic. Future studies in this area are needed before an adolescent preference for electronic books can be unequivocally substantiated.

  10. OCR Cambridge nationals in ICT student book

    CERN Document Server

    Stuart, Sonia; Cushing, Steve

    2012-01-01

    Written by experts and in partnership with OCR, the brand-new OCR Cambridge Nationals in ICT Student's Book provides invaluable guidance for your teaching of the OCR Cambridge Nationals in ICT Level 1/2 . This textbook covers the mandatory Units 1 and 2 in detail, offering your students the knowledge and practice they require. Unit 1 - Understanding Computer Systems.; Coverage of use of applications and systems.; Case studies of how they are used for different purposes.; Exam style questions and guidance. Unit 2 - Using ICT to Create Business Solutions.; Coverage of the principles of use of re

  11. Percent Forest Cover (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCTFuture) generally indicate healthier ecosystems and cleaner surface water....

  12. Saturated Domino Coverings

    CERN Document Server

    Buchanan, Andrew; Ryba, Alex

    2011-01-01

    A domino covering of a board is saturated if no domino is redundant. We introduce the concept of a fragment tiling and show that a minimal fragment tiling always corresponds to a maximal saturated domino covering. The size of a minimal fragment tiling is the domination number of the board. We define a class of regular boards and show that for these boards the domination number gives the size of a minimal X-pentomino covering. Natural sequences that count maximal saturated domino coverings of square and rectangular boards are obtained. These include the new sequences A193764, A193765, A193766, A193767, and A193768 of OEIS.

  13. Percent Forest Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCT) generally indicate healthier ecosystems and cleaner surface water. More...

  14. The Twitter Book

    CERN Document Server

    O'Reilly, Tim

    2009-01-01

    This practical guide will teach you everything you need to know to quickly become a Twitter power user, including strategies and tactics for using Twitter's 140-character messages as a serious--and effective--way to boost your business. Co-written by Tim O'Reilly and Sarah Milstein, widely followed and highly respected Twitterers, the practical information in The Twitter Book is presented in a fun, full-color format that's packed with helpful examples and clear explanations.A Sneak Preview on SlideShare

  15. Instrumentation reference book

    CERN Document Server

    Boyes, Walt

    2002-01-01

    Instrumentation is not a clearly defined subject, having a 'fuzzy' boundary with a number of other disciplines. Often categorized as either 'techniques' or 'applications' this book addresses the various applications that may be needed with reference to the practical techniques that are available for the instrumentation or measurement of a specific physical quantity or quality. This makes it of direct interest to anyone working in the process, control and instrumentation fields where these measurements are essential.* Comprehensive and authoritative collection of technical information* Writte

  16. Bytes, Books and Readers

    DEFF Research Database (Denmark)

    Rasmussen, Krista Stinne Greve

    2016-01-01

    Geschichte von Editionen und der Entwicklung der Digital Humanities besonderes Augenmerk geschenkt, um zu demonstrieren, wie bedeutsam die Analyse der Überlieferung und der Textbegriff für die Geschichte von Editionen sind. Beispiele aus Alastair McKinnons erster digitaler Edition von Soren Kierkegaards......In diesem Beitrag werden Ergebnisse aus der Dissertation der Autorin Bytes, Books, and Readers. A Historical Analysis of the Transition from Printed to Digital Scholarly Editions Focusing on ‘The Writings of Søren Kierkegaard’ (2015) vorgestellt. Dabei wird dem Wechselverhältnis zwischen der...

  17. The automotive transmission book

    CERN Document Server

    Fischer, Robert; Jürgens, Gunter; Najork, Rolf; Pollak, Burkhard

    2015-01-01

    This book presents essential information on systems and interactions in automotive transmission technology and outlines the methodologies used to analyze and develop transmission concepts and designs. Functions of and interactions between components and subassemblies of transmissions are introduced, providing a basis for designing transmission systems and for determining their potentials and properties in vehicle-specific applications: passenger cars, trucks, buses, tractors, and motorcycles. With these fundamentals the presentation provides universal resources for both state-of-the-art and future transmission technologies, including systems for electric and hybrid electric vehicles.

  18. The Twitter Book

    CERN Document Server

    O'Reilly, Tim

    2011-01-01

    Twitter is not just for talking about your breakfast anymore. It's become an indispensable communications tool for businesses, non-profits, celebrities, and people around the globe. With the second edition of this friendly, full-color guide, you'll quickly get up to speed not only on standard features, but also on new options and nuanced uses that will help you tweet with confidence. Co-written by two widely recognized Twitter experts, The Twitter Book is packed with all-new real-world examples, solid advice, and clear explanations guaranteed to turn you into a power user. Use Twitter to con

  19. Outstanding Science Trade Books for Children in 1988.

    Science.gov (United States)

    Science and Children, 1989

    1989-01-01

    Lists annotations of books based on accuracy of contents, readability, format, and illustrations. Includes number of pages in each entry, price, and availability. Topics cover animals, biographies, space science, astronomy, archaeology, anthropology, earth and life sciences, medical and health sciences, physics, technology, and engineering. (RT)

  20. Installing the ARL Phrase Book Android Application and Configuring its Dependencies

    Science.gov (United States)

    2015-02-01

    Installing the ARL Phrase Book Android Application and Configuring its Dependencies by Michael H Lee ARL-TN-0664 February 2015...February 2015 Installing the ARL Phrase Book Android Application and Configuring its Dependencies Michael H Lee Computational and...COVERED (From - To) 03/2014–05/2014 4. TITLE AND SUBTITLE Installing the ARL Phrase Book Android Application and Configuring its Dependencies 5a

  1. Book advertisements in Osijek’s 19th century newspapers

    Directory of Open Access Journals (Sweden)

    Maja Krtalić

    2009-04-01

    was found that book advertising coincided with the emergence of newspapers, with ads at first appearing only occasionally, but later, with the development and spreading of newspapers, more frequently. Book ads were not, for the most part, included in the sections reserved for advertising but, rather, in the sections covering cultural matters, notices, daily news, etc. Visually, they were not prominent and were addressed at the existing readership, especially in the German newspapers. They may be divided into several categories: ads for books published outside Osijek and Croatia, ads for books available in Osijek’s bookshops, ads for newspapers and journals, and printers’ ads. Only a small number of book ads were printed in the ads section. Information included in the ads covered the title, author’s name, content, price, publisher and the name of the bookseller. Attached is a bibliography of advertisements in the above-listed newspapers.   Keywords:books; book advertising; newspapers; advertisements; Osijek; printing; 19th century

  2. Proofs from THE BOOK

    CERN Document Server

    Aigner, Martin

    2014-01-01

    This revised and enlarged fifth edition features four new chapters, which contain highly original and delightful proofs for classics such as the spectral theorem from linear algebra, some more recent jewels like the non-existence of the Borromean rings and other surprises. From the Reviews "... Inside PFTB (Proofs from The Book) is indeed a glimpse of mathematical heaven, where clever insights and beautiful ideas combine in astonishing and glorious ways. There is vast wealth within its pages, one gem after another. ... Aigner and Ziegler... write: "... all we offer is the examples that we have selected, hoping that our readers will share our enthusiasm about brilliant ideas, clever insights and wonderful observations." I do. ... " Notices of the AMS, August 1999 "... This book is a pleasure to hold and to look at: ample margins, nice photos, instructive pictures, and beautiful drawings ... It is a pleasure to read as well: the style is clear and entertaining, the level is close to elementary, the necessary b...

  3. Alzira’s book

    Directory of Open Access Journals (Sweden)

    Maria Do Rosário Longo Mortatti

    2013-01-01

    Full Text Available Aiming it contribute to discussions on teaching and learning of reading and writing, is presented, in the form of critical review, the analysis of textual configuration of the book Será que fui eu ?, by Alzira Silveria. This analysis was developed based on the assumption that reading and producing written texts are specifically human activities whose function and importance beyond the boundaries of the school and change ways of thinking, feeling, will and act, promoting qualitative changes in process of human development and providing active participation in the public world of written culture, and therefore in society and history. This is the main “life lesson” that the author of the book teaches all interested in the subject, especially to school teachers responsible for teaching reading and writing, which can only be successful if and when they understand themselves as historical and social people who, also experience reading and producing written texts, not only as necessary acturties for their teaching performance, but rather as essential activities for human development, of people who are author of their own speech frow and about their life and history.

  4. Unlimited Horizons: Design and Development of the U-2. [NASA Aeronautics Book Series

    Science.gov (United States)

    Merlin, Peter W.

    2015-01-01

    This book describes the creation, history, design, and research value of the U-2 program. It also describes the involvement of NACA, as a cover story, and the later use by NASA of these aircraft as environmental research platforms.

  5. Land Cover Characterization Program

    Science.gov (United States)

    ,

    1997-01-01

    The U.S. Geological Survey (USGS) has a long heritage of leadership and innovation in land use and land cover mapping. The USGS Anderson system defined the principles for land use and land cover mapping that have been the model both nationally and internationally for more than 20 years. The Land Cover Characterization Program (LCCP) is founded on the premise that the Nation's needs for land cover and land use data are diverse and increasingly sophisticated. The range of projects, programs, and organizations that use land cover data to meet their planning, management, development, and assessment objectives has expanded significantly. The reasons for this are numerous, and include the improved capabilities provided by geographic information systems, better and more data-intensive analytic models, and increasing requirements for improved information for decision making. The overall goals of the LCCP are to:

  6. Land Cover Trends Project

    Science.gov (United States)

    Acevedo, William

    2006-01-01

    The Land Cover Trends Project is designed to document the types, rates, causes, and consequences of land cover change from 1973 to 2000 within each of the 84 U.S. Environmental Protection Agency (EPA) Level III ecoregions that span the conterminous United States. The project's objectives are to: * Develop a comprehensive methodology using probability sampling and change analysis techniques and Landsat Multispectral Scanner (MSS), Thematic Mapper (TM), and Enhanced Thematic Mapper (ETM) data for estimating regional land cover change. * Characterize the spatial and temporal characteristics of conterminous U.S. land cover change for five periods from 1973 to 2000 (nominally 1973, 1980, 1986, 1992, and 2000). * Document the regional driving forces and consequences of change. * Prepare a national synthesis of land cover change.

  7. Book Review ‘A short history of ethics and economics – the Greeks’

    NARCIS (Netherlands)

    I.P. van Staveren (Irene)

    2013-01-01

    markdownabstract__Abstract__ The book’s cover pictures the sculptures of the four Greek philosophers whose work the book discusses: Socrates, Xenophon, Aristotle and Plato. This picture conveys the main message of the book, namely that economics is not independent from philosophy, including ethics,

  8. Becoming Trivial: The Book Trailer

    Directory of Open Access Journals (Sweden)

    Kati Voigt

    2013-12-01

    Full Text Available Despite the introduction of audiobooks and e-books, printed stories still are in high demand. However, in a globalized world which is more and more ruled by mass media and technology, it is increasingly difficult for writers and publishers to promote their books. The solution is almost ironic: popular media, which is assumed to decrease readership, is turned into a tool to increase the number of readers. In 2002 the book trailer emerged as a new web-based marketing strategy for the launch of new books. Since then the appearance of the book trailer has changed considerably. The article examines specific examples and highlights methods that establish the relationship between the content of the book and its representation in the book trailer. Although guidelines apply for the production of book trailers, such as constraints relating to time and content, there are no limitations for the imagination of the producers. A book trailer may be simple, supported only by music and pictures, but they may also be as complex as short films. Additionally, book trailers are not limited to the promotion of one specific genre or age group. Depending on the viral potential of social networks such as YouTube, Facebook, and Tumblr book trailers reach a global audience and, therefore, open up new markets. It can be argued, while book trailers have not yet reached the realm of the everyday, they will gradually come to the attention of academics and this article wants to present a starting point for this development.

  9. Facilitating a midwifery book club.

    Science.gov (United States)

    Chenery-Morris, Samantha

    2012-03-01

    A midwifery student book club was set up at University Campus Suffolk (UCS) with the aim of engaging students in alternative forms of literature relevant to their studies and to enhance their university experience. The book club was well attended by first and second year midwifery students, but less so by third years. There was evidence of informal student engagement with the lecturer through follow up emails about the meetings. Most of the books reviewed were enjoyed, but the responsibility of suggesting a book for their peers to review was deemed too much by some students.

  10. Covering folded shapes

    Directory of Open Access Journals (Sweden)

    Oswin Aichholzer

    2014-05-01

    Full Text Available Can folding a piece of paper flat make it larger? We explore whether a shape S must be scaled to cover a flat-folded copy of itself. We consider both single folds and arbitrary folds (continuous piecewise isometries \\(S\\to\\mathbb{R}^2\\. The underlying problem is motivated by computational origami, and is related to other covering and fixturing problems, such as Lebesgue's universal cover problem and force closure grasps. In addition to considering special shapes (squares, equilateral triangles, polygons and disks, we give upper and lower bounds on scale factors for single folds of convex objects and arbitrary folds of simply connected objects.

  11. Percent Wetland Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Wetlands act as filters, removing or diminishing the amount of pollutants that enter surface water. Higher values for percent of wetland cover (WETLNDSPCT) may be...

  12. Percent Wetland Cover (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Wetlands act as filters, removing or diminishing the amount of pollutants that enter surface water. Higher values for percent of wetland cover (WETLNDSPCT) may be...

  13. GAP Land Cover - Image

    Data.gov (United States)

    Minnesota Department of Natural Resources — This raster dataset is a simple image of the original detailed (1-acre minimum), hierarchically organized vegetation cover map produced by computer classification...

  14. GAP Land Cover - Vector

    Data.gov (United States)

    Minnesota Department of Natural Resources — This vector dataset is a detailed (1-acre minimum), hierarchically organized vegetation cover map produced by computer classification of combined two-season pairs of...

  15. Projected 2020 Land Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Projected 2020 land cover was developed to provide one scenario of development in the year 2020. It was used to generate several metrics to compare to 1992 metrics...

  16. Percent of Impervious Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — High amounts of impervious cover (parking lots, rooftops, roads, etc.) can increase water runoff, which may directly enter surface water. Runoff from roads often...

  17. CERN Book Fair 2010 - Events and book presentations

    CERN Multimedia

    CERN Library

    2010-01-01

    A series of events and book presentations is scheduled for the 2010 CERN Book Fair.   -Springer will present its new products and services (eBooks, MyCopy Softcover Editions, SpringerBriefs, and a new physics journal: "Historical Perspectives on Contemporary Physics") and SpringerMaterials, the electronic version of the Landolt Boernstein book series. -Wiley will present two books: "A History of International Research Networking : The People who Made it Happen", edited by B. Bressan and H. Davies, and "Field computation for accelerator magnets : analytical and numerical methods for electromagnetic design and optimization" by S. Russenschuck. -Finally, World Scientific will present the series "Reviews of Accelerator Science and Technology (RAST)". The calendar is available here: http://indico.cern.ch/conferenceDisplay.py?confId=105651      

  18. Making meaning(s with cover designs

    Directory of Open Access Journals (Sweden)

    Yvonne Reed

    2011-08-01

    Full Text Available In this article Halliday’s systemic functional grammar, Kress and Van Leeuwen’s grammar of visual design and Bernstein’s work on pedagogic discourse are drawn on in order to analyze some of the ways in which meanings are made and some meanings privileged over others in the designing, both visual and discursive, of the covers of three course books prepared for teacher education programmes in South Africa. The primary aim of this analysis is to understand what meanings are offered to readers as entrants into or as established members of communities of practice in the teaching profession and the academy.

  19. The landscape lighting book

    CERN Document Server

    Moyer, Janet Lennox

    2013-01-01

    This richly illustrated, up-to-date guide offers practical coverage of all aspects of lighting design. Written by an award-winning, internationally known lighting designer, it covers lighting practices, materials, and their design applications and offers guidelines for preparing lighting drawings, control and transfer charts, symbol lists, and other technical specifications. This edition provides a new focus on the use of LEDs, as well as new and expanded coverage of renderings, Mesopic Vision, and the latest controls approaches and systems.

  20. From book to eBook : towards a print conception of the eBook

    OpenAIRE

    Berry, Katherine Rachel L

    2005-01-01

    Denne avhandlingen er en analyse av eBook som beskrevet av to eBook forlag via ebooks.com og ereader.com på internett. Avhandlingen inkluderer også en analyse av tre andre programmer; Abode Reader, Microsoft Reader og eReader. Ut fra websidens innhold som fokuserer på en visuell presentasjon av eBook og språket som blir brukt i forbindelse med eBook så vil analysen ta dette i betraktning. I forbindelse med reader programmet så vil den visuelle presentasjonen, funksjoner, skriveområde og sp...

  1. BOOK REVIEW: Inverse Problems. Activities for Undergraduates

    Science.gov (United States)

    Yamamoto, Masahiro

    2003-06-01

    into the nature of inverse problems and the appropriate mode of thought, chapter 1 offers historical vignettes, most of which have played an essential role in the development of natural science. These vignettes cover the first successful application of `non-destructive testing' by Archimedes (page 4) via Newton's laws of motion up to literary tomography, and readers will be able to enjoy a wide overview of inverse problems. Therefore, as the author asks, the reader should not skip this chapter. This may not be hard to do, since the headings of the sections are quite intriguing (`Archimedes' Bath', `Another World', `Got the Time?', `Head Games', etc). The author embarks on the technical approach to inverse problems in chapter 2. He has elegantly designed each section with a guide specifying course level, objective, mathematical and scientifical background and appropriate technology (e.g. types of calculators required). The guides are designed such that teachers may be able to construct effective and attractive courses by themselves. The book is not intended to offer one rigidly determined course, but should be used flexibly and independently according to the situation. Moreover, every section closes with activities which can be chosen according to the students' interests and levels of ability. Some of these exercises do not have ready solutions, but require long-term study, so readers are not required to solve all of them. After chapter 5, which contains discrete inverse problems such as the algebraic reconstruction technique and the Backus - Gilbert method, there are answers and commentaries to the activities. Finally, scripts in MATLAB are attached, although they can also be downloaded from the author's web page (http://math.uc.edu/~groetsch/). This book is aimed at students but it will be very valuable to researchers wishing to retain a wide overview of inverse problems in the midst of busy research activities. A Japanese version was published in 2002.

  2. BOOK REVIEW: Quantum Gravity (2nd edn)

    Science.gov (United States)

    Husain, Viqar

    2008-06-01

    There has been a flurry of books on quantum gravity in the past few years. The first edition of Kiefer's book appeared in 2004, about the same time as Carlo Rovelli's book with the same title. This was soon followed by Thomas Thiemann's 'Modern Canonical Quantum General Relativity'. Although the main focus of each of these books is non-perturbative and non-string approaches to the quantization of general relativity, they are quite orthogonal in temperament, style, subject matter and mathematical detail. Rovelli and Thiemann focus primarily on loop quantum gravity (LQG), whereas Kiefer attempts a broader introduction and review of the subject that includes chapters on string theory and decoherence. Kiefer's second edition attempts an even wider and somewhat ambitious sweep with 'new sections on asymptotic safety, dynamical triangulation, primordial black holes, the information-loss problem, loop quantum cosmology, and other topics'. The presentation of these current topics is necessarily brief given the size of the book, but effective in encapsulating the main ideas in some cases. For instance the few pages devoted to loop quantum cosmology describe how the mini-superspace reduction of the quantum Hamiltonian constraint of LQG becomes a difference equation, whereas the discussion of 'dynamical triangulations', an approach to defining a discretized Lorentzian path integral for quantum gravity, is less detailed. The first few chapters of the book provide, in a roughly historical sequence, the covariant and canonical metric variable approach to the subject developed in the 1960s and 70s. The problem(s) of time in quantum gravity are nicely summarized in the chapter on quantum geometrodynamics, followed by a detailed and effective introduction of the WKB approach and the semi-classical approximation. These topics form the traditional core of the subject. The next three chapters cover LQG, quantization of black holes, and quantum cosmology. Of these the chapter on LQG is

  3. When Books Are Your Friends

    Science.gov (United States)

    Chudnov, Daniel

    2009-01-01

    Since most libraries are now hosting their own web sites, this author advocates for a social network centered on the work of building and supporting resource-rich library sites. While there are already several social networks for books, books are just one thing that libraries make available. A social network that helps people share what they are…

  4. The eBook Hook

    Science.gov (United States)

    Barger, Bettie Parsons; Notwell, Mary

    2013-01-01

    The time students spend using mobile devices is making an impact on the reading experience both inside and outside the classroom. The authors--a doctoral student and a fourth-grade language arts and science teacher--designed and implemented a unit on landforms that included nonfiction reading, with both traditional print books and eBooks on iPads,…

  5. Connect the Book. Benjamin Franklin

    Science.gov (United States)

    Brodie, Carolyn S.

    2004-01-01

    This article presents a brief review of James Cross Giblin's "The Amazing Life of Benjamin Franklin" (Scholastic, 2000). This book provides a real look at the life of one of America's most famous statesmen who was also a printer, inventor, and writer. The book additionally includes a chronology of Franklin's life, information about his many…

  6. Seven Tips for Publishing Books

    Science.gov (United States)

    Kumashiro, Kevin K.

    2004-01-01

    The publishing industry in the field of education is undergoing several profound changes. New publishers are emerging while established publishers are merging. More book series (that is, books on a certain topic that are approved and mentored by one or more established scholars in the field) are being created. Alternative paths are becoming more…

  7. Discis Books: Adventures in Learning.

    Science.gov (United States)

    Martin, Ron

    1992-01-01

    Describes a new product by Discis Books which offers complete editions of classic and original children's books on CD-ROM including features such as reading aloud by a variety of voices, background music, sound effects, help with vocabulary, customized appearance of text, and availability of foreign translations. A library media activity for…

  8. How to Get Greener Books

    Science.gov (United States)

    Malone, Cynthia N.

    2008-01-01

    Professors select readings for their students in different forms: printed matter, including books and journals; print-on-demand texts; and online material. Before long, enough books and articles will be available for downloading onto devices like the Sony Reader and Amazon.com's new Kindle to make that format another option. They consider a wide…

  9. Book Display as Adult Service.

    Science.gov (United States)

    Moore, Matthew S.

    1997-01-01

    Defines book display as an adult service as choosing and positioning adult books from the library collection to increase their circulation. The author contrasts bookstore arrangement for sales versus library arrangement for access, including contrasting missions, genre grouping, weeding, problems, and dimensions. (Author/LRW)

  10. Are Goosebumps Books Real Literature?

    Science.gov (United States)

    Perry, Leslie Anne; Butler, Rebecca P.

    1997-01-01

    Argues that, regardless of whether they have literary merit, the "Goosebumps" books (a series of mildly scary horror books for preteens) are getting children hooked on reading, some of whom do not otherwise read. Discusses students' attitudes toward the series. (SR)

  11. The Common Vision. Reviews: Books.

    Science.gov (United States)

    Chattin-McNichols, John

    1998-01-01

    Reviews Marshak's book describing the work of educators Maria Montessori, Rudolf Steiner, Aurobindo Ghose, and Inayat Khan. Maintains that the book gives clear, concise information on each educator and presents a common vision for children and their education; also maintains that it gives theoretical and practical information and discusses…

  12. Hooked on Books: Program & Proof.

    Science.gov (United States)

    Fader, Daniel N.; McNeil, Elton B.

    An approach to learning called "English in Every Classroom" and based on the concepts of saturation and diffusion is presented in a book that proposes to surround the student with newspapers, magazines, and paperbound books until he comes to perceive them as a pleasureable means to a necessary end and to relate school to the world outside. The…

  13. MacBook for dummies

    CERN Document Server

    Chambers , Mark L

    2014-01-01

    Make friends with your MacBook the fun and easy way! Ultra-light, ultra-fast, and ultra-powerful, the MacBook is the coolest laptop in town, and longtime Mac guru Mark L. Chambers is just the guy to help you get to know your MacBook in no time. Take a closer look at the latest features, get the lowdown on OS X, unleash your creative forces with iLife, take care of business with the iWork applications, and sync it all with iCloud with the expert advice in this bestselling MacBook guide. Whether this is your first MacBook or your first laptop, period, you''ll learn to navigate the Mac desktop, c

  14. The inherited sewing box [second edition][artists' book

    OpenAIRE

    2011-01-01

    this small 16pp book, designed to replicate a needle-case, explores the contents of a sewing box that was inherited on the death of a family member. Pen and ink drawings are juxtaposed with short statements from the family who recall their memories of the sewing-box and its contents The book combines ink-jet printing with typewritten text and rubber stamps; four of the edition includes fabric elements that are machine-stitched to the pages. Felt covers with button detail and fabric endpap...

  15. What Do Digital Books Mean for Libraries?

    Science.gov (United States)

    Lynch, Clifford

    2001-01-01

    Discusses digital books, or electronic books, and their relationship to libraries and communication between authors and readers. Topics include the scholarly market, for academic libraries, versus the consumer market; textbooks versus novels; digitization of older books; marketing; costs; and electronic books versus printed books. (LRW)

  16. Inciting Interest in the Newbery Award Books

    Science.gov (United States)

    Hegel, Claudette

    2007-01-01

    Hearing some fun facts about books and authors can bring books to life and help ignite students' interest in books and reading. Because most elementary school media centers and public libraries have many of the Newbery Medal books, students will have a better chance of finding books they decide they want to read once they hear about them. Reading…

  17. University contracts summary book

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-08-01

    The principal objectives of the Fossil Energy Program are to seek new ideas, new data, fundamental knowledge that will support the ongoing programs, and new processes to better utilize the nation's fossil energy resources with greater efficiency and environmental acceptability. Toward this end, the Department of Energy supports research projects conducted by universities and colleges to: Ensure a foundation for innovative technology through the use of the capabilities and talents in our academic institutions; provide an effective, two-way channel of communication between the Department of Energy and the academic community; and ensure that trained technical manpower is developed to carry out basic and applied research in support of DOE's mission. Fossil Energy's university activities emphasize the type of research that universities can do best - research to explore the potential of novel process concepts, develop innovative methods and materials for improving existing processes, and obtain fundamental information on the structure of coal and mechanisms of reactions of coal, shale oil, and other fossil energy sources. University programs are managed by different Fossil Energy technical groups; the individual projects are described in greater detail in this book. It is clear that a number of research areas related to the DOE Fossil Energy Program have been appropriate for university involvement, and that, with support from DOE, university scientific and technical expertise can be expected to continue to play a significant role in the advancement of fossil energy technology in the years to come.

  18. Climate under cover

    CERN Document Server

    Takakura, Tadashi

    2002-01-01

    1.1. INTRODUCTION Plastic covering, either framed or floating, is now used worldwide to protect crops from unfavorable growing conditions, such as severe weather and insects and birds. Protected cultivation in the broad sense, including mulching, has been widely spread by the innovation of plastic films. Paper, straw, and glass were the main materials used before the era of plastics. Utilization of plastics in agriculture started in the developed countries and is now spreading to the developing countries. Early utilization of plastic was in cold regions, and plastic was mainly used for protection from the cold. Now plastic is used also for protection from wind, insects and diseases. The use of covering techniques started with a simple system such as mulching, then row covers and small tunnels were developed, and finally plastic houses. Floating mulch was an exception to this sequence: it was introduced rather recently, although it is a simple structure. New development of functional and inexpensive films trig...

  19. BOOK REVIEW: Theory of Neural Information Processing Systems

    Science.gov (United States)

    Galla, Tobias

    2006-04-01

    It is difficult not to be amazed by the ability of the human brain to process, to structure and to memorize information. Even by the toughest standards the behaviour of this network of about 1011 neurons qualifies as complex, and both the scientific community and the public take great interest in the growing field of neuroscience. The scientific endeavour to learn more about the function of the brain as an information processing system is here a truly interdisciplinary one, with important contributions from biology, computer science, physics, engineering and mathematics as the authors quite rightly point out in the introduction of their book. The role of the theoretical disciplines here is to provide mathematical models of information processing systems and the tools to study them. These models and tools are at the centre of the material covered in the book by Coolen, Kühn and Sollich. The book is divided into five parts, providing basic introductory material on neural network models as well as the details of advanced techniques to study them. A mathematical appendix complements the main text. The range of topics is extremely broad, still the presentation is concise and the book well arranged. To stress the breadth of the book let me just mention a few keywords here: the material ranges from the basics of perceptrons and recurrent network architectures to more advanced aspects such as Bayesian learning and support vector machines; Shannon's theory of information and the definition of entropy are discussed, and a chapter on Amari's information geometry is not missing either. Finally the statistical mechanics chapters cover Gardner theory and the replica analysis of the Hopfield model, not without being preceded by a brief introduction of the basic concepts of equilibrium statistical physics. The book also contains a part on effective theories of the macroscopic dynamics of neural networks. Many dynamical aspects of neural networks are usually hard to find in the

  20. News from the Library: Browse Library books directly from your desktop

    CERN Multimedia

    CERN Library

    2011-01-01

    The collection of electronic books held by the Library is steadily expanding, but there are still many titles not available online. However, to some extent Google is bridging the gap.   Google Books is an initiative launched by Google in 2004, in collaboration with a range of publishers and large libraries, which provides the books online and enables searches of the text from cover to cover. For titles that are out of copyright, or in cases where Google has struck an agreement with the publisher, the entire books can be read online. For other books, users can still search in the entire text but, depending on the agreement reached with the publisher, they may only be able to read a limited amount of pages (limited preview) or a few lines of text (known as snippets). Google Books also provides additional information such as reviews and links to related titles. Today, there are more than 15 million scanned books in Google Books. Over the last few weeks, Google Books has been "mashed up&...

  1. Reusable pipe flange covers

    Energy Technology Data Exchange (ETDEWEB)

    Holden, James Elliott (Simpsonville, SC); Perez, Julieta (Houston, TX)

    2001-01-01

    A molded, flexible pipe flange cover for temporarily covering a pipe flange and a pipe opening includes a substantially round center portion having a peripheral skirt portion depending from the center portion, the center portion adapted to engage a front side of the pipe flange and to seal the pipe opening. The peripheral skirt portion is formed to include a plurality of circumferentially spaced tabs, wherein free ends of the flexible tabs are formed with respective through passages adapted to receive a drawstring for pulling the tabs together on a back side of the pipe flange.

  2. BOOK REVIEW: Cosmology

    Science.gov (United States)

    Silk, Joseph

    2008-11-01

    recent, and comprehensive, is Cosmology, in which the University of Texas physicist and Nobel Laureate, Steven Weinberg provides a concise introduction to modern cosmology. The book is aimed at the level of a final year physics undergraduate, or a first year graduate student. The discussion is self-contained, with numerous derivations. It begins with an overview of the standard cosmological model, and presents a detailed treatment of fluctuation growth. There are sections on gravitational lensing and inflationary cosmology, on microwave background fluctuations and structure growth. There are aspects however where a supplementary book is essential for the physicist being introduced to cosmology. The text is lacking in physical cosmology. The baryon physics of galaxy formation is barely mentioned, apart from a discussion of the Jeans mass. And it ignores one of the greatest contributions to the field by Russian cosmologist Yaakov Zel'dovich, who discovered the only nonspherical solution to the nonlinear evolution of density fluctuations, one that has since dominated our understanding of the large-scale structure of the universe via the cosmic web. But these are minor quibbles about what provides an outstanding introduction to modern cosmology, and one that takes us from the physics fundamentals up to the cosmic frontier. I recommend Cosmology for anyone wishing to enter the field and with a good physics background. It is ideal for the astronomer who may only have a sketchy knowledge of general relativity or particle physics. She will learn about vielbeins and scalar fields, gauge-invariant fluctuation theory and inflation. Steven Weinberg is a leading physicist who has also made important contributions to cosmology. The text provides a rigorous treatment of the standard model of cosmology, and of structure formation. Numerous exercises are provided. It provides an excellent core for a course on cosmology.

  3. Books, Places, Regions: A Natural Blend.

    Science.gov (United States)

    Oden, Pat

    1995-01-01

    Maintains that children love books, and through carefully selected books, geographic concepts can be taught. Explains how children's literature encourages geographic thinking, builds geographic skills, and develops lasting mental maps of places and regions. Discusses 14 suggested books. (CFR)

  4. Selecting Trade Books for Elementary Science Units.

    Science.gov (United States)

    Rop, Charles J.; Rop, Sheri K.

    2001-01-01

    Explains the importance of using well-chosen trade books for stimulating student interest and motivation in the natural world. Discusses how to assess and select trade books. Lists selected trade books on the life cycles of plants. (YDS)

  5. Book Display as Adult Service

    Directory of Open Access Journals (Sweden)

    Matthew S. Moore

    1997-03-01

    Full Text Available 無Book display as an adult service is defined as choosing and positioning adult books from the collection to increase their circulation. The author contrasts bookstore arrangement for sales versus library arrangement for access. The paper considers the library-as-a-whole as a display, examines the right size for an in-library display, and discusses mass displays, end-caps, on-shelf displays, and the Tiffany approach. The author proposes that an effective display depends on an imaginative, unifying theme, and that book displays are part of the joy of libraries.

  6. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    2013-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  7. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid

    2015-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  8. CORINE Land Cover 2006

    DEFF Research Database (Denmark)

    Stjernholm, Michael

    "CORINE land cover" er en fælleseuropæisk kortlægning af arealanvendelse/arealdække. Arealanvendelse/arealdække er i Danmark kortlagt efter CORINE metode og klasseopdeling med satellitbilleder fra 3 forskellige tidsperioder, fra begyndelsen af 1990'erne (CLC90), fra år 2000 (CLC2000) og fra år 2006...

  9. The Role of Book Familiarity and Book Type on Mothers' Reading Strategies and Toddlers' Responsiveness

    Science.gov (United States)

    Fletcher, Kathryn L.; Finch, W. Holmes

    2015-01-01

    The purpose of the current study was to examine how maternal reading strategies and book type would impact on toddlers' responsiveness as they became familiar with three books. Eleven mothers and their 2- to 3-year-olds were recorded reading the same set of three different books (i.e. word book, narrative book and no narrative book) on four…

  10. Libros Bilingues, Traducciones y Libros Recomendables. (Bilingual Books, Translations and Recommended Books in Spanish.)

    Science.gov (United States)

    Taylor, Jose G., Comp.

    Citing 123 books published between 1960 and 1977, this bibliography is divided into 3 main categories: (1) books with Spanish and English text, (2) translations of books also available in English, and (3) recommended books in Spanish. The first two sections concentrate on books for use in grades K-3. The final section includes books for older…

  11. Media Type Influences Preschooler's Literacy Development: E-Book versus Printed Book Reading

    Science.gov (United States)

    Kozminsky, Ely; Asher-Sadon, Revital

    2013-01-01

    Traditionally, children's books are in a printed format and shared book reading is done with an adult. In recent years, interactive E-books have become a common medium for children's books and shared book reading is diminishing. This study compared the contribution of book format to the development of literacy in kindergarten children. We…

  12. Catalysed fusion: a very different book about CERN

    CERN Multimedia

    CERN Library

    2013-01-01

    Not many books get reviews resulting in headlines like "Steamy novel challenges CERN's serious image", "Love and death at CERN" and so on. But Francis Farley's book "Catalysed Fusion" does not leave its readers untouched.   Those of you who have been around some time will know Farley from when he worked at CERN. For "newcomers", Farley is a well-known physicist who put together the first experiment on the anomalous magnetic moment of the muon and has since taken part in all the experiments relating to this phenomenon. The back cover of his book reads: "A sizzling romance and a romp with subatomic particles at CERN. Love, discovery and adventure in the city where nations meet and beams collide. Life in a large laboratory. As always, the challenges are the same. Who leads? Who follows? Who succeeds? Who gets the credit? Who gets the women or the men? Young Jeremy arrives in CERN and joins the quest ...

  13. BOOK REVIEW: Solid State Physics: An Introduction

    Science.gov (United States)

    Jakoby, Bernhard

    2009-07-01

    There's a wealth of excellent textbooks on solid state physics. The author of the present book is well aware of this fact and does not attempt to write just another one. Rather, he has provided a very compact introduction to solid state physics for third-year students. As we are faced with the continuous appearance interdisciplinary fields and associated study curricula in natural and engineering sciences (biophysics, mechatronics, etc), a compact text in solid state physics would be appreciated by students of these disciplines as well. The book features 11 chapters where each is provided with supplementary discussion questions and problems. The first chapters deal with a review of chemical bonding mechanisms, crystal structures and mechanical properties of solids, which are brief but by no means superficial. The following, somewhat more detailed chapter on thermal properties of lattices includes a nice introduction to phonons. The foundations of solid state electronics are treated in the next three chapters. Here the author first discusses the classical treatment of electronic behaviour in metals (Drude model) and continues with a quantum-theoretical approach starting with the free-electron model and leading to the band structures in conductive solids. The next chapter is devoted to semiconductors and ends with a brief but, with respect to the topical scope, adequate discussion of semiconductor devices. The classical topics of magnetic and dielectric behaviour are treated in the sequel. The book closes with a chapter on superconductivity and a brief chapter covering the modern topics of quantum confinement and aspects of nanoscale physics. In my opinion, the author has succeeded in creating a very concise yet not superficial textbook. The account presented often probes subjects deep enough to lay the basis for a thorough understanding, preparing the reader for more specialized textbooks. For instance, I think that this book may serve as an excellent first

  14. Book review:JIANG YAJUN,World Englishes:A Metadisciplinary Perspective%Book review :JIANG YAJUN, World Englishes: A Metadisciplinary Perspective

    Institute of Scientific and Technical Information of China (English)

    Xie Shaoliang

    2011-01-01

    Book reviewJIANG YAJUN,World Englishes:A Metadisciplinary Perspective.Beijing:China Social Sciences Prfess,2008.349pp.ISBN-10:7500475799,ISBN-13:9787500475798,paper cover.This book adopts the concept of paradigm from Thomas Kuhn to testify the World Englishes (Wes) research is a science under the applied linguistics,mainly focusing on the levels of the structure,the research method and the research topics in the WEs disciplinary.

  15. Books for the Job Hunt.

    Science.gov (United States)

    Saltzman, Amy

    1992-01-01

    Reviews new and classic titles on career choice, job search methods, executive/professional job search, resume writing, and interviewing. Advises avoiding books with simplistic formulas and exercises or overt sales pitches for software, videos, and other products. (SK)

  16. MedPAC Data Book

    Data.gov (United States)

    U.S. Department of Health & Human Services — MedPACs Data Book is the result of discussions with congressional staff members regarding ways that MedPAC can better support them. Some of the information it...

  17. Exploration Blueprint: Data Book

    Science.gov (United States)

    Drake, Bret G. (Editor)

    2007-01-01

    The material contained in this report was compiled to capture the work performed by the National Aeronautics and Space Administration's (NASA's) Exploration study team in the late 2002 timeframe. The "Exploration Blueprint Data Book" documents the analyses and findings of the 90-day Agency-wide study conducted from September - November 2002. During the summer of 2002, the NASA Deputy Administrator requested that a study be performed with the following objectives: (1) Develop the rationale for exploration beyond low-Earth orbit (2) Develop roadmaps for how to accomplish the first steps through humans to Mars (3) Develop design reference missions as a basis for the roadmaps 4) Make recommendations on what can be done now to effect this future This planning team, termed the Exploration Blueprint, performed architecture analyses to develop roadmaps for how to accomplish the first steps beyond LEO through the human exploration of Mars. The previous NASA Exploration Team activities laid the foundation and framework for development of NASA's Integrated Space Plan. The reference missions resulting from the analysis performed by the Exploration Blueprint team formed the basis for requirement definition, systems development, technology roadmapping, and risk assessments for future human exploration beyond low-Earth orbit. Emphasis was placed on developing recommendations on what could be done now to effect future exploration activities. The Exploration Blueprint team embraced the "Stepping Stone" approach to exploration where human and robotic activities are conducted through progressive expansion outward beyond low-Earth orbit. Results from this study produced a long-term strategy for exploration with near-term implementation plans, program recommendations, and technology investments. Specific results included the development of a common exploration crew vehicle concept, a unified space nuclear strategy, focused bioastronautics research objectives, and an integrated human

  18. A Christmas Book from 1875

    Science.gov (United States)

    Greenslade, Thomas B., Jr.

    2009-01-01

    This is a story about a book that I found in my collection, its author, and the boy who owned it. The book is "The Boy's Playbook of Science", first published in 1860 by John Henry Pepper (1821-1900). On the flyleaf is written "Arthur G. Webster; Christmas/75; from Mama." Arthur Gordon Webster (1863-1923) was one of the founders of the American…

  19. Apple MacBook Air

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    当乔布斯手持MacBook Air,放言“there is somthing in air”时,苹果教徒们的信仰再一次得到了“升华”。其实再为MacBook Air来写这样一段文字,多少显得有些多余。

  20. Two books History of Cartography

    OpenAIRE

    2013-01-01

    Two valuable books were published under the title History of Cartography in the group Lecture Notes and the subgroup Publications of the International Cartographic Association. The books were published as a result of collaboration between International Cartographic Association (ICA) and the Springer-Verlag publishing company and contain most papers from the following symposia:3rd International Symposium of the ICA Commission on the History of Cartography at University of Texas in Arlington, O...

  1. Singular coverings of toposes

    CERN Document Server

    Bunge, Marta

    2006-01-01

    The self-contained theory of certain singular coverings of toposes called complete spreads, that is presented in this volume, is a field of interest to topologists working in knot theory, as well as to various categorists. It extends the complete spreads in topology due to R. H. Fox (1957) but, unlike the classical theory, it emphasizes an unexpected connection with topos distributions in the sense of F. W. Lawvere (1983). The constructions, though often motivated by classical theories, are sometimes quite different from them. Special classes of distributions and of complete spreads, inspired respectively by functional analysis and topology, are studied. Among the former are the probability distributions; the branched coverings are singled out amongst the latter. This volume may also be used as a textbook for an advanced one-year graduate course introducing topos theory with an emphasis on geometric applications. Throughout the authors emphasize open problems. Several routine proofs are left as exercises, but...

  2. Photos from the CMS Photo Book

    CERN Multimedia

    Boreham, S

    2008-01-01

    Photos from the CMS Photo Book. Activities at Point 5 in Cessy, France, between 1998 - 2008. Images of assembly and Installation of the CMS detector: - Civil Engineering - Assembly in the Surface Building - Lowering of the Heavy Elements - Installing and connecting the CMS detector in the underground experiment These images illustrate the assembly, installation and commissioning of the CMS detector. They cover the activities at Point 5 in Cessy, France, between 1998 and 2008. CMS is one of the most complex scientific instruments ever built. It has taken about 20 years to go from conceptual design to the completion of construction of the CMS detector for the LHC start-up in September 2008. Accomplishing this has required the talents, efforts and resources of over 2500 scientists and engineers from about 180 institutions in 38 countries. caverns Compiled by: S. Cittolin, F. Marcastel and T.S. Virdee

  3. Transportation energy data book: Edition 13

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.; Strang, S.G.

    1993-03-01

    The Transportation Energy Data Book: Edition 13 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes -- highway, air, water, rail, pipeline -- is treated in separate chapters or sections. Chapter 1 compares US transportation data with data from seven other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet automobiles, federal standards, fuel economies, and vehicle emission data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternatively-fueled vehicles. The last chapter, Chapter 6, covers each of the nonhighway modes: air, water, pipeline, and rail, respectively.

  4. Transportation energy data book: Edition 12

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.; Morris, M.D.

    1992-03-01

    The Transportation Energy Data Book: Edition 12 is a statistical compendium prepared and published by Oak Ridge National Laboratory under contract with the Office of Transportation Technologies in the Department of Energy. Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes--highway, air, water, rail, pipeline--is treated in separate chapters or sections. Chapter 1 compares US transportation data with data from seven other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet automobiles, federal standards, fuel economies, and vehicle emission data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternatively-fueled vehicles. The last chapter, Chapter 6, covers each of the nonhighway modes: air, water, pipeline, and rail, respectively.

  5. Transportation energy data book: edition 16

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C. [Lockheed Martin Energy Systems, Inc., Oak Ridge, TN (United States); McFarlin, D.N. [Tennessee Univ., Knoxville, TN (United States)

    1996-07-01

    The Transportation Energy Data Book: Edition 16 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes is treated in separate chapters or sections. Chapter 1 compares U.S. transportation data with data from other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet vehicles, federal standards, fuel economies, and high- occupancy vehicle lane data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternative fuel vehicles. Chapter 6 covers the major nonhighway modes: air, water, and rail. The last chapter, Chapter 7, presents data on environmental issues relating to transportation.

  6. Transportation energy data book: Edition 15

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    1995-05-01

    The Transportation Energy Data Book: Edition 15 is a statistical compendium. Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. Purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes is treated in separate chapters or sections. Chapter I compares US transportation data with data from other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet vehicles, federal standards, fuel economies, and high-occupancy vehicle lane data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternative fuel vehicles. Chapter 6 covers the major nonhighway modes: air, water, and rail. The last chapter, Chapter 7, presents data environmental issues relating to transportation.

  7. Transportation energy data book: Edition 13

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.; Strang, S.G.

    1993-03-01

    The Transportation Energy Data Book: Edition 13 is a statistical compendium prepared and published by Oak Ridge National Laboratory (ORNL) under contract with the Office of Transportation Technologies in the Department of Energy (DOE). Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes - highway, air, water, rail, pipeline - is treated in separate chapters or sections. Chapter 1 compares US transportation data with data from seven other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet automobiles, federal standards, fuel economies, and vehicle emission data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternatively-fueled vehicles. The last chapter, Chapter 6, covers each of the nonhighway modes: air, water, pipeline, and rail, respectively.

  8. Book Review: System Forensics, Investigation, and Response

    Directory of Open Access Journals (Sweden)

    Nate Keith

    2012-06-01

    Full Text Available Vacca, J. R. and Rudolph, K. (2011. System Forensics, Investigation, and Response. Sudbury, MA: Jones and Bartlett Learning. 339 + xv pages, ISBN: 978-0-7637-9134-6, US$89.95.Reviewed by Nate Keith, MBA, (natejkeith@gmail.comI recently expressed an interest to a respected colleague in finding a way to “give back” to the forensic community. He suggested writing a review for a text he recently received and provide feedback to the community. It is my intent to present an objective analysis of System Forensics, Investigation, and Response.Written by John R. Vacca and K Rudolph, this book is part of the Jones and Bartlett Learning Information Systems Security & Assurance Series.  Both Vacca and Rudolph have considerable experience in the information technology field as is demonstrated by the back cover notes: “John R. Vacca is an information technology consultant and internationally known best-selling author based in Pomeroy, Ohio.  Since 1982, he has written 62 books and more than 600 articles in the areas of advanced storage, computer security, and aerospace technology.(see PDF for full review

  9. LSST Science Book, Version 2.0

    CERN Document Server

    Allison, Julius; Andrew, John R; Angel, J Roger P; Armus, Lee; Arnett, David; Asztalos, S J; Axelrod, Tim S; Bailey, Stephen; Ballantyne, D R; Bankert, Justin R; Barkhouse, Wayne A; Barr, Jeffrey D; Barrientos, L Felipe; Barth, Aaron J; Bartlett, James G; Becker, Andrew C; Becla, Jacek; Beers, Timothy C; Bernstein, Joseph P; Biswas, Rahul; Blanton, Michael R; Bloom, Joshua S; Bochanski, John J; Boeshaar, Pat; Borne, Kirk D; Bradac, Marusa; Brandt, W N; Bridge, Carrie R; Brown, Michael E; Brunner, Robert J; Bullock, James S; Burgasser, Adam J; Burge, James H; Burke, David L; Cargile, Phillip A; Chandrasekharan, Srinivasan; Chartas, George; Chesley, Steven R; Chu, You-Hua; Cinabro, David; Claire, Mark W; Claver, Charles F; Clowe, Douglas; Connolly, A J; Cook, Kem H; Cooke, Jeff; Cooray, Asantha; Covey, Kevin R; Culliton, Christopher S; de Jong, Roelof; de Vries, Willem H; Debattista, Victor P; Delgado, Francisco; Dell'Antonio, Ian P; Dhital, Saurav; Di Stefano, Rosanne; Dickinson, Mark; Dilday, Benjamin; Djorgovski, S G; Dobler, Gregory; Donalek, Ciro; Dubois-Felsmann, Gregory; Durech, Josef; Eliasdottir, Ardis; Eracleous, Michael; Eyer, Laurent; Falco, Emilio E; Fan, Xiaohui; Fassnacht, Christopher D; Ferguson, Harry C; Fernandez, Yanga R; Fields, Brian D; Finkbeiner, Douglas; Figueroa, Eduardo E; Fox, Derek B; Francke, Harold; Frank, James S; Frieman, Josh; Fromenteau, Sebastien; Furqan, Muhammad; Galaz, Gaspar; Gal-Yam, A; Garnavich, Peter; Gawiser, Eric; Geary, John; Gee, Perry; Gibson, Robert R; Gilmore, Kirk; Grace, Emily A; Green, Richard F; Gressler, William J; Grillmair, Carl J; Habib, Salman; Haggerty, J S; Hamuy, Mario; Harris, Alan W; Hawley, Suzanne L; Heavens, Alan F; Hebb, Leslie; Henry, Todd J; Hileman, Edward; Hilton, Eric J; Hoadley, Keri; Holberg, J B; Holman, Matt J; Howell, Steve B; Infante, Leopoldo; Ivezic, Zeljko; Jacoby, Suzanne H; Jain, Bhuvnesh; R,; Jedicke,; Jee, M James; Jernigan, J Garrett; Jha, Saurabh W; Johnston, Kathryn V; Jones, R Lynne; Juric, Mario; Kaasalainen, Mikko; Styliani,; Kafka,; Kahn, Steven M; Kaib, Nathan A; Kalirai, Jason; Kantor, Jeff; Kasliwal, Mansi M; Keeton, Charles R; Kessler, Richard; Knezevic, Zoran; Kowalski, Adam; Krabbendam, Victor L; Krughoff, K Simon; Kulkarni, Shrinivas; Kuhlman, Stephen; Lacy, Mark; Lepine, Sebastien; Liang, Ming; Lien, Amy; Lira, Paulina; Long, Knox S; Lorenz, Suzanne; Lotz, Jennifer M; Lupton, R H; Lutz, Julie; Macri, Lucas M; Mahabal, Ashish A; Mandelbaum, Rachel; Marshall, Phil; May, Morgan; McGehee, Peregrine M; Meadows, Brian T; Meert, Alan; Milani, Andrea; Miller, Christopher J; Miller, Michelle; Mills, David; Minniti, Dante; Monet, David; Mukadam, Anjum S; Nakar, Ehud; Neill, Douglas R; Newman, Jeffrey A; Nikolaev, Sergei; Nordby, Martin; O'Connor, Paul; Oguri, Masamune; Oliver, John; Olivier, Scot S; Olsen, Julia K; Olsen, Knut; Olszewski, Edward W; Oluseyi, Hakeem; Padilla, Nelson D; Parker, Alex; Pepper, Joshua; Peterson, John R; Petry, Catherine; Pinto, Philip A; Pizagno, James L; Popescu, Bogdan; Prsa, Andrej; Radcka, Veljko; Raddick, M Jordan; Rasmussen, Andrew; Rau, Arne; Rho, Jeonghee; Rhoads, James E; Richards, Gordon T; Ridgway, Stephen T; Robertson, Brant E; Roskar, Rok; Saha, Abhijit; Sarajedini, Ata; Scannapieco, Evan; Schalk, Terry; Schindler, Rafe; Schmidt, Samuel; Schmidt, Sarah; Schneider, Donald P; Schumacher, German; Scranton, Ryan; Sebag, Jacques; Seppala, Lynn G; Shemmer, Ohad; Simon, Joshua D; Sivertz, M; Smith, Howard A; Smith, J Allyn; Smith, Nathan; Spitz, Anna H; Stanford, Adam; Stassun, Keivan G; Strader, Jay; Strauss, Michael A; Stubbs, Christopher W; Sweeney, Donald W; Szalay, Alex; Szkody, Paula; Takada, Masahiro; Thorman, Paul; Trilling, David E; Trimble, Virginia; Tyson, Anthony; Van Berg, Richard; Berk, Daniel Vanden; VanderPlas, Jake; Verde, Licia; Vrsnak, Bojan; Walkowicz, Lucianne M; Wandelt, Benjamin D; Wang, Sheng; Wang, Yun; Warner, Michael; Wechsler, Risa H; West, Andrew A; Wiecha, Oliver; Williams, Benjamin F; Willman, Beth; Wittman, David; Wolff, Sidney C; Wood-Vasey, W Michael; Wozniak, Przemek; Young, Patrick; Zentner, Andrew; Zhan, Hu

    2009-01-01

    A survey that can cover the sky in optical bands over wide fields to faint magnitudes with a fast cadence will enable many of the exciting science opportunities of the next decade. The Large Synoptic Survey Telescope (LSST) will have an effective aperture of 6.7 meters and an imaging camera with field of view of 9.6 deg^2, and will be devoted to a ten-year imaging survey over 20,000 deg^2 south of +15 deg. Each pointing will be imaged 2000 times with fifteen second exposures in six broad bands from 0.35 to 1.1 microns, to a total point-source depth of r~27.5. The LSST Science Book describes the basic parameters of the LSST hardware, software, and observing plans. The book discusses educational and outreach opportunities, then goes on to describe a broad range of science that LSST will revolutionize: mapping the inner and outer Solar System, stellar populations in the Milky Way and nearby galaxies, the structure of the Milky Way disk and halo and other objects in the Local Volume, transient and variable object...

  10. A Book on Bulgarian High Schools History

    Directory of Open Access Journals (Sweden)

    Asen N. Kozhukharov

    2016-06-01

    Full Text Available The article presents the book about the secondary education in Bulgaria during the period from the Bulgarian revival up to 1944, where the focus is on the government policy regarding the secondary education and the legislation of the secondary school as a part of the education system. The body of the book is supported with statistical data. There are three periods outlined within the development – the first one covers the time till the Liberation, from the Liberation until 1909 while the third one is from 1909 to 1944. The second period is characterized by a strive towards the leveling of the male and female secondary schools and their consolidation as a ground for higher education. During the third period the high school takes after the European one, it develops steadily and the short and ineffective changes do not bear any influence on the gradual expansion of the web of high schools (full – male, female, mixed or semigymnasium, with a real, half-classical or classical curriculum.

  11. Covering R-trees

    CERN Document Server

    Berestovskii, V N

    2007-01-01

    We show that every inner metric space X is the metric quotient of a complete R-tree via a free isometric action, which we call the covering R-tree of X. The quotient mapping is a weak submetry (hence, open) and light. In the case of compact 1-dimensional geodesic space X, the free isometric action is via a subgroup of the fundamental group of X. In particular, the Sierpin'ski gasket and carpet, and the Menger sponge all have the same covering R-tree, which is complete and has at each point valency equal to the continuum. This latter R-tree is of particular interest because it is "universal" in at least two senses: First, every R-tree of valency at most the continuum can be isometrically embedded in it. Second, every Peano continuum is the image of it via an open light mapping. We provide a sketch of our previous construction of the uniform universal cover in the special case of inner metric spaces, the properties of which are used in the proof.

  12. Book history as a research topic in Croatian journals from 2001 to 2010

    Directory of Open Access Journals (Sweden)

    Jasna Tingle

    2013-02-01

    Full Text Available The aim of the paper is to determine the scope and content of Croatian research output in the field of book history, determine which Croatian journals publish papers on book history, the topics covered and the number of scholars who do research in this field. The research was conducted on the corpus of 177 papers published in 17 Croatian journals from 2001 to 2010. The data collected indicates that few journals regularly publish papers on book history, and only one journal explicitly states book history as its major area of interest. Furthermore, it is evident that very few scholars regularly or occasionally do research on book history. The topics covered in selected papers bear witness to a wide range of interests, but only few papers follow recent trends in world book history research. This paper, however, does not cover scholarly or trade monographs and conference proceedings published during the time under investigation, which is one of the limitations of the current research. Still, the output in scholarly and trade journals, which are the main channels of scholarly communication, provides a relevant sample for determining the incidence of book history as a research topic in Croatian science. These findings are the main research contribution of this paper.

  13. Book Review: Grounded Theory: A practical guide (Birks & Mills, 2011)

    OpenAIRE

    Astrid Gynnild, Ph.D.

    2011-01-01

    What is grounded theory and how is a grounded theory study carried out? Several recent publications have been trying to answer these questions, building on a literature list on the topic that covers more than 40 years of research and scholarship. According to the authors, this book is aimed at beginner researchers, research students and experienced researchers from a variety of disciplines who are unfamiliar with grounded theory.

  14. Book Review: Grounded Theory: A practical guide (Birks & Mills, 2011

    Directory of Open Access Journals (Sweden)

    Astrid Gynnild, Ph.D.

    2011-12-01

    Full Text Available What is grounded theory and how is a grounded theory study carried out? Several recent publications have been trying to answer these questions, building on a literature list on the topic that covers more than 40 years of research and scholarship. According to the authors, this book is aimed at beginner researchers, research students and experienced researchers from a variety of disciplines who are unfamiliar with grounded theory.

  15. Advantages and Disadvantages of E-books

    Institute of Scientific and Technical Information of China (English)

    马立平

    2004-01-01

    The e-book has many advantages over a paper-based product. You .can store lots of books on one computer-in fact your entire library could be stored on the top of your desk. E-books also allow you to mark your page with an electronic bookmark and jump straight to it when you open the book.

  16. Path-breaking books in regional science

    NARCIS (Netherlands)

    Waldorf, BS

    2004-01-01

    This article presents a collection of regional science books that long-standing members of the Regional Science Association International (RSAI) identified as path-breaking books. The most frequently nominated books include the "classics" by Isard, the seminal books in urban economics by Alonso, Mut

  17. Examining Language of Information Books for Children

    Science.gov (United States)

    Inan, Hatice Zeynep

    2010-01-01

    In recent years, inclusion of information books in early childhood centers is well-advised since children show fast developing knowledge of information book language and enjoy reading those books. The aim of the current study is to discuss features of information books' language by examining the illustrations and texts of randomly selected 15…

  18. 46 CFR Section 1 - Books of account.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Books of account. Section 1 Section 1 Shipping MARITIME... TRANSACTIONS UNDER AGENCY AGREEMENTS Accounts Section 1 Books of account. A separate set of books of account... agreement. The books of original entry and ledgers may be similar in design to those heretofore employed...

  19. Emotional Realism in Books for Young People.

    Science.gov (United States)

    Bawden, Nina

    1980-01-01

    Presents reflections on a number of topics, including the author's purposes in writing children's fiction, the importance of judging children's books in the same way as adult books are judged, the role of children's books in fostering enjoyment in the fullest sense, and the need for children's books to take children's thoughts and feelings…

  20. Day Camp Manual: Administration. Book I.

    Science.gov (United States)

    Babcock, William

    The first book in a 5-book manual on day camping focuses on summer day camp administration. The book defines day camps as organized group experiences in outdoor living on a day-by-day basis and under trained leadership. It includes a philosophy of day camping, noting benefits to the campers. The book is divided into further chapters that describe…

  1. How Do You Choose Science Trade Books?

    Science.gov (United States)

    Rice, Diana C.; Dudley, Ann P.; Williams, Christy S.

    2001-01-01

    Compares textbooks and trade books for elementary grade levels. Recommends integrating trade books into hands-on science during the introduction of terms and examples. Points out the role of book content on elementary students' concept formation. Makes recommendations for selecting the right books for teaching science. (YDS)

  2. The Small Book Press: A Cultural Essential.

    Science.gov (United States)

    Henderson, Bill

    1984-01-01

    Discussion of small literary book publishers notes works of small-press authors (Thomas Paine, Washington Irving, Walt Whitman, Mark Twain, Upton Sinclair, Anais Nin); today's outstanding presses (Creative Arts Book Company, Persea Books, Full Court Press, Reed and Cannon Company, Tuumba Books); and role of little magazines. Thirty-seven…

  3. School Library Journal's Best Books 2008

    Science.gov (United States)

    Jones, Trevelyn; Toth, Luann; Charnizon, Marlene; Grabarek, Daryl; Fleishhacker, Joy

    2008-01-01

    Of the more than 5000 books reviewed in "School Library Journal's" ("SLJ's") pages in 2008, the 67 books listed in this article stood out as having distinctive voices, singular vision, and/or innovative approaches. They include books for toddlers and preschoolers, terrific picture books and easy readers, and some highly original novels. Fantasy,…

  4. Overview of the INEX 2009 Book Track

    NARCIS (Netherlands)

    Kazai, G.; Doucet, A.; Koolen, M.; Landoni, M.

    2010-01-01

    The goal of the INEX 2009 Book Track is to evaluate approaches for supporting users in reading, searching, and navigating the full texts of digitized books. The investigation is focused around four tasks: 1) the Book Retrieval task aims at comparing traditional and book-specific retrieval approaches

  5. Covered Clause Elimination

    CERN Document Server

    Heule, Marijn; Biere, Armin

    2010-01-01

    Generalizing the novel clause elimination procedures developed in [M. Heule, M. J\\"arvisalo, and A. Biere. Clause elimination procedures for CNF formulas. In Proc. LPAR-17, volume 6397 of LNCS, pages 357-371. Springer, 2010.], we introduce explicit (CCE), hidden (HCCE), and asymmetric (ACCE) variants of a procedure that eliminates covered clauses from CNF formulas. We show that these procedures are more effective in reducing CNF formulas than the respective variants of blocked clause elimination, and may hence be interesting as new preprocessing/simplification techniques for SAT solving.

  6. The library beyond the book

    CERN Document Server

    Schnapp, Jeffrey T

    2014-01-01

    With textbook readers and digital downloads proliferating, it is easy to imagine a time when printed books will vanish. Such forecasts miss the mark, argue Jeffrey Schnapp and Matthew Battles. Future bookshelves will not be wholly virtual, and libraries will thrive although in a variety of new social, cultural, and architectural forms. Schnapp and Battles combine deep study of the library s history with a record of institutional and technical innovation at metaLAB, a research group at the forefront of the digital humanities. They gather these currents in The Library Beyond the Book," exploring what libraries have been in the past to speculate on what they will become: hybrid places that intermingle books and ebooks, analog and digital formats, paper and pixels. Libraries have always been mix-and-match spaces, and remix is their most plausible future scenario. Speculative and provocative, The Library Beyond the Book" explains book culture for a world where the physical and the virtual blend with ever increasin...

  7. MacBook portable genius

    CERN Document Server

    Miser, Brad

    2008-01-01

    The Genius is in. You don't have to be a genius to use a MacBook. But if you want to get the very most out of yours, put this savvy Portable Genius guide to work. Want to connect your MacBook to other Macs? Use Expose to its fullest potential? Troubleshoot? You'll find cool and useful Genius tips, insider secrets, full-color screenshots, and pages of easy-to-access shortcuts and tools that will save you loads of time and make your MacBook IQ soar. Portable GENIUS Fun, hip, and straightforward, the new Portable Genius series gives forward-thinking Apple users useful informat

  8. CERN Scientific Book Fair 2013

    CERN Multimedia

    CERN Library

    2013-01-01

    The CERN Bookshop and CERN Library invite you to attend the 2013 CERN Book Fair, a two-day scientific event offering you the opportunity to meet key publishers and to browse and purchase books at significant discounts.   Key publishers will present a selection of titles in physics, technology, mathematics, engineering, computing and popular science. You are welcome to come along and meet the publishers’ representatives or simply have a look at the books on sale. The fair will take place in the Main Building (Bldg. 500) on the ground floor near Restaurant 1 on Monday 9 and Tuesday 10 September. Participating or represented publishers include: Oxford University Press, Princeton University Press, Springer, Wiley, and World Scientific-Imperial College Press. Fair opening times:  - Monday 9 September 9:00 - 18:00  - Tuesday 10 September 9:00 - 18:00

  9. CERN scientific book fair 2010

    CERN Multimedia

    CERN Library

    2010-01-01

    The CERN Bookshop and CERN Library invite you to attend the 2010 CERN Book Fair, a two-day scientific event offering you the opportunity to meet key publishers and to browse and purchase books at significant discounts.   Some twelve companies will be present and will bring with them a selection of titles in physics, technology, mathematics, engineering, computing and popular science. You are welcome to come along and meet the publishers’ representatives or simply have a look to the books on offer. The Fair will take place in the Main Building (bldg. 500) on the ground floor near the Restaurant 1 on Tuesday 7th and Wednesday 8th September. Participating or represented publishers include: Cambridge University Press, EPFL Press – PPUR, Oxford University Press, Imperial College Press, McGraw-Hill, Oxford University Press, Pearson Education, Princeton University Press, Springer, Taylor and Francis, Wiley, World Scientific. Fair opening times: Tuesday 7 September 9:00 &ndash...

  10. Automated Metadata Formatting for Cornell’s Print-on-Demand Books

    Directory of Open Access Journals (Sweden)

    Dianne Dietrich

    2009-11-01

    Full Text Available Cornell University Library has made Print-On Demand (POD books available for many of its digitized out-of-copyright books. The printer must be supplied with metadata from the MARC bibliographic record in order to produce book covers. Although the names of authors are present in MARC records, they are given in an inverted order suitable for alphabetical filing rather than the natural order that is desirable for book covers. This article discusses a process for parsing and manipulating the MARC author strings to identify their various component parts and to create natural order strings. In particular, the article focuses on processing non-name information in author strings, such as titles that were commonly used in older works, e.g., baron or earl, and suffixes appended to names, e.g., "of Bolsena." Relevant patterns are identified and a Python script is used to manipulate the author name strings.

  11. Design of e-books: readers’ expectations in a comparative perspective

    Directory of Open Access Journals (Sweden)

    Josipa Selthofer

    2014-03-01

    Full Text Available The aim of the paper is to compare graphic elements used for the design of printed and electronic books. The paper focuses on four main graphic elements: book cover, typography, colour and image. Ten books published in printed and electronic form in Croatia between 2010 and 2012 were used as a research sample. The research methods used are visual content analysis and interviews. The research results indicate that e-books imitate the graphic design of a printed book in many aspects. The graphic elements of an e-book highly depend on the features of e-formats and on e-readers. The main advantages of an e-book are that they are searchable, adaptable, easily linked to other digital documents, transportable, easily accessible and durable. Still, in the second phase of the research, the majority of the interviewed participants stated that reading of an e-book was something new to them. They prefer the interaction with a printed book and its visual appearance.

  12. EM wave propagation analysis in plasma covered radar absorbing material

    CERN Document Server

    Singh, Hema; Rawat, Harish Singh

    2017-01-01

    This book focuses on EM propagation characteristics within multilayered plasma-dielectric-metallic media. The method used for analysis is impedance transformation method. Plasma covered radar absorbing material is approximated as a multi-layered dielectric medium. The plasma is considered to be bounded homogeneous/inhomogeneous medium. The reflection coefficient and hence return loss is analytically derived. The role of plasma parameters, such as electron density, collision frequency, plasma thickness, and plasma density profile in the absorption behavior of multi-layered plasma-RAM structure is described. This book provides a clearer picture of EM propagation within plasma. The reader will get an insight of plasma parameters that play significant role in deciding the absorption characteristics of plasma covered surfaces.

  13. Astronomical Books and Charts in the Book of Bibliographie Coreenne

    Science.gov (United States)

    Lee, Ki-Won; Yang, Hong-Jin; Park, Myeong-Gu

    2008-06-01

    We investigate astronomical materials listed in the book of Bibliographie Coréenne written by Maurice Courant. He classified ancient Korean books into nine Divisions (?) and thirty six Classes (?), and published them as three volumes (ranging from 1894 to 1896) and one supplement (in 1901). In total, 3,821 books including astronomical ones are listed together with information on physical size, possessional place, bibliographical note, and so forth. Although this book is an essential one in the field of Korea bibliography and contains many astronomical materials such as Cheon-Mun-Ryu-Cho ????, Si-Heon-Seo ??????, and Cheon-Sang-Yeol-Cha-Bun-Ya-Ji-Do ????????, it has not been well known to the public nor to astronomical society. Of 3,821 catalogues, we found that about 50 Items (?) are related to astronomy or astrology, and verified that most ! of them are located in the Kyujanggak Royal Library ???. We also found an unknown astronomical chart, Hon-Cheon-Chong-Seong-Yeol-Cha-Bun-Ya-Ji-Do ??????????. Because those astronomical materials are not well known to international astronomical community and there have been few studies on the materials in Korea, we here introduce and review them, particularly with the astronomical viewpoint.

  14. The English Book Club (or, The Book Lives On)

    CERN Multimedia

    2008-01-01

    The English Book Club was one of the first clubs to be founded at CERN. Since the late 1950s it has been a literary lifeline for English speakers in a predominantly French-speaking environment. The English Book Club has moved once again, and now has its home in Hut 564. Earlier lodgings included the fire station (remember "Fahrenheit 451") and the basement of Building 3, where it got flooded (shades of "Robinson Crusoe")."When people arrive in this country, they often feel a bit lost," explains Adam Park, who is in charge of the club’s communications. "Finding the club makes them feel at home. That’s why we have members from other international organisations, too." In the old days, of course, merely obtaining a book in English could be difficult. While it’s become much easier, thanks to specialty bookstores in Geneva, and of course the Internet, books remain an expensive item. For those looking for one of the great classics, th...

  15. Book by Book, College Libraries Pool Their Collected Wisdom

    Science.gov (United States)

    Wills, Eric

    2006-01-01

    The Orbis Cascade Alliance is a consortium of 35 college libraries in Washington State and Oregon which allows the libraries to pool their resources in pursuit of what librarians call collaborative collection development. In its scope and diversity, Orbis Cascade is unusual among groups of colleges that collaboratively buy and share books, with…

  16. Embroidery without tears [artists' book

    OpenAIRE

    Wood, Philippa

    2013-01-01

    Produced in response to the ‘call for entries’ exhibition theme POINT – curated by Emma Powell and Melanie Bush of ‘we love your books’, this altered book takes the subject of needlepoint as its basis. Working with a 1930s edition of Embroidery without Tears, this altered book explores the idea of the traditional sampler; pages are decorated with cross-stitched letterforms and decorative detailing. Phrases offering needlework advice to the embroiderer are rubber-stamped throughout the bo...

  17. Writing the Live Coding Book

    DEFF Research Database (Denmark)

    Cox, Geoff; Blackwell, Alan; Lee, Sang Wong

    2016-01-01

    This paper is a speculation on the relationship between coding and writing, and the ways in which technical innovations and capabilities enable us to rethink each in terms of the other. As a case study, we draw on recent experiences of preparing a book on live coding, which integrates a wide range...... of personal, historical, technical and critical perspectives. This book project has been both experimental and reflective, in a manner that allows us to draw on critical understanding of both code and writing, and point to the potential for new practices in the future....

  18. The web designer's idea book

    CERN Document Server

    Mcneil, Patrick

    Inspiring Web Design at a GlanceThe Web Designer's Idea Book includes more than 700 websites arranged thematically, so you can find inspiration for layout, color, style and more. Author Patrick McNeil has cataloged more than 5,000 sites on his website, and showcased in this book are the very best examples.Sites are organized by type, design style, theme, color, element and structure. Each chapter is easy to use and reference again and again, whether you're talking with a coworker or discussing website design options with a client. As a handy desk reference for design layout, color and style, t

  19. Covering walks in graphs

    CERN Document Server

    Fujie, Futaba

    2014-01-01

    Covering Walks  in Graphs is aimed at researchers and graduate students in the graph theory community and provides a comprehensive treatment on measures of two well studied graphical properties, namely Hamiltonicity and traversability in graphs. This text looks into the famous Kӧnigsberg Bridge Problem, the Chinese Postman Problem, the Icosian Game and the Traveling Salesman Problem as well as well-known mathematicians who were involved in these problems. The concepts of different spanning walks with examples and present classical results on Hamiltonian numbers and upper Hamiltonian numbers of graphs are described; in some cases, the authors provide proofs of these results to illustrate the beauty and complexity of this area of research. Two new concepts of traceable numbers of graphs and traceable numbers of vertices of a graph which were inspired by and closely related to Hamiltonian numbers are introduced. Results are illustrated on these two concepts and the relationship between traceable concepts and...

  20. book review:jiang yajun,world englishes:a metadisciplinary perspective

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    book reviewjiang yajun,world englishes:a metadisciplinary perspective.beijing:china social sciences prfess,2008.349pp.isbn-10:7500475799,isbn-13:9787500475798,paper cover.this book adopts the concept of paradigm from thomas kuhn to testify the world englishes (wes) research is a science under the applied linguistics,mainly focusing on the levels of the structure,the research method and the research topics in the wes disciplinary.

  1. [Analysis of images in Japanese book Fukusho-Kiran (Medical Book Focusing on Abdominal Palpation) and Fukusho-Kiran yoku (Supplement to Medical Book Focusing on Abdominal Palpation)].

    Science.gov (United States)

    Zhang, Lijun; DI, Kan; Song, Yuanliang

    2014-09-01

    Hukusyo-kiran (Medical Book Focusing on Abdominal Palpation) and Hukusyo-kiran yoku (Supplement to Medical Book Focusing on Abdominal Palpation) are two typical monographs of Fukushin (abdominal palpation), with a total of 148 images about abdominal palpation. These images can be divided into 5 kinds: locations, theories, techniques, diseases and medicines, with its own system covering the theories, principles, prescriptions and medicines of abdominal palpation. It can be used as a guide for clinicians to differentiate the locations and qualities of diseases, confirm the principles of treatment, guide the usage of medicines, and predict the prognosis, with the rather high theoretic and academic value, deserving further research and analysis for the modern scholars.

  2. Land Use and Land Cover - Montana Land Cover Framework 2013

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This statewide land cover theme is a baseline digital map of Montana's natural and human land cover. The baseline map is adapted from the Northwest ReGAP project...

  3. Brandon/Hill selected list of print books and journals in allied health.

    Science.gov (United States)

    Hill, Dorothy R; Stickell, Henry N

    2003-01-01

    This list of 434 books and 79 journals is intended as a selection guide for print literature to be used in a library supporting allied health educational programs or allied health personnel in either an academic or health care setting. Because of the impossibility of covering the large number of and wide variety of allied health professions and occupations, the recommended publications are focused primarily on the educational programs listed and recognized by the American Medical Association and other accrediting bodies. Books and journals are categorized by subject; the book list is followed by an author/editor index and the subject list of journals by an alphabetical title listing. Items suggested for initial purchase (169 books and 32 journals) are indicated by asterisks. To purchase the entire collection of books and journals (2002 subscriptions) would require an expenditure of about $36,744. The cost of only the asterisked items totals $14,465.

  4. The Evaluation of Scholarly Books as Research Output. Current Developments in Europe

    DEFF Research Database (Denmark)

    Giminez-Toledo, Elea; Mañana-Rodriguez, Jorge; Engels, Tim;

    2015-01-01

    The relevance and value of books in scholarly communication from both sides, the scholars who chose this format as a communication channel and the instances assessing the scholarly and scientific output is undisputed. Nevertheless, the absence of worldwide comprehensive databases covering the items...... and information needed for the assessment of this type of publication has urged several European countries to develop custom-built information systems for the registration of books, weighting procedures and funding allocation practices enabling a proper assessment of books and book-type publications....... For the first time, these systems make the assessment of books as a research output feasible. This paper resumes the main features of the assessment systems developed in five European countries / regions (Spain, Denmark, Flanders, Finland and Norway), focusing on the processes involved in the collection...

  5. 2010 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, Rachel [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2011-10-01

    This Renewable Energy Data Book for 2010 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced waterpower, hydrogen, renewable fuels, and clean energy investments.

  6. 2009 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2010-08-01

    This Renewable Energy Data Book for 2009 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced waterpower, hydrogen, renewable fuels, and clean energy investments.

  7. 2008 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    2009-07-01

    This Renewable Energy Data Book for 2008 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  8. Assessing Understanding through Reasoning Books

    Science.gov (United States)

    Roberts, Sally K.; Tayeh, Carla

    2010-01-01

    To focus on mathematical reasoning and what makes a good argument, the authors developed an assignment that requires college students to submit a book of mathematical reasoning as an assessment during the semester. To begin, the authors looked for questions and tasks that lend themselves to developing mathematical arguments and justifications and…

  9. Books That Made a Difference.

    Science.gov (United States)

    School Administrator, 1998

    1998-01-01

    Asked to identify one book that profoundly influenced their thinking, eight well-read superintendents recommended titles stressing learning and leadership themes. The list includes James Comer's "Waiting for a Miracle," Paulo Freire's "Pedagogy of the Oppressed," John Dewey's "Experience and Education," Antoine de…

  10. New Books for Industrial Educators

    Science.gov (United States)

    School Shop, 1975

    1975-01-01

    The most recent book releases in the field of industrial-technical education are listed alphabetically under: automotive/power mechanics; building trades; drafting; electricity/electronics; graphic arts, industrial arts, vocational, technical and career education; industrial mathematics; machine shop/metalworking; metrics; radio/television;…

  11. 2014 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Beiter, Philipp

    2015-11-01

    The Renewable Energy Data Book for 2014 provides facts and figures on energy and electricity use, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, marine and hydrokinetic power, hydrogen, renewable fuels, and clean energy investment.

  12. The Healthy Trail Food Book.

    Science.gov (United States)

    Miller, Dorcas S.

    An 800-mile canoe trip down a Canadian river provided the testing ground for the tenets of this trail food book. On the seven week expedition two pounds of food per person per day at a daily cost of $1.70 were carried. The only perishables were cheese, margarine, and onions. Recipes and menu ideas from that expedition are provided along with…

  13. The Middle School Recipe Book.

    Science.gov (United States)

    Robinson, Lynnette S., Comp.

    The purpose of this book is to provide activities, forms, and information to aid elementary and middle school counselors in improving services and programs for students. The materials included may also serve as an invaluable tool in assisting newly employed counselors in setting up their programs. This publication is organized in the format of the…

  14. Autonomous Learner Model Resource Book

    Science.gov (United States)

    Betts, George T.; Carey, Robin J.; Kapushion, Blanche M.

    2016-01-01

    "Autonomous Learner Model Resource Book" includes activities and strategies to support the development of autonomous learners. More than 40 activities are included, all geared to the emotional, social, cognitive, and physical development of students. Teachers may use these activities and strategies with the entire class, small groups, or…

  15. 2015 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Beiter, Philipp [National Renewable Energy Lab. (NREL), Golden, CO (United States); Tian, Tian [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-11-01

    The Renewable Energy Data Book for 2015 provides facts and figures on energy and electricity use, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, marine and hydrokinetic power, hydrogen, renewable fuels, and clean energy investment.

  16. 2015 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Beiter, Philipp; Tian, Tian

    2016-11-01

    The 2015 Renewable Energy Data Book provides facts and figures on energy and electricity use, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, marine and hydrokinetic power, hydrogen, renewable fuels, and clean energy investment.

  17. 2011 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    R. Gelman

    2013-02-01

    This Renewable Energy Data Book for 2011 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  18. 2014 Renewable Energy Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Beiter, Philipp [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-11-15

    The Renewable Energy Data Book for 2014 provides facts and figures on energy and electricity use, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, marine and hydrokinetic power, hydrogen, renewable fuels, and clean energy investment.

  19. Cutting edge intermediate : student's book

    CERN Document Server

    Cunningham, Sarah

    2004-01-01

    A focus on high-frequency useful vocabulary helps students say what they want to say. Regular, well-structured speaking tasks encourage students to express themselves more extensively and fluently. ‘Do You Remember’ sections in every unit and extra. Consolidation modules provide regular review and consolidation Student Books include Mini-Dictionary to help learners study independently.

  20. Open Book Professional Accountancy Examinations

    Science.gov (United States)

    Rowlands, J. E.; Forsyth, D.

    2006-01-01

    This article describes the structure and rationale for an open-book approach in professional accountancy examinations. The concept of knowledge management and the recognition that some knowledge ought to be embedded in the minds of professional accountants while other knowledge ought to be readily accessible and capable of application forms the…

  1. Japanese Basic Course: Exercise Book.

    Science.gov (United States)

    Defense Language Inst., Washington, DC.

    This exercise book, prepared for use after Lesson 121 of the Defense Language Institute Basic Course in Japanese, provides for instruction in the use of Kanji dictionaries, familiarizes students with useful phrases and expressions that are not included in the Basic Course, and allows for greater variety in the classroom. The ten lessons, in the…

  2. Book Review: The Software IP Detective's Handbook: Measurement, Comparison, and Infringement Detections

    Directory of Open Access Journals (Sweden)

    Diane Barrett

    2012-03-01

    Full Text Available Zeidman, B. (2011. The Software IP Detective's Handbook: Measurement, Comparison, and Infringement Detection. Boston, MA: Pearson Education, Inc. 480 pages, ISBN-10: 0137035330;ISBN-13: 978-0137035335, US$49.99.Reviewed by Diane Barrett, American Military University.Do not the book title fool you into thinking that the book is only for those looking to detect software infringement detection. It is a comprehensive look at software intellectual property. The book covers a wide range of topics and has something to offer for just about everyone from lawyers to programmers.(see PDF for full review

  3. iBooks Author For Dummies

    CERN Document Server

    Gruman, en

    2012-01-01

    Design and create your own e-book using the groundbreaking iBooks Author app With Apple's iBooks Author app, you can create rich, interactive books for use on the iPad, and this new For Dummies handy portable guide shows you just how to do it. Whether you want to create textbooks, training materials, marketing reports, or awesome product manuals with dynamic content, this book takes you through the process. Plunge in, and you'll soon learn how to create an iPad e-book with all the bells and whistles, including video, interactive widgets, text, tables, figures, colors, cool fonts, and more. Hel

  4. E-books in academic libraries

    CERN Document Server

    Mincic-Obradovic, Ksenija

    2010-01-01

    Written from the perspective of a librarian, this book offers a comprehensive overview of the impact of e-books on academic libraries. The author discusses advantages to both researchers and librarians and provides current examples of innovative uses of e-books in academic contexts. This book reviews the current situation in e-book publishing, and describes problems in managing e-books in libraries caused by the variety of purchase models and varying formats available, and the lack of standardisation. It discusses solutions for providing access and maintaining bibliographic control, looks at v

  5. Allegheny County Land Cover Areas

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The Land Cover dataset demarcates 14 land cover types by area; such as Residential, Commercial, Industrial, Forest, Agriculture, etc. If viewing this description on...

  6. Allegheny County Land Cover Areas

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The Land Cover dataset demarcates 14 land cover types by area; such as Residential, Commercial, Industrial, Forest, Agriculture, etc. If viewing this description...

  7. Space Constrained Dynamic Covering

    CERN Document Server

    Antonellis, Ioannis; Dughmi, Shaddin

    2009-01-01

    In this paper, we identify a fundamental algorithmic problem that we term space-constrained dynamic covering (SCDC), arising in many modern-day web applications, including ad-serving and online recommendation systems in eBay and Netflix. Roughly speaking, SCDC applies two restrictions to the well-studied Max-Coverage problem: Given an integer k, X={1,2,...,n} and I={S_1, ..., S_m}, S_i a subset of X, find a subset J of I, such that |J| <= k and the union of S in J is as large as possible. The two restrictions applied by SCDC are: (1) Dynamic: At query-time, we are given a query Q, a subset of X, and our goal is to find J such that the intersection of Q with the union of S in J is as large as possible; (2) Space-constrained: We don't have enough space to store (and process) the entire input; specifically, we have o(mn), sometimes even as little as O((m+n)polylog(mn)) space. The goal of SCDC is to maintain a small data structure so as to answer most dynamic queries with high accuracy. We present algorithms a...

  8. Communication, Control, and Computer Access for Disabled and Elderly Individuals. ResourceBook 4: Update to Books 1, 2, and 3.

    Science.gov (United States)

    Borden, Peter A., Ed.; Vanderheiden, Gregg C., Ed.

    This update to the three-volume first edition of the "Rehab/Education ResourceBook Series" describes special software and products pertaining to communication, control, and computer access, designed specifically for the needs of disabled and elderly people. The 22 chapters cover: speech aids; pointing and typing aids; training and communication…

  9. Book review: Organisational behaviour: A contemporary South African perspective

    Directory of Open Access Journals (Sweden)

    Andrew Thatcher

    2004-10-01

    Full Text Available Authors: Helen Schultz (Ed., Jeffrey Bagraim, Tracy Potgieter, Conrad Viedge, Amanda Werner Publisher: Van Schaik Publishers According to the authors the aim of this book is to present an interdisciplinary approach to the understanding of organisational behaviour within the contemporary South African environment. Within this framework, the book targets (senior undergraduate and postgraduate students in Industrial/Organisational Psychology and Human Resources Management. The text is written in a simple, conversational style (as was the intention of the authors that should be suitable for most undergraduate students at English-speaking tertiary institutions. The book is organised into three sections based on a model of four components of organizational behaviour: the individual, the group and the organisation. The fourth component of the model, the environment, refers specifically in the context of this book, to a contemporary South African approach to understanding behaviour in organisations. In the ‘individual’ section, the authors cover topics such as individual differences (e.g. personality, attitudes, perceptions, emotional intelligence, etc., ethics, work motivation, and performance management. In the ‘group’ section, the authors look at issues of group and team dynamics, power and empowerment, communication, decision-making and leadership. Finally, in the ‘organisation’ section, the authors address issues of contemporary organisational design, organisational change and employee well-being (e.g. stress management, job satisfaction, etc..

  10. On L-injective Covers

    Institute of Scientific and Technical Information of China (English)

    周德旭

    2004-01-01

    We use the class of L-injective modules to define L-injective covers, and provide the characterizations of L-injective covers by the properties of kernels of homomorphisms. We prove that the right L-noetherian right L-hereditary ring is just such that every right R-module has an L-injective cover which is monic. We also use kernels of homomorphisms to investigate L-simple L-injective covers and give some constructions ofL-simple L-iniective covers.

  11. 'Container' at London Art Book Fair

    OpenAIRE

    Bottle, Ian; Dargan, John; Mcdonald, Rob; Malone, Andy; McCormack, Tania

    2014-01-01

    Artist collective exhibiting artists' books and multiples. A group of artists from different disciplinary backgrounds with a common interest in developing ideas through examining what a book can be or represent, from sequential narrative to sculptural form.

  12. Catalogue of Korean manuscripts and rare books

    DEFF Research Database (Denmark)

    Lerbæk Pedersen, Bent

    2014-01-01

    Catalogue of Korean manuscripts and rare books in The Royal Library, Copenhagen and the National Museum of Denmark......Catalogue of Korean manuscripts and rare books in The Royal Library, Copenhagen and the National Museum of Denmark...

  13. Stig Brøgger's Artists' Books

    DEFF Research Database (Denmark)

    Ørum, Tania; Hvis Kromann, Thomas

    Introduction and presentation of the many artist's books made by the Danish artist Stig Brøgger......Introduction and presentation of the many artist's books made by the Danish artist Stig Brøgger...

  14. Overview of the INEX 2008 Book Track

    Science.gov (United States)

    Kazai, Gabriella; Doucet, Antoine; Landoni, Monica

    This paper provides an overview of the INEX 2008 Book Track. Now in its second year, the track aimed at broadening its scope by investigating topics of interest in the fields of information retrieval, human computer interaction, digital libraries, and eBooks. The main topics of investigation were defined around challenges for supporting users in reading, searching, and navigating the full texts of digitized books. Based on these themes, four tasks were defined: 1) The Book Retrieval task aimed at comparing traditional and book-specific retrieval approaches, 2) the Page in Context task aimed at evaluating the value of focused retrieval approaches for searching books, 3) the Structure Extraction task aimed to test automatic techniques for deriving structure from OCR and layout information, and 4) the Active Reading task aimed to explore suitable user interfaces for eBooks enabling reading, annotation, review, and summary across multiple books. We report on the setup and results of each of these tasks.

  15. Comparing Safari Tech Books Online and Books24x7 E-Book Collections: A Case Study from the University of British Columbia Library

    Science.gov (United States)

    Barsky, Eugene; Schattman, Lisa; Greenwood, Aleteia

    2009-01-01

    Most academic libraries are seeking to provide electronic access to the very dynamic and changing field of technology related material. "Safari Tech Books Online" and "Books24x7" are the major e-book collections in this area. We compared the "Safari Tech Books Online" and "Books24x7" e-book packages as to their usefulness for the University of…

  16. E-book perception of Croatian students

    Directory of Open Access Journals (Sweden)

    Boris Badurina

    2016-02-01

    Full Text Available The aim of this paper is to try to answer the question of students’ perception of e-book considering different forms of e-books students might have experience with. Questions of defining the e-book and attitudes toward e-book are considered separately. Research conducted by online questionnaire on student population show that the experience that students have with e-books mainly consists of pdf versions of printed books. Devices used for reading e-books are mainly desktop computers or laptops or in smaller degree tablets. E-readers are almost not used at all since the ownership of the e-readers among students is almost non-existent. That level of e-book experience influences students’ definition of e-book. Students mainly consider an e-book to be electronic version of printed book that is read on a computer. Considering the content that student mostly read on e-books it’s mainly scientific literature or exam materials. Fiction is almost exclusively read on paper. Given the choice of type of book students would in both cases rather chose paper, although in case of scientific literature and exam materials they are more open to e-books. Factor analysis was used to analyse characteristic that students recognize in e-books and result show three independent factors: Usefulness and practicality, Reading experience and Accessibility. Usefulness and practicality and accessibility was rated positively and reading experience negatively. These results are expected considering that students mostly read e-books on computers and not on dedicated reading devices.

  17. Trends in Books Publication in Pakistan

    OpenAIRE

    Mustafa, Khawaja; Shah, Syed Attaullah

    2007-01-01

    Abstract: Writing and Publishing books in Pakistan is a complex undertaking; and to a large extent devoid of monetary gain. An average 1200 books were published annually during five year period from 2001 to 2005. Most books were published on Islam, Pakistan, Literature, and History. The Social Sciences, Humanities, Science and Technology are more or less been neglected by the Pakistani Authors Strong areas in Authorship: a) Books on Islam were the most favo...

  18. Books and Marshall McLuhan

    Science.gov (United States)

    Neill, Sam

    1971-01-01

    Marshall McLuhan, who has gained a reputation as an enemy of books is, in fact, a man of the book as any librarian. In tracing the evidence of McLuhan's concern for the future of the book, we can see him as one who has, perhaps, a greater perception of the value of books and libraries for civilization, than many librarians. (31 references)…

  19. History of neurologic examination books.

    Science.gov (United States)

    Boes, Christopher J

    2015-04-01

    The objective of this study was to create an annotated list of textbooks dedicated to teaching the neurologic examination. Monographs focused primarily on the complete neurologic examination published prior to 1960 were reviewed. This analysis was limited to books with the word "examination" in the title, with exceptions for the texts of Robert Wartenberg and Gordon Holmes. Ten manuals met the criteria. Works dedicated primarily to the neurologic examination without a major emphasis on disease description or treatment first appeared in the early 1900s. Georg Monrad-Krohn's "Blue Book of Neurology" ("Blue Bible") was the earliest success. These treatises served the important purpose of educating trainees on proper neurologic examination technique. They could make a reputation and be profitable for the author (Monrad-Krohn), highlight how neurology was practiced at individual institutions (McKendree, Denny-Brown, Holmes, DeJong, Mayo Clinic authors), and honor retiring mentors (Mayo Clinic authors).

  20. Big Book of Apple Hacks

    CERN Document Server

    Seibold, Chris

    2008-01-01

    Bigger in size, longer in length, broader in scope, and even more useful than our original Mac OS X Hacks, the new Big Book of Apple Hacks offers a grab bag of tips, tricks and hacks to get the most out of Mac OS X Leopard, as well as the new line of iPods, iPhone, and Apple TV. With 125 entirely new hacks presented in step-by-step fashion, this practical book is for serious Apple computer and gadget users who really want to take control of these systems. Many of the hacks take you under the hood and show you how to tweak system preferences, alter or add keyboard shortcuts, mount drives and

  1. Two books History of Cartography

    Directory of Open Access Journals (Sweden)

    Mirko Husak

    2013-12-01

    Full Text Available Two valuable books were published under the title History of Cartography in the group Lecture Notes and the subgroup Publications of the International Cartographic Association. The books were published as a result of collaboration between International Cartographic Association (ICA and the Springer-Verlag publishing company and contain most papers from the following symposia:3rd International Symposium of the ICA Commission on the History of Cartography at University of Texas in Arlington, October 11–12, (URL 1 with the theme Charting the Cartography of Chartered Companies and4th International Symposium of the ICA Commission on the History of Cartography, at Eötvös Loránd University in Budapest, Hungary, June 28–29, 2012 (URL 2 with the theme Exploration – Discovery – Cartography.

  2. BOOK-SHELF%书架

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    As one of the rare books on Korean contemporary art in the English language, Korean Eye, following the eponymous and hugely successful exhibition in London, aims at providing a repre- sentative overview of 75 Korean contemporary artists and their works to an international audience.%①《韩国之眼:韩国当代艺术》KOREAN EYE:CONTEMPORARYKOREAN ART塞雷内拉·西克利塔编,Skira Editore出版社,2010年,386页,英文Serenella Ciclitira ed.,Skira Editore,2010,386 pp.,EnglishAs one of the rare booKS on Koreancontemporary art in the English language,

  3. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  4. International waste management fact book

    Energy Technology Data Exchange (ETDEWEB)

    Amaya, J P; LaMarche, M N; Upton, J F

    1997-10-01

    Many countries around the world are faced with nuclear and environmental management problems similar to those being addressed by the US Department of Energy. The purpose of this Fact Book is to provide the latest information on US and international organizations, programs, activities and key personnel to promote mutual cooperation to solve these problems. Areas addressed include all aspects of closing the commercial and nuclear fuel cycle and managing the wastes and sites from defense-related, nuclear materials production programs.

  5. Engaging Young Writers through Book Design

    Science.gov (United States)

    Brown, Susannah; Towell, Janet Leigh

    2015-01-01

    Creative book design connects learning in visual arts and language arts. Explore the benefits of bookmaking and specific steps to create a variety of book formats with children. Examples of imaginative books, such as accordion, flip, paper bag, and pop-up, are shared.

  6. LET BOOKS BE OUR GOOD FRIENDS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Books are our friends because they are bridges to knowledge. Knowledge isvaluable because it enriches our life and brings us happiness.Almost all great men in the history of mankind loved books. We have every reason to believe it is the knowledge in books that led them to success.

  7. Book Ownership and Young Children's Learning

    Science.gov (United States)

    Tadesse, Selamawit; Washington, Patsy

    2013-01-01

    Research indicates that there are positive effects when young children read and explore books for pleasure, as such activities help build the skills and knowledge that are critical to schooling. Reading for pleasure is facilitated when children have access to books in their own homes. There are great variations in children's book ownership…

  8. The 11th Beijing International Book Fair

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ Adhering to the principle of "ush ering world books into China,introducing Chinese books to the world", the size of Beijing International Book Fair has seen constant expansion, international position undergoing continuous upgrading and its influence becoming increasingly profound since the first Fair was held in 1986.

  9. The 11th Beijing International Book Fair

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

      Adhering to the principle of "ush ering world books into China,introducing Chinese books to the world", the size of Beijing International Book Fair has seen constant expansion, international position undergoing continuous upgrading and its influence becoming increasingly profound since the first Fair was held in 1986.……

  10. Princess Picture Books: Content and Messages

    Science.gov (United States)

    Dale, Lourdes P.; Higgins, Brittany E.; Pinkerton, Nick; Couto, Michelle; Mansolillo, Victoria; Weisinger, Nica; Flores, Marci

    2016-01-01

    Because many girls develop their understanding of what it means to be a girl from books about princesses, the researchers coded the messages and content in 58 princess books (picture, fairy tales, and fractured fairy tales). Results indicate that gender stereotypes are present in the books--the princesses were more likely to be nurturing, in…

  11. Books in Action: The Armed Services Editions.

    Science.gov (United States)

    Cole, John Y., Ed.

    In an effort to reach a wide audience, the Center for the Book in the Library of Congress presents this book in honor of the 40th anniversary celebration of the Armed Services Editions (ASE), the paperback books distributed during World War II. The titles of the essays and their authors are as follows: "The Armed Services Editions: An…

  12. Young Children, National Tragedy, and Picture Books.

    Science.gov (United States)

    McMath, Joan S.

    1997-01-01

    Suggests that, rather than exposing young children to media coverage of national tragedies and disasters, caregivers should read aloud to children from picture books that convey stability, calmness, and reassurance. Includes tips for helping children cope with tragedy, guidelines for selecting books, and an annotated list of 25 books that can help…

  13. Electronic Study Books and learning style

    NARCIS (Netherlands)

    De Diana, I.P.F.; Heiden, van der G.

    1994-01-01

    Attention has been drawn to the concepts of Electronic Books and Electronic Study Books. Several publications have discussed some main ideas (paradigms) for both concepts. For the Electronic Study Book as a learning environment, it is essential to consider individual modes of learning, usually terme

  14. One Book, One Community: One Great Idea

    Science.gov (United States)

    Dempsey, Beth

    2009-01-01

    In 1998, Nancy Pearl and Chris Higashi, librarians working in the Washington Center for the Book at the Seattle Public Library (SPL), had a brainstorm. Challenged with a grant to develop new audiences for literature, they were intrigued with the power of books to unite diverse audiences. With that in mind, they expanded the book club concept to…

  15. Exploring Ethics through Children's Literature. Book 2.

    Science.gov (United States)

    Saenger, Elizabeth Baird

    Designed to improve the rigor and clarity of children's reasoning about ethical issues, this book provides a practical, down-to-earth, discussion-based approach to teaching ethics to fourth- through sixth-grade children. The book provides stories, lesson plans, questioning strategies, guidance on using children's books for ethics lessons, and a…

  16. Exploring Ethics through Children's Literature. Book 1.

    Science.gov (United States)

    Saenger, Elizabeth Baird

    Designed to improve the rigor and clarity of children's reasoning about ethical issues, this book provides a practical, down-to-earth, discussion-based approach to teaching ethics to second- and third-grade children. The book provides stories, lesson plans, questioning strategies, guidance on using children's books for ethics lessons, and a…

  17. Book Review: Infrastructure for Asian Connectivity

    OpenAIRE

    Sandee, Henry

    2013-01-01

    This article reviews the book Infrastructure for Asian Connectivity edited by Bhattacharyay, Kawai and Nag (2012). This book is the second publication coordinated by the ADB and the ADB Institute focusing on infrastructure and connectivity in Asian countries. This book looks at regional (across border) infrastructure that is needed to facilitate growth and development through better connectivity and integration among countries.

  18. Best Books for Young Adults. Second Edition.

    Science.gov (United States)

    Carter, Betty

    This book presents an annotated listing of the Young Adult Library Services Association's "Best Books for Young Adults" (BBYA) from 1966-99. Selected books are listed in topical bibliographies under the following subjects: Too Good To Miss; Adventure; Animals; Family; Fantasy; Friendship; Historical Fiction; The Holocaust; Humor;…

  19. Using collaborative filtering in social book search

    NARCIS (Netherlands)

    Huurdeman, H.; Kamps, J.; Koolen, M.; van Wees, J.

    2012-01-01

    In this paper we describe our participation in INEX 2012 in the Social Book Search Track and the Linked Data Track. For the Social Book Search Track we compare the impact of query- and user-independent popularity measures and recommendations based on user profiles. Book suggestions are more than jus

  20. Gimme That E-Book Religion

    Science.gov (United States)

    Pace, Andrew

    2005-01-01

    The debate on the efficacy of electronic books involves issues of fair use, digital rights management, preservation, and perpetual ownership. Nevertheless, our intense focus on these areas has distracted us from one of the most important aspects of content pluralism? namely, e-book relationships to book distributors. This article discusses E-books…

  1. Electronic Books: A Review and Evaluation.

    Science.gov (United States)

    Rao, Siriginidi Subba

    2003-01-01

    Discusses electronic books and derives a comprehensive definition. Lists various types of e-books, their characteristics, pros and cons, and compares e-books reader hardware and software with their specifications and characteristics. Considers the publishing industry, impact on libraries, and digital rights management. (Author/LRW)

  2. Teaching the Social History of the Book

    Science.gov (United States)

    Meiman, Meg

    2006-01-01

    Teaching book history as the story of its development as an artifact is undoubtedly important. However, placing that history more prominently within the social contexts of reading and libraries seems crucial to one's understanding of book history, since books are both the continuing means of social practices (such as reading), and since they…

  3. Book Review: English Language Learning and Technology

    OpenAIRE

    Shojaei, Abouzar; Motallebzadeh, Khalil

    2016-01-01

    This book is a very helpful book which gives us information and knowledge of using technology in language learning and teaching. It contains detailed consideration to articulatory and auditory Language learning as well as to the practicalities of English language learning. The book discusses the relationship between English language learning and technology. 

  4. Representations of Science within Children's Trade Books

    Science.gov (United States)

    Ford, Danielle J.

    2006-01-01

    The use of trade books in science instruction, particularly in the elementary and middle school grades, invites scrutiny into the ways in which trade books represent science and its practitioners to learners. Forty-four trade books were examined for their explicit and implicit representations of science. The majority of the sample was comprised of…

  5. Magnet Trade Books: Attracting and Repelling Concepts

    Science.gov (United States)

    Barrow, Lloyd H.; Robinson, Richard D.

    2007-01-01

    A series of magnet trade books were analyzed against a validated list of magnet concepts (Barrow, 1990a) and their Flesch (1974) Readability was determined. These trade books were used to supplement a second grade unit on magnetism locally constructed from AIM's "Mostly Magnets" (1991). All trade books accurately described how like and unlike…

  6. Mediatheorie van het e-book

    NARCIS (Netherlands)

    Mulder, Arjen

    2017-01-01

    abstractDeparting from Marshal McLuhan’s analysis of the impact of print books on the mental and social environment of readers, Arjen Mulder reflects on the possible mental and social effects of the e-book as a new medium. The e-book, as carrier of an immaterial text, allows the reader to change its

  7. Overview of the INEX 2009 Book Track

    NARCIS (Netherlands)

    Kazai, G.; Doucet, A.; Koolen, M.; Landoni, M.; Geva, S.; Kamps, J.; Trotman, A.

    2009-01-01

    This paper provides an overview of the INEX 2009 Book Track. The main goal of the track is to evaluate approaches for supporting users in reading, searching, and navigating the full texts of digitized books. The investigation is focused around four tasks: 1) the Book Retrieval task aims at comparing

  8. Violent Comic Books Influence Relational Aggression.

    Science.gov (United States)

    Kirsh, Steven J.; Olczak, Paul V.

    This paper assesses the impact that reading violent comic books has on hostile attributional bias using relationally aggressive scenarios. College students (N=85) read either very violent or mildly violent comic books. Participants rated the comic books on levels of violence, humor, interest level, and overall likeability. They also read five…

  9. Inspired at a book fair

    CERN Multimedia

    Anaïs Schaeffer

    2012-01-01

    During the Frankfurt book fair last October, the CERN stand drew quite the crowd. Director-General Rolf Heuer was there to promote CERN’s mission and the "LHC: the Large Hadron Collider" book. He met a lot of visitors and for one of them there was also a nice follow-up…   Marcus and his father visiting the LINAC facility. Fifteen year-old Marcus lives in Lauterecken near Frankfurt. The popular book fair last autumn was for him a nice opportunity to get in touch with the CERN environment. Inspired by the stand and what the CERN people were describing, he started to ask more and more questions… So many, that Rolf Heuer decided to invite him to come to CERN and find out some of the answers for himself. A few weeks later, while recovering from an exciting visit to the ATLAS underground cavern and other CERN installations with a cup of tea in Restaurant 1, Marcus shared his enthusiasm about the Organization: “When I was younger, my moth...

  10. BOOK

    Institute of Scientific and Technical Information of China (English)

    刘丹

    2008-01-01

    <正> 《忽而今夏》这里有好多你熟悉的情节,熟悉的画面。纯净得让人嫉妒的青春岁月,有一种感觉--每个人心里都有一个叫"章远"的男孩--在我们最意气风发青春年华的时候。这个球场上的男孩,格子衬衫、颀长的身影,优美的侧脸弧线,曾经定格在多少人心中。最常出现的画面,是车厢里立着的一对少年,光影从少年英俊的面孔一掠而过。流动的光影,急驶的列车,仿佛时间般一去不回。在青春的尾巴上来看这么一部小说远比身在此山中的当时当地来得通透和深刻,"因为懂得所以慈悲"隔着那么长的漫漫流年看当初的少年世界,就像在某个阴郁的午后,听小野丽莎唱"Historia De Un Amor"不是不缱绻怀念,只是明白那些面目模糊纯真美好的日子终将一去不复返,只留下些许回忆在阳光中如轻尘飞舞,让人无端端想起梦想照进现实。每颗心,都是一座城。双城的距离,比不过两颗心的距离。一段跨越十年,分分合合的感情——这是小说的文案,一个关乎初恋和成长的故事。16岁的何洛爱上章远,她说我爱过的男孩,有世界上最英俊的侧脸。那些清亮如水对着遥不可知的未来仍能微笑憧憬的日子,不明白青春终将要落幕,所以肆意挥霍,所以为爱痴狂。像所有年少

  11. Books

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    蚯蚓创业记作者:汤姆·萨基译者:王哲出版社:中国人民大学出版社 2011年10月定价:25.00元[内容简介]垃圾也能赚钱?而且是多头赚钱?这是不是天方夜谭?不错,这个想法听上去确实有点异想天开,但是汤姆·萨基却创造了这样的奇迹,把它变成了现实!本书讲的就是这位大一的学生如何变废为宝、如何创业的故事。

  12. Books

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    看懂中国贫富差距[内容简介]贫富差距恶化有可能割裂社会,这是中国面悔的最大威胁。如何缩小贫富差距,改变我们的收入分配?本书以通俗晓畅的风格.客观分析与解读近年来的经济热点.对中国当前经济系统进行再思考、再讨论、再判断。

  13. BOOK REVIEW: Introduction to Computational Plasticity

    Science.gov (United States)

    Hartley, P.

    2006-04-01

    . Chapter two introduces one of several yield criteria, that normally attributed to von Mises (though historians of mechanics might argue over who was first to develop the theory of yielding associated with strain energy density), and its two or three-dimensional representation as a yield surface. The expansion of the yield surface during plastic deformation, its translation due to kinematic hardening and the Bauschinger effect in reversed loading are described with a direct link to the material stress-strain curve. The assumption, that the increment of strain is normal to the yield surface, the normality principle, is introduced. Uniaxial loading of an elastic-plastic material is used as an example in which to develop expressions to describe increments in stress and strain. The full presentation of numerous expressions, tensors and matrices with a clear explanation of their development, is a recurring, and commendable, feature of the book, which provides an invaluable introduction for those new to the subject. The chapter moves on from time-independent behaviour to introduce viscoplasticity and creep. Chapter three takes the theories of deformation another stage further to consider the problems associated with large deformation in which an important concept is the separation of the phenomenon into material stretch and rotation. The latter is crucial to allow correct measures of strain and stress to be developed in which the effects of rigid body rotation do not contribute to these variables. Hence, the introduction of 'objective' measures for stress and strain. These are described with reference to deformation gradients, which are clearly explained; however, the introduction of displacement gradients passes with little comment, although velocity gradients appear later in the chapter. The interpretation of different strain measures, e.g. Green--Lagrange and Almansi, is covered briefly, followed by a description of the spin tensor and its use in developing the objective

  14. BOOK REVIEW: Partial Differential Equations in General Relativity

    Science.gov (United States)

    Halburd, Rodney G.

    2008-11-01

    Although many books on general relativity contain an overview of the relevant background material from differential geometry, very little attention is usually paid to background material from the theory of differential equations. This is understandable in a first course on relativity but it often limits the kinds of problems that can be studied rigorously. Einstein's field equations lie at the heart of general relativity. They are a system of partial differential equations (PDEs) relating the curvature of spacetime to properties of matter. A central part of most problems in general relativity is to extract information about solutions of these equations. Most standard texts achieve this by studying exact solutions or numerical and analytical approximations. In the book under review, Alan Rendall emphasises the role of rigorous qualitative methods in general relativity. There has long been a need for such a book, giving a broad overview of the relevant background from the theory of partial differential equations, and not just from differential geometry. It should be noted that the book also covers the basic theory of ordinary differential equations. Although there are many good books on the rigorous theory of PDEs, methods related to the Einstein equations deserve special attention, not only because of the complexity and importance of these equations, but because these equations do not fit into any of the standard classes of equations (elliptic, parabolic, hyperbolic) that one typically encounters in a course on PDEs. Even specifying exactly what ones means by a Cauchy problem in general relativity requires considerable care. The main problem here is that the manifold on which the solution is defined is determined by the solution itself. This means that one does not simply define data on a submanifold. Rendall's book gives a good overview of applications and results from the qualitative theory of PDEs to general relativity. It would be impossible to give detailed

  15. E-Books and E-Book Apps: Considerations for Beginning Readers

    Science.gov (United States)

    Bates, Celeste C.; Klein, Adria; Schubert, Barbara; McGee, Lea; Anderson, Nancy; Dorn, Linda; McClure, Erin; Ross, Rachael Huber

    2017-01-01

    This article highlights considerations for teachers when selecting and using e-books and e-book applications (apps) with beginning readers during guided and independent reading. A framework for examining e-books and e-book apps is suggested, and several apps and related digital features are described. The article also includes an overview of…

  16. Translation Ecology Analysis of The Book of Songs & Book of Poetry

    Institute of Scientific and Technical Information of China (English)

    毕蕾

    2013-01-01

    Shi Jing is the necessary reference book about Chinese literature. Waley’s the Book of Songs and Xu Yuanchong’s Book of Poetry are two excellent reference books. So, this paper hopes to find a new way to analyze the two versions. This paper will use the theory to analyze and compare the two translation works on the perspective of translation ecology.

  17. Outstanding Science Trade Books for Students K-12 (Books Published in 2009)

    Science.gov (United States)

    Science Teacher, 2010

    2010-01-01

    What makes an outstanding book for a young reader? Although it would be hard to create a rubric for every book, experienced teachers recognize them quickly. They fascinate and captivate with both their content and style. Award-winning trade books inspire young readers to want more... more information, more books, more inquiry, more science. The…

  18. A Study on Reading Printed Books or E-Books: Reasons for Student-Teachers Preferences

    Science.gov (United States)

    Tosun, Nilgun

    2014-01-01

    This study tried to determine the preferences of student-teachers on reading printed books or e-books and the reasons for these preferences. Reading printed books and e-books preferences of students are discussed in terms of gender and department variables. 258 student-teachers who are studying in Computer Education and Instructional Technologies…

  19. Reading Engagement: A Comparison between E-Books and Traditional Print Books in an Elementary Classroom

    Science.gov (United States)

    Jones, Troy; Brown, Carol

    2011-01-01

    Electronic books (e-books) are gaining popularity for personal reading. Options for access to a large selection of book titles and "anytime/anywhere" reading choices have added to the increased use of e-books. For this study, 22 third-grade students completed satisfaction surveys and reading comprehension tests on three separate reading…

  20. BOOK REVIEW: Universe or Multiverse?

    Science.gov (United States)

    Trimble, Virginia

    2008-11-01

    More than 2000 years ago, Epicurus taught that there are an infinite number of other worlds, both like and unlike ours, and Aristotle taught that there are none. Neither hypothesis can currently be falsified, and this issue of potential for falsification (that is testability) goes to the heart of many of the chapters in Carr's book. All but one of the 27 chapters, provided by 27 pundits (almost but not quite a one-to-one mapping) are written versions of talks given at one of three meetings, held between 2001 and 2005 at Stanford and Cambridge Universities and partly sponsored by the Templeton Foundation. Every reader will surely find some chapters interesting and informative, some provocative, and some rather vacuous. These will not be the same chapters for all readers. Two 'conflict of interest' statements: first, I spoke at one of these meetings, but was not one of those asked to provide a chapter. And, second, the first time I suggested in a lecture for scientists that 'many universes, either in temporal succession or embedded in higher dimensional space' was a possible explanation of the habitability of ours was fall 1974, shortly after Brandon Carter's first paper on anthropic principles and explanations, but before Bernard Carr and Martin Rees's 1979 Nature paper, which presented all the anthropic arguments then known and divided them into numbers that required no additional physics beyond the four standard forces (like the number of particles in a star) and those that seemed essential for life but not calculable (like the ratio of the electromagnetic to nuclear force constant). My other three possibilities were 'G.d has been very careful' (now called intelligent design), additional physics to be learned, and shear complexity. The core multiverse concept is that our universe (the 4-dimensional spacetime with which we are or could be connected and all its contents) is one of many, perhaps infinitely many, probably with different values of the constants of

  1. Design issues in the production of hyper-books and visual-books

    Directory of Open Access Journals (Sweden)

    Nadia Catenazzi

    1993-12-01

    Full Text Available This paper describes an ongoing research project in the area of electronic books. After a brief overview of the state of the art in this field, two new forms of electronic book are presented: hyper-books and visual-books. A flexible environment allows them to be produced in a semi-automatic way starting from different sources: electronic texts (as input for hyper-books and paper books (as input for visual-books. The translation process is driven by the philosophy of preserving the book metaphor in order to guarantee that electronic information is presented in a familiar way. Another important feature of our research is that hyper-books and visual-books are conceived not as isolated objects but as entities within an electronic library, which inherits most of the features of a paper-based library but introduces a number of new properties resulting from its non-physical nature.

  2. MacBook Pro Portable Genius

    CERN Document Server

    Miser, Brad

    2012-01-01

    Discover loads of tips and techniques for the newest MacBook Pro You're already ahead of the game with a MacBook Pro. Now you can get even more out the popular Apple notebook with the new edition of this handy, compact book. Crammed with savvy insights and tips on key tools and shortcuts, this book will help you increase your productivity and keep your Apple digital lifestyle on track. From desktop sharing and wireless networking to running Windows applications, this book avoids fluff, doesn't skimp on the essentials, saves you time and hassle, and shows you what you most want to know. Include

  3. BOOK REVIEW: Light, Visible and Invisible and its Medical Applications

    Science.gov (United States)

    Newing, Angela

    2000-09-01

    This book is based on various lectures given by Professor Newing over the last few years covering the centenaries of the discovery of x-rays, radioactivity, the electron and radium. It is a splendid follow-up read after studying the more formal presentations in A-level textbooks. The theory of each technique is touched on and the reader is provided with a full list of references for deeper analysis. Intermittently within the text are paragraphs of historical and developmental details, illustrated by contemporary drawings and photographs. These passages, which appear in a different typeface, add greatly to the enjoyment of the book, but could be skipped by an impatient reader seeking to gain an appropriate review knowledge of the subject of medical radiation physics. The areas of physiological measurement and medical engineering are not covered, neither is medical computing. Chapters discuss the diagnostic and therapeutic applications of x-rays. Different methods of scanning are outlined and the appropriateness of techniques brought up-to-date. Treatment with ionizing radiations is expanded to touch on electron radiotherapy, neutron therapy and brachytherapy. Phototherapy and photochemotherapy are considered in the section on treatments using non-ionizing radiations. The story starts with evidence from the ancient worlds of Egypt and Greece, accelerating through the nineteenth and twentieth centuries to the many treatments around today. The laser is shown to be a versatile and exact tool, available in a complete range of wavelengths for different surgical uses. The scientific principles and current applications of nuclear medicine, ultrasound and MRI are described. For each type of procedure, the author includes comments on advantages, disadvantages and operational safety. Dosimetry and quality assurance are touched upon. The book reflects Professor Newing's enthusiasm for her role as a medical physicist both as practitioner and teacher. To any students studying

  4. Transportation Energy Data Book: Edition 14

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    1994-05-01

    Designed for use as a desk-top reference, the data book represents an assembly and display of statistics and information that characterize transportation activity, and presents data on other factors that influence transportation energy use. The purpose of this document is to present relevant statistical data in the form of tables and graphs. Each of the major transportation modes is treated in separate chapters or sections. Chapter 1 compares US transportation data with data from other countries. Aggregate energy use and energy supply data for all modes are presented in Chapter 2. The highway mode, which accounts for over three-fourths of total transportation energy consumption, is dealt with in Chapter 3. Topics in this chapter include automobiles, trucks, buses, fleet vehicles, federal standards, fuel economies, and high-occupancy vehicle lane data. Household travel behavior characteristics are displayed in Chapter 4. Chapter 5 contains information on alternative fuels and alternatively-fueled vehicles. Chapter 6 covers the major nonhighway modes: air, water, and rail. The last chapter, Chapter 7, presents data environmental issues relating to transportation.

  5. Pocket book of integrals and mathematical formulas

    CERN Document Server

    Tallarida, Ronald J

    2008-01-01

    Convenient Organization of Essential Material so You Can Look up Formulas Fast Containing a careful selection of standard and timely topics, the Pocket Book of Integrals and Mathematical Formulas, Fourth Edition presents many numerical and statistical tables, scores of worked examples, and the most useful mathematical formulas for engineering and scientific applications. This fourth edition of a bestseller provides even more comprehensive coverage with the inclusion of several additional topics, all while maintaining its accessible, clear style and handy size. New to the Fourth Edition           An expanded chapter on series that covers many fascinating properties of the natural numbers that follow from number theory           New applications such as geostationary satellite orbits and drug kinetics           An expanded statistics section that discusses nonlinear regression as well as the normal approximation of the binomial distribution           Revised f...

  6. A Paradoxical Property of the Monkey Book

    CERN Document Server

    Bernhardsson, Sebastian; Minnhagen, Petter

    2011-01-01

    A "monkey book" is a book consisting of a random distribution of letters and blanks, where a group of letters surrounded by two blanks is defined as a word. We compare the statistics of the word distribution for a monkey book with the corresponding distribution for the general class of random books, where the latter are books for which the words are randomly distributed. It is shown that the word distribution statistics for the monkey book is different and quite distinct from a typical sampled book or real book. In particular the monkey book obeys Heaps' power law to an extraordinary good approximation, in contrast to the word distributions for sampled and real books, which deviate from Heaps' law in a characteristics way. The somewhat counter-intuitive conclusion is that a "monkey book" obeys Heaps' power law precisely because its word-frequency distribution is not a smooth power law, contrary to the expectation based on simple mathematical arguments that if one is a power law, so is the other.

  7. The e-book war in Denmark

    DEFF Research Database (Denmark)

    Worsøe-Schmidt, Lisbeth

    2017-01-01

    The aim is to investigate how digitisation and in particular e-books have changed relations between private players and public institutions within the Danish book world through a case study of eReolen, a private-public partnership functioning as common platform for public libraries’ lending of e-books...... in Denmark. Traditional and new models of the book world are discussed as the basis of understanding relations between the players. A new way of analysing the field outlined by literary sociologist, Professor Johan Svedjedal, is adopted. The main conclusions are that the lending of e-books has disrupted...... the traditional understanding and interaction between the public library system and the commercial book market. In addition, the Danish library system through the partnership has taken on a new function in relation to the commercial market, namely acting as the engine in building a market for Danish e-books....

  8. Conformal Radiotherapy: Physics, Treatment Planning and Verification. Proceedings book

    Energy Technology Data Exchange (ETDEWEB)

    De Wagter, C. [ed.

    1995-12-01

    The goal of conformal radiotherapy is to establish radiation dose distributions that conform tightly to the target volume in view of limiting radiation to normal tissues. Conformal radiotherapy significantly improves both local control and palliation and thus contributes to increase survival and to improve the quality of life. The subjects covered by the symposium include : (1) conformal radiotherapy and multi-leaf collimation; (2) three dimensional imaging; (3) treatment simulation, planning and optimization; (4) quality assurance; and (5) dosimetry. The book of proceedings contains the abstracts of the invited lectures, papers and poster presentations as well as the full papers of these contributions.

  9. Introducing English language a resource book for students

    CERN Document Server

    Mullany, Louise

    2015-01-01

    Routledge English Language Introductions cover core areas of language study and are one-stop resources for students.Assuming no prior knowledge, books in the series offer an accessible overview of the subject, with activities, study questions, sample analyses, commentaries and key readings - all in the same volume. The innovative and flexible 'two-dimensional' structure is built around four sections - introduction, development, exploration and extension - which offer self-contained stages for study. Each topic can also be read across these sections, enabling the reader to build gradually on th

  10. Working in English student's book

    CERN Document Server

    Jones, Leo

    2001-01-01

    Working In English is a comprehensive course for Business English learners from Leo Jones, co-author of the successful New International Business English course. The core course comprises 40 one-hour units, focusing on thye practical day-to-day activities that all business people are involved in, and organised into seven modules. It is supplemented by extra activities from the Teacher's Book to offer maximum flexibility. The accompanying Video contains specially filmed documentary sequences, made in Europe and the USA, that relate to the themes of the modules and provide authentic input to the course.

  11. The Adobe Photoshop layers book

    CERN Document Server

    Lynch, Richard

    2011-01-01

    Layers are the building blocks for working in Photoshop. With the correct use of the Layers Tool, you can edit individual components of your images nondestructively to ensure that your end result is a combination of the best parts of your work. Despite how important it is for successful Photoshop work, the Layers Tool is one of the most often misused and misunderstood features within this powerful software program. This book will show you absolutely everything you need to know to work with layers, including how to use masks, blending, modes and layer management. You'll learn professional tech

  12. Book review: Mineral resource estimation

    Science.gov (United States)

    Mihalasky, Mark J.

    2016-01-01

    Mineral Resource Estimation is about estimating mineral resources at the scale of an ore deposit and is not to be mistaken with mineral resource assessment, which is undertaken at a significantly broader scale, even if similar data and geospatial/geostatistical methods are used. The book describes geological, statistical, and geostatistical tools and methodologies used in resource estimation and modeling, and presents case studies for illustration. The target audience is the expert, which includes professional mining geologists and engineers, as well as graduate-level and advanced undergraduate students.

  13. The Leadership Challenge Activities Book

    CERN Document Server

    Kouzes, James M; Biech, Elaine

    2010-01-01

    ACTIVE Learning for Exemplary Leaders. The best leaders are the best learners. This evidence-based truth has been a foundational principle of The Leadership Challenge since it was first published nearly twenty-five years ago. In this new work, bestselling Leadership Challenge authors Jim Kouzes and Barry Posner team up with experiential learning expert Elaine Biech to bring today's leaders over 100 engaging activities designed to expand and accelerate their leadership development efforts. Grounded in The Five Practices of Exemplary Leadership® model, The Leadership Challenge Activities Book in

  14. You cannot judge a book by its cover: the problems with journal rankings

    OpenAIRE

    Sangster, Alan

    2015-01-01

    Journal rankings lists have impacted and are impacting accounting educators and accounting education researchers around the world. Nowhere is the impact positive. It ranges from slight constraints on academic freedom to admonition, censure, reduced research allowances, non-promotion, non-short-listing for jobs, increased teaching loads, and re- designation as a non-researcher, all because the chosen research specialism of someone who was vocationally motivated to become a teacher of accountin...

  15. The UV Design of Book Cover%书籍封面"UV"设计

    Institute of Scientific and Technical Information of China (English)

    周婷

    2009-01-01

    @@ "今天你UV了吗?"据说在近年的各大图书订货会中,这已成为出版界人士的一句顺口溜.从畅销书到普通儿童读物,从科技书到经典文学作品,UV技术似乎成为了书籍设计师们最为青睐的印刷工艺.

  16. You Cannot Judge a Book by Its Cover: The Problems with Journal Rankings

    Science.gov (United States)

    Sangster, Alan

    2015-01-01

    Journal rankings lists have impacted and are impacting accounting educators and accounting education researchers around the world. Nowhere is the impact positive. It ranges from slight constraints on academic freedom to admonition, censure, reduced research allowances, non-promotion, non-short-listing for jobs, increased teaching loads, and…

  17. High plains cover crop research

    Science.gov (United States)

    Some recent statements have been made about the benefits of growing cover crops in mixtures as compared with single-species plantings of cover crops. Those stated benefits have included greatly reduced water use, enhanced soil microbiological activity, increased biomass productivity, and enhanced wa...

  18. Dualities in Covering Rough Operations

    Institute of Scientific and Technical Information of China (English)

    William Zhu

    2006-01-01

    Rough set theory is a technique of granular computing. In this paper, we study a type of generalized rough sets based on covering. There are several literatures[ 1,40-43 ] exploring covering-based rough sets. Our focus of this paper is on the dualities in rough operations.

  19. The Green and Burning Tree: On the Writing and Enjoyment of Children's Books.

    Science.gov (United States)

    Cameron, Eleanor

    This collection of 12 critical essays--written for teachers, librarians, students, and parents--comments on the style, characterization, sense of wonder, and sense of reality in children's books. Specific subjects covered are (1) the fantasy worlds of Andersen, Beatrix Potter, Walter de la Mare, C. S. Lewis, Lewis Carroll, and J. R. R. Tolkien;…

  20. An In-Depth Analysis of Tags and Controlled Metadata for Book Search

    DEFF Research Database (Denmark)

    Bogers, Toine; Petras, Vivien

    2017-01-01

    Book search for information needs that go beyond standard bibliographic data is far from a solved problem. Such complex information needs often cover a combination of di erent aspects, such as specific genres or plot elements, engagement or novelty. By design, subject information in controlled vo...