WorldWideScience

Sample records for bohrium 275

  1. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  2. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  4. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  5. ADJ 275 Courses Tutorial / indigohelp

    OpenAIRE

    NESA

    2015-01-01

    ADJ 275 Week 2 Checkpoint 1 Criminal Procedures ADJ 275 Week 2 CheckPoint 2 Criminal Procedure Variation ADJ 275 Week 2 Assignment Jurisdiction Case Review ADJ 275 Week 3 Checkpoint Arrest ADJ 275 Week 4 CheckPoint 1 Exclusionary Rule Arguments ADJ 275 Week 4 CheckPoint 2 Stop and Frisk and Arrest ADJ 275 Week 4 Assignment Exclusionary Rule Presentation ADJ 275 Week 5 CheckPoint Search and Seizure ADJ 275 Week 6 Assignment Plain View Open Fields Case Study ...

  6. BCOM 275 Course Tutorial / tutorialrank

    OpenAIRE

    welcome1351

    2015-01-01

    BCOM 275 Entire Course (UOP Course) For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 275 Week 1 DQ 1 (UOP Course) BCOM 275 Week 1 DQ 2 (UOP Course) BCOM 275 Week 1 Individual Exercise 1.1(UOP Course) BCOM 275 Week 2 DQ 1 (UOP Course) BCOM 275 Week 2 DQ 2 (UOP Course) BCOM 275 Week 2 Individual Assignment Demonstrative Communication Paper (UOP Course) BCOM 275 Week 3 DQ 1 (UOP Course) BCOM 2...

  7. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  8. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  9. BCOM 275 UOP Course Tutorial / Tutorialrank

    OpenAIRE

    charles

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 275 Week 1 DQ 1 (UOP Course) BCOM 275 Week 1 DQ 2 (UOP Course) BCOM 275 Week 1 Individual Exercise 1.1(UOP Course) BCOM 275 Week 2 DQ 1 (UOP Course) BCOM 275 Week 2 DQ 2 (UOP Course) BCOM 275 Week 2 Individual Assignment Demonstrative Communication Paper (UOP Course) BCOM 275 Week 3 DQ 1 (UOP Course) BCOM 275 Week 3 DQ 2 (UOP Course) BCOM 275...

  10. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  11. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  12. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  13. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  14. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  15. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  16. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  17. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  18. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  19. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  20. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  1. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  2. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  3. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  4. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  5. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  6. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  7. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  8. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  9. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  10. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  11. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  12. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  13. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  14. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  15. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  16. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  17. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  18. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  19. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  20. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  1. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  2. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  3. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  4. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  5. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  6. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  7. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  8. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  9. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  10. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  11. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  12. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  13. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  14. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  15. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  16. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  17. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  18. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  19. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  20. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  1. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  2. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  3. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  4. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  5. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  6. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  7. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  8. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  9. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  10. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  11. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  12. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  13. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  14. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  15. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  16. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  17. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  18. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  19. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  20. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  1. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  2. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  3. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  4. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  5. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  6. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  7. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  8. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  9. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  10. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  11. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  12. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  13. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  14. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  15. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  16. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  17. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  18. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  19. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  20. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  1. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  2. 28 CFR 27.5 - Review.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Review. 27.5 Section 27.5 Judicial... Investigating Reprisal Allegations and Ordering Corrective Action § 27.5 Review. The Complainant or the FBI may..., review by the Deputy Attorney General of that determination or order. The Deputy Attorney General...

  3. 7 CFR 275.15 - Data management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Data management. 275.15 Section 275.15 Agriculture... § 275.15 Data management. (a) Analysis. Analysis is the process of classifying data, such as by areas of... management information sources available to: (1) Identify all deficiencies in program operations and...

  4. 275 C Downhole Microcomputer System

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Hooi Miin Soo

    2008-08-31

    An HC11 controller IC and along with serial SRAM and ROM support ICs chip set were developed to support a data acquisition and control for extreme temperature/harsh environment conditions greater than 275 C. The 68HC11 microprocessor is widely used in well logging tools for control, data acquisition, and signal processing applications and was the logical choice for a downhole controller. This extreme temperature version of the 68HC11 enables new high temperature designs and additionally allows 68HC11-based well logging tools and MWD tools to be upgraded for high temperature operation in deep gas reservoirs, The microcomputer chip consists of the microprocessor ALU, a small boot ROM, 4 kbyte data RAM, counter/timer unit, serial peripheral interface (SPI), asynchronous serial interface (SCI), and the A, B, C, and D parallel ports. The chip is code compatible with the single chip mode commercial 68HC11 except for the absence of the analog to digital converter system. To avoid mask programmed internal ROM, a boot program is used to load the microcomputer program from an external mask SPI ROM. A SPI RAM IC completes the chip set and allows data RAM to be added in 4 kbyte increments. The HC11 controller IC chip set is implemented in the Peregrine Semiconductor 0.5 micron Silicon-on-Sapphire (SOS) process using a custom high temperature cell library developed at Oklahoma State University. Yield data is presented for all, the HC11, SPI-RAM and ROM. The lessons learned in this project were extended to the successful development of two high temperature versions of the LEON3 and a companion 8 Kbyte SRAM, a 200 C version for the Navy and a 275 C version for the gas industry.

  5. 7 CFR 275.11 - Sampling.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Sampling. 275.11 Section 275.11 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... precision than would be obtained had the State agency reviewed simple random samples of the sizes...

  6. 14 CFR 21.275 - Experimental certificates.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Experimental certificates. 21.275 Section 21.275 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... certificates. (a) The manufacturer shall, before issuing an experimental certificate, obtain from...

  7. 32 CFR 275.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 275.5 Section 275.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Responsibilities. (a) The Director of Administration and Management, Office of the Secretary of Defense shall:...

  8. 49 CFR 27.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., organic brain syndrome, emotional or mental illness, and specific learning disabilities. The term physical... 49 Transportation 1 2010-10-01 2010-10-01 false Definitions. 27.5 Section 27.5 Transportation Office of the Secretary of Transportation NONDISCRIMINATION ON THE BASIS OF DISABILITY IN PROGRAMS...

  9. BCOM 275 UOP Course Tutorial/TutotorialRank

    OpenAIRE

    jnifer

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 275 Week 1 DQ 1 (UOP Course) BCOM 275 Week 1 DQ 2 (UOP Course) BCOM 275 Week 1 Individual Exercise 1.1(UOP Course) BCOM 275 Week 2 DQ 1 (UOP Course) BCOM 275 Week 2 DQ 2 (UOP Course) BCOM 275 Week 2 Individual Assignment Demonstrative Communication Paper (UOP Course) BCOM 275 Week 3 DQ 1 (UOP Course) BCOM 275 Week 3 DQ 2 (UOP Course) BCOM 275...

  10. BCOM 275 UOP Course Tutorial/TutorialRank

    OpenAIRE

    apj

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 275 Week 1 DQ 1 (UOP Course) BCOM 275 Week 1 DQ 2 (UOP Course) BCOM 275 Week 1 Individual Exercise 1.1(UOP Course) BCOM 275 Week 2 DQ 1 (UOP Course) BCOM 275 Week 2 DQ 2 (UOP Course) BCOM 275 Week 2 Individual Assignment Demonstrative Communication Paper (UOP Course) BCOM 275 Week 3 DQ 1 (UOP Course) BCOM 275 Week 3 DQ 2 (UOP Course)

  11. 32 CFR 275.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT OF 1978 § 275.3...) Customer. Any person or authorized representative of that person who used or is using any service of a... from the original record held by a financial institution that pertains to a customer's...

  12. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  13. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  14. Dicty_cDB: VSJ275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ2-D/VSJ275Q.Seq.d/ Representati...ve seq. ID VSJ275P (Link to Original site) Representative DNA sequence >VSJ275 (VSJ275Q) /CSM/VS/VSJ2-D/VSJ2...ence gelecgvceviaqqcsnyikankteseivglldqfcstlsifesacdtivassapkiinl llqnqsatvvcteigfcgnsssgnnnhssseesssssqpssssessessysgsmtgassg sas...SGTSET*kftsnkfnn*ii*g Translated Amino Acid sequence (All Frames) Frame A: gelecgvceviaqqcsnyikankteseivglldqfcstlsifesacdtivassa...pkiinl llqnqsatvvcteigfcgnsssgnnnhssseesssssqpssssessessysgsmtgassg sas

  15. 7 CFR 275.21 - Quality control review reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Quality control review reports. 275.21 Section 275.21... Reporting on Program Performance § 275.21 Quality control review reports. (a) General. Each State agency shall submit reports on the performance of quality control reviews in accordance with the...

  16. Dicty_cDB: VFE275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFE275 (Link to dictyBase) - - - Contig-U16521-1 VFE275P (Link to Original ... SRSETQVDHSDPIVLCGKAIANG*kvr*g*qashilefisvmwfgtsmsa*hip ... elkkfprvgvfth*svt*agfkts*dslvpiyc*krkn*npsfstrglrw ... SRSETQVDHSDPIVLCGKAIANG*kvr*g*qashilefisvmwfgtsmsa*hip ... elkkfprvgvfth*svt*agfkts*dslvpiyc*krkn*npsfstrglrw ...

  17. 49 CFR 192.275 - Cast iron pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Cast iron pipe. 192.275 Section 192.275... Cast iron pipe. (a) Each caulked bell and spigot joint in cast iron pipe must be sealed with mechanical leak clamps. (b) Each mechanical joint in cast iron pipe must have a gasket made of a...

  18. 7 CFR 275.16 - Corrective action planning.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Corrective action planning. 275.16 Section 275.16... Corrective action planning. (a) Corrective action planning is the process by which State agencies shall...)/management unit(s) in the planning, development, and implementation of corrective action are those which:...

  19. 24 CFR 221.275 - Method of paying insurance benefits.

    Science.gov (United States)

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of paying insurance benefits. 221.275 Section 221.275 Housing and Urban Development Regulations Relating to Housing and...

  20. 32 CFR Appendix B to Part 275 - Obtaining Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... required by 32 CFR part 310 for a personnel security investigation. C. Any customer's authorization not... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Customer Authorization B Appendix B to... OF 1978 Pt. 275, App. B Appendix B to Part 275—Obtaining Customer Authorization A. A DoD...

  1. 24 CFR 241.275 - No vested right in fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false No vested right in fund. 241.275... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.275 No vested...

  2. 40 CFR 27.5 - Review by the reviewing official.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Review by the reviewing official. 27.5... REMEDIES § 27.5 Review by the reviewing official. (a) If, based on the report of the investigating official under § 27.4(b), the reviewing official determines that there is adequate evidence to believe that...

  3. 21 CFR 73.275 - Dried algae meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Dried algae meal. 73.275 Section 73.275 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL LISTING OF COLOR... algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  4. Dicty_cDB: SSM275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSM275 (Link to dictyBase) - - - Contig-U07980-1 SSM275Z (Link to Original ... ents: (bits) Value EU276418_1( EU276418 |pid:none) Olive ... flounder iridovirus strain O... 36 0.80 AB043979_1 ...

  5. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  6. 40 CFR 1065.275 - N2O measurement devices.

    Science.gov (United States)

    2010-07-01

    ... CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Nox and N2o Measurements § 1065.275 N2O... for any compensation algorithm is 0.0% (that is, no bias high and no bias low), regardless of the... and no bias low), regardless of the uncompensated signal's bias. Use appropriate analytical...

  7. 24 CFR 990.275 - Project-based management (PBM).

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Project-based management (PBM). 990... URBAN DEVELOPMENT THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.275 Project-based... of rental housing at the project level. Under PBM, these property management services are...

  8. 40 CFR 421.275 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... Metals Subcategory § 421.275 Pretreatment standards for existing sources. Except as provided in 40 CFR... publicly owned treatment works must comply with 40 CFR part 403 and achieve the following pretreatment... wastewater introduced into a POTW must not exceed the following values: (a) Dryer vent water quench...

  9. 40 CFR 180.275 - Chlorothalonil; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... inadvertent residues. Editorial Note: For Federal Register citations affecting § 180.275, see the List of CFR... with husks removed 1 Cranberry 5.0 Ginseng 4.0 Horseradish 4.0 Lentil 0.10 Lychee 15 Mango 1.0...

  10. 27 CFR 19.275 - Continuous distilling system.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Continuous distilling... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Construction, Equipment and Security § 19.275 Continuous distilling system. The distilling system shall be continuous, and...

  11. 32 CFR Appendix G to Part 275 - Releasing Information Obtained From Financial Institutions

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Releasing Information Obtained From Financial Institutions G Appendix G to Part 275 National Defense Department of Defense (Continued) OFFICE OF THE... FINANCIAL PRIVACY ACT OF 1978 Pt. 275, App. G Appendix G to Part 275—Releasing Information Obtained...

  12. 32 CFR Appendix K to Part 275 - Format for Formal Written Request

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Format for Formal Written Request K Appendix K to Part 275 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE... OF 1978 Pt. 275, App. K Appendix K to Part 275—Format for Formal Written Request Mr./Mrs....

  13. Dicty_cDB: VHC275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC275 (Link to dictyBase) - G22313 DDB0233961 Contig-U14773-1 - (Link to O ... complete sequence. 34 0.22 8 EL371567 |EL371567.1 CCE L13585.b1_B13.ab1 CCE (LMS) endive Cichorium endivia ... cDNA clone CCE L13585, mRNA sequence. 48 0.26 1 EL360537 |EL360537 ... .1 CCE M5240.b1_O14.ab1 CCE (LMS) endive Cichorium endivia ... cDNA clone CCE M5240, mRNA sequence. 48 0.26 1 dna update 2007. 4. ...

  14. 275 C Downhole Switched-Mode Power Supply

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Vijay Madhuravasal

    2008-08-31

    A vee-square (V2) control based controller IC is developed for a switch mode power supply capable of operating at extreme temperature/harsh environment conditions. A buck type regulator with silicon carbide power junction field effect transistors (JFET) as power devices is used to analyze the performance of controller. Special emphases are made on the analog sub-blocks--voltage reference, operational transconductance amplifier and comparator as individual building blocks. Transformer coupled gate drives and high temperature operable magnetic cores and capacitors are identified and tested for use in the design. Conventional ceramic chip packaging of ICs combined with lead carrier type mounting of passive filter components is introduced for hybrid packaging of the complete product. The developed SMPS is anticipated to support the operation of down-hole microcontrollers and other electronics devices that require low/medium power filtered dc inputs over an operating temperature of 275 C.

  15. 17 CFR 275.206(4)-4 - Financial and disciplinary information that investment advisers must disclose to clients.

    Science.gov (United States)

    2010-04-01

    ... written disclosure statement to clients under Rule 204-3 (17 CFR 275.204-3); Provided, That the delivery... ADVISERS ACT OF 1940 § 275.206(4)-4 Financial and disciplinary information that investment advisers must... information that investment advisers must disclose to clients. 275.206(4)-4 Section 275.206(4)-4 Commodity...

  16. Composite augmentation phalloplasty: personal experience after 275 patients

    Directory of Open Access Journals (Sweden)

    Juan Monreal

    2015-03-01

    Full Text Available Aim: To report the author's experience in augmentation phalloplasty by studying a retrospective series of patients who underwent fat grafting for girth enhancement or a composite technique based on suspensory ligament release plus fat grafting performed simultaneously. Methods: The author analyzed retrospectively the outcomes of 275 augmentation phalloplasty procedures performed in 259 patients until November 2013. Of these, 127 correspond to girth augmentation with fat grafting and 148 to composite augmentation phalloplasty (girth augmentation with fat grafting and length improvement by suspensory ligament release. In 16 patients girth and length enhancement were performed in two separate procedures. Results: Of this 259 patients, 87 underwent postoperative follow-up for at least 12 months and 160 patients underwent follow-up for at least 6 months. The average increase in circumference at 6 months was 1.7 cm (1.57 cm at 12 months and the average increase in length of 3.2 cm (3.1 cm at 12 months. Twenty-two patients showed minor complications that were treated without sequelae and without influencing the final result. Conclusion: By judicious use of currently available techniques, it is possible to achieve stable increases in penis size. The use of composite techniques provides better final results than the use of individual techniques performed alone due to the increase of the actual volume of the penis. An adequate informed consent is essential in all patients due to the unrealistic expectations expressed by the majority of them.

  17. 24 CFR 213.275 - Nature of the Cooperative Management Housing Insurance Fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of the Cooperative Management Housing Insurance Fund. 213.275 Section 213.275 Housing and Urban Development Regulations Relating... Nature of the Cooperative Management Housing Insurance Fund. The Cooperative Management Housing...

  18. 5 CFR 532.275 - Special wage schedules for ship surveyors in Puerto Rico.

    Science.gov (United States)

    2010-01-01

    ... in Puerto Rico. 532.275 Section 532.275 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... schedules for ship surveyors in Puerto Rico. (a) The Department of Defense shall establish special wage schedules for nonsupervisory ship surveyors and supervisory ship surveyors in Puerto Rico. (b) Rates...

  19. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of...

  20. 32 CFR Appendix J to Part 275 - Format for Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Format for Customer Authorization J Appendix J... OF 1978 Pt. 275, App. J Appendix J to Part 275—Format for Customer Authorization Pursuant to section... months from the date of my signature. Signature: Date: Statement of Customer Rights Under the Right...

  1. 32 CFR Appendix E to Part 275 - Obtaining Access for Foreign Intelligence, Foreign Counterintelligence, and International...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Access for Foreign Intelligence..., App. E Appendix E to Part 275—Obtaining Access for Foreign Intelligence, Foreign Counterintelligence... financial institution (as identified at § 275.3) by an intelligence organization, as identified in...

  2. Atomic Mass and NuclearBinding Energy for Uup-275(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-275 (Ununpentium, atomic number Z = 115, mass number A = 275).

  3. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... defined in § 275.203(b)(3)-1), and the adviser or any related person (as defined in Form ADV (17 CFR 279.1..., see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Books and records to...

  4. 17 CFR 275.206(4)-1 - Advertisements by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements.... 80b-3), directly or indirectly, to publish, circulate, or distribute any advertisement: (1)...

  5. 7 CFR 275.18 - Project area/management unit corrective action plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Project area/management unit corrective action plan... SYSTEM Corrective Action § 275.18 Project area/management unit corrective action plan. (a) The State agency shall ensure that corrective action plans are prepared at the project area/management unit...

  6. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... generally to the public as an investment adviser, within the meaning of section 203(b)(3) of the Act (15 U.S... than the United States, and is regulated as a public investment company under the laws of the country... investment adviser. 275.203(b)(3)-1 Section 275.203(b)(3)-1 Commodity and Securities Exchanges SECURITIES...

  7. 42 CFR 137.275 - May Self-Governance Tribes include IHS construction programs in a construction project agreement...

    Science.gov (United States)

    2010-10-01

    ... programs in a construction project agreement or in a funding agreement? 137.275 Section 137.275 Public...-Governance Tribes include IHS construction programs in a construction project agreement or in a funding agreement? Yes, Self-Governance Tribes may choose to assume construction programs in a construction...

  8. The class I-specific HDAC inhibitor MS-275 modulates the differentiation potential of mouse embryonic stem cells

    Directory of Open Access Journals (Sweden)

    Gianluigi Franci

    2013-08-01

    Exploitation of embryonic stem cells (ESC for therapeutic use and biomedical applications is severely hampered by the risk of teratocarcinoma formation. Here, we performed a screen of selected epi-modulating compounds and demonstrate that a transient exposure of mouse ESC to MS-275 (Entinostat, a class I histone deacetylase inhibitor (HDAC, modulates differentiation and prevents teratocarcinoma formation. Morphological and molecular data indicate that MS-275-primed ESCs are committed towards neural differentiation, which is supported by transcriptome analyses. Interestingly, in vitro withdrawal of MS-275 reverses the primed cells to the pluripotent state. In vivo, MS275-primed ES cells injected into recipient mice give only rise to benign teratomas but not teratocarcinomas with prevalence of neural-derived structures. In agreement, MS-275-primed ESC are unable to colonize blastocysts. These findings provide evidence that a transient alteration of acetylation alters the ESC fate.

  9. 275例唐氏综合征患儿染色体分析%The chromosome karyotype of 275 examples of Down's syndrome

    Institute of Scientific and Technical Information of China (English)

    安会波; 刘征燕; 张丽丽

    2012-01-01

    Objective; Check the chromosome in peripheral blood of Down's syndrome suspected by clinic, who visited our hospital from 2. 2007 -3.2010. Methods; Cultivate lymphocyte in peripheral blood in nutritive medium, analyze the karyotype using G band. Results; Detected 275 examples of Down's syndrome, including 247 examples of simple type, 21 examples of translocation type and 7 examples of mosaicism type.%目的 对2007年2月至2010年3月期间来我院就诊,临床疑为先天愚型的患者进行外周血染色体检查.方法 用培养基培养外周血淋巴细胞,G显带进行染色体核型分析.结果 检出唐氏综合征患者275例,其中单纯型247例,易位型21例,嵌合型7例.

  10. RESULTS OF SURGICAL TREATMENT IN CERVICAL HERNIATED DISC ANALYSIS OF 275 CASES

    Directory of Open Access Journals (Sweden)

    L. Eva

    2010-02-01

    Full Text Available Background: Problems of surgical treatment of cervical disc hernia are still far from being resolved. It shows variety of surgical procedures it. The operations for cervical level with radiculopatie were quite limited. Limits method were dictated by the absence of accurate diagnosis, microsurgical methods, extensions, sometimes unjustified, conservative treatment. Material and method Complex issue of cervical spine degenerative pathologies, particularly cervical disc hernia with radicular syndrome was studied on a group of 275 patients. Results: From the 275 patients with herniated disc cervical admitted in the study, 182 (66.18% of cases had surgical intervention to a single level disc, 72 patients (26.18% of cases in two levels, 20 patients (7.27% cases at three levels and one case (0.36% at four levels.

  11. Evaluation of Characteristics of Lightning Faults on 275kV Transmission Lines

    Science.gov (United States)

    Kawamura, Hironao; Itamoto, Naoki; Shinjo, Kazuo; Ishii, Masaru

    It is effective to design the lightning protection of transmission lines by employing simulation to be able to reproduce conditions of experienced lightning faults. As a result of the lightning faults on 275kV transmission lines in Hokuriku area, the frequency of only one-ground fault of upper or middle lines is higher. Especially, the frequency of one-ground faults of the middle lines in summer is the highest. It is thought that many one-ground faults in summer are caused by direct lightning strokes to phase conductors. Moreover, multi-ground faults caused by lightning strokes to tower tops or overhead ground wires also include many ground faults of the middle lines. In this paper, the experienced lightning faults on the 275kV transmission lines are reproduced by EMTP calculations and the characteristics of the ground-fault lines are examined.

  12. 49 CFR 40.275 - What is the effect of procedural problems that are not sufficient to cancel an alcohol test?

    Science.gov (United States)

    2010-10-01

    ... in Alcohol Testing § 40.275 What is the effect of procedural problems that are not sufficient to... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of procedural problems that are not sufficient to cancel an alcohol test? 40.275 Section 40.275 Transportation Office of the...

  13. Detection of drugs in 275 alcohol-positive blood samples of Korean drivers.

    Science.gov (United States)

    Kim, Eunmi; Choe, Sanggil; Lee, Juseon; Jang, Moonhee; Choi, Hyeyoung; Chung, Heesun

    2016-08-01

    Since driving under the influence of drugs (DUID) is as dangerous as drink-driving, many countries regulate DUID by law. However, laws against the use of drugs while driving are not yet established in Korea. In order to investigate the type and frequency of drugs used by drivers in Korea, we analyzed controlled and non-controlled drugs in alcohol-positive blood samples. Total 275 blood samples were taken from Korean drivers, which were positive in roadside alcohol testing. The following analyses were performed: blood alcohol concentrations by GC; screening for controlled drugs by immunoassay and confirmation for positive samples by GC-MS. For the detection of DUID related drugs in blood samples, a total of 49 drugs were selected and were examined by GC-MS. For a rapid detection of these drugs, an automated identification software called "DrugMan" was used. Concentrations of alcohol in 275 blood samples ranged from 0.011 to 0.249% (average 0.119%). Six specimens showed positive results by immunoassay: one methamphetamine and five benzodiazepines I. By GC-MS confirmation, only benzodiazepines in four cases were identified, while methamphetamine and benzodiazepine in two cases were not detected from the presumptive positive blood samples. Using DrugMan, four drugs were detected; chlorpheniramine (5)*, diazepam (4), dextromethorphan (1) and doxylamine (1). In addition, ibuprofen (1), lidocaine (1) and topiramate (1) were also detected as general drugs in blood samples ('*' indicates frequency). The frequency of drug abuse by Korean drivers was relatively low and a total 14 cases were positive in 275 blood samples with a ratio of 5%. However it is necessary to analyze more samples including alcohol negative blood, and to expand the range of drug lists to get the detailed information. PMID:27015372

  14. Tris(6-carboxypyridine-2-carboxylatoterbium(III 2.75-hydrate

    Directory of Open Access Journals (Sweden)

    Soumaila Zebret

    2011-07-01

    Full Text Available In the title compound, [Tb(C7H4NO43]·2.75H2O, the Tb3+ atom is coordinated by three tridentate 6-carboxypyridine-2-carboxylate ligands and lies on a crystallographic threefold rotation axis. The coordination polyhedron around TbIII adopts a distorted tricapped trigonal–prismatic geometry. Disordered water molecules with partial occupancy are also present in the crystal, one of which is associated with each of the carboxylate O atoms of the complex unit.

  15. 275 W average output power from a femtosecond thin disk oscillator operated in a vacuum environment

    OpenAIRE

    Clara J. Saraceno; Emaury, Florian; Heckl, Oliver H.; Baer, Cyrill R. E.; Hoffmann, Martin; Schriber, Cinia; Golling, Matthias; Südmeyer, Thomas; Keller, Ursula

    2012-01-01

    We present an ultrafast thin disk laser that generates an average output power of 275 W, which is higher than any other modelocked laser oscillator. It is based on the gain material Yb:YAG and operates at a pulse duration of 583 fs and a repetition rate of 16.3 MHz resulting in a pulse energy of 16.9 µJ and a peak power of 25.6 MW. A SESAM designed for high damage threshold initiated and stabilized soliton modelocking. We reduced the nonlinearity of the atmosphere inside the cavity by several...

  16. Heat treatment of high manganese type X57MnAl27-5 austenitic steel

    International Nuclear Information System (INIS)

    In the paper, the influence of heat treatment parameters on microstructure and mechanical properties of high manganese type X57MnAl27-5 austenitic steel was investigated. The as-forged bar with diameter of 15 mm were underwent a saturation process at six different temperatures. The microstructural changes of austenite and the influence of heat treatment on the mechanical properties were considered. The quantitative analysis of austenite phase of the examined steel indicated that the parameters of saturation process resulted in changes of morphology and grain size of austenite. It was revealed that treatment temperature in the range of 950 deg. C - 1100 deg. C slightly influenced grain size, stress limit and hardness of the investigated steel. Treatment at temperature higher than 1150 deg. C resulted in the growth of austenite grain size and the decrease of mechanical properties.

  17. 275 W average output power from a femtosecond thin disk oscillator operated in a vacuum environment.

    Science.gov (United States)

    Saraceno, Clara J; Emaury, Florian; Heckl, Oliver H; Baer, Cyrill R E; Hoffmann, Martin; Schriber, Cinia; Golling, Matthias; Südmeyer, Thomas; Keller, Ursula

    2012-10-01

    We present an ultrafast thin disk laser that generates an average output power of 275 W, which is higher than any other modelocked laser oscillator. It is based on the gain material Yb:YAG and operates at a pulse duration of 583 fs and a repetition rate of 16.3 MHz resulting in a pulse energy of 16.9 μJ and a peak power of 25.6 MW. A SESAM designed for high damage threshold initiated and stabilized soliton modelocking. We reduced the nonlinearity of the atmosphere inside the cavity by several orders of magnitude by operating the oscillator in a vacuum environment. Thus soliton modelocking was achieved at moderate amounts of self-phase modulation and negative group delay dispersion. Our approach opens a new avenue for power scaling femtosecond oscillators to the kW level. PMID:23188316

  18. Potentiation of reactive oxygen species is a marker for synergistic cytotoxicity of MS-275 and 5-azacytidine in leukemic cells

    Science.gov (United States)

    Gao, Shan; Mobley, Aaron; Miller, Claudia; Boklan, Jessica; Chandra, Joya

    2008-01-01

    Epigenetic modifiers are currently in clinical use for various tumor types. Recently, numerous studies supporting the combination of histone deacetylase inhibitors (HDACi) and DNA methyltransferase inhibitors have emerged, encouraging early clinical trials of these agents together. Here we show that MS-275, an HDACi, and 5-azacytidine, a methyltransferase inhibitor, display synergistic cytotoxicity and apoptosis in AML and ALL cells. Intracellular production of reactive oxygen species (ROS), such as superoxide and hydrogen peroxide, is a novel marker for this synergism in ALL cells. These data suggest that assessment of oxidative stress can serve as a marker of the concerted action of MS-275 and 5-azacytidine. PMID:18031811

  19. l275np.m77t - MGD77 data file for Geophysical data from feld activity L-2-75-NP in Gulf of Alaska from 08/25/1975 to 09/04/1975

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and magnetics data along with DGPS navigation data was collected as part of field activity L-2-75-NP in Gulf of Alaska from 08/25/1975 to...

  20. 17 CFR 275.206(4)-2 - Custody of funds or securities of clients by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... certificate on Form ADV-E (17 CFR 279.8) with the Commission within 120 days of the time chosen by the... Regulation S-X (17 CFR 210.1-02(d))): (i) At least annually and distributes its audited financial statements... companies. You are not required to comply with this section (17 CFR 275.206(4)-2) with respect to...

  1. The recurrence and survival of oral squamous cell carcinoma: a report of 275 cases

    Directory of Open Access Journals (Sweden)

    Kai Yue

    2013-11-01

    Full Text Available Oral squamous cell carcinoma (OSCC is a common malignant tumor of the head and neck, and recurrence is an important prognostic factor in patients with OSCC. We explored the factors associated with recurrence of OSCC and analyzed the survival of patients after recurrence. Clinicopathologic and follow-up data of 275 patients with OSCC treated by surgery in the Cancer Institute and Hospital of Tianjin Medical University between 2002 and 2006 were analyzed. Recurrence factors were analyzed with Chi-square or Fisher's exact test and multivariate analysis. The prognosis of patients after recurrence was analyzed with the Kaplan-Meier method and log-rank test. The recurrence rate was 32.7%. The recurrence time ranged from 2 to 96 months, with a median of 14 months. Univariate analysis showed that T stage, degree of differentiation, pN stage, flap application, resection margin, and lymphovascular invasion were factors of recurrence (P 0.05. Kaplan-Meier and log-rank tests showed that the 2- and 5-year survival rates were significantly lower in the recurrence group than in non-recurrence group (67.6% vs. 88.0%, 31.8% vs. 79.9%, P < 0.001. Therefore, to improve prognosis, we recommend extended local excision, flap, radical neck dissection, and adjuvant chemoradiotherapy for patients more likely to undergo recurrence.

  2. Multimodality treatment of brain metastases: an institutional survival analysis of 275 patients

    Directory of Open Access Journals (Sweden)

    Demakas John J

    2011-07-01

    Full Text Available Abstract Background Whole brain radiation therapy (WBRT, surgical resection, stereotactic radiosurgery (SRS, and combinations of the three modalities are used in the management of patients with metastatic brain tumors. We present the previously unreported survival outcomes of 275 patients treated for newly diagnosed brain metastases at Cancer Care Northwest and Gamma Knife of Spokane between 1998 and 2008. Methods The effects treatment regimen, age, Eastern Cooperative Oncology Group-Performance Status (ECOG-PS, primary tumor histology, number of brain metastases, and total volume of brain metastases have on patient overall survival were analyzed. Statistical analysis was performed using Kaplan-Meier survival curves, Andersen 95% confidence intervals, approximate confidence intervals for log hazard-ratios, and multivariate Cox proportional hazard models. Results The median clinical follow up time was 7.2 months. On multivariate analysis, survival statistically favored patients treated with SRS alone when compared to patients treated with WBRT alone (p Conclusions In our analysis, patients benefited from a combined modality treatment approach and physicians must consider patient age, performance status, and primary tumor histology when recommending specific treatments regimens.

  3. 32 CFR Appendix L to Part 275 - Format for Customer Notice for Administrative or Judicial Subpoena or for a Formal Written Request

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Format for Customer Notice for Administrative or... FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT OF 1978 Pt. 275, App. L Appendix L to Part 275—Format for Customer Notice for Administrative or Judicial Subpoena or for a Formal Written...

  4. Imaging cognition II: An empirical review of 275 PET and fMRI studies.

    Science.gov (United States)

    Cabeza, R; Nyberg, L

    2000-01-01

    Positron emission tomography (PET) and functional magnetic resonance imaging (fMRI) have been extensively used to explore the functional neuroanatomy of cognitive functions. Here we review 275 PET and fMRI studies of attention (sustained, selective, Stroop, orientation, divided), perception (object, face, space/motion, smell), imagery (object, space/motion), language (written/spoken word recognition, spoken/no spoken response), working memory (verbal/numeric, object, spatial, problem solving), semantic memory retrieval (categorization, generation), episodic memory encoding (verbal, object, spatial), episodic memory retrieval (verbal, nonverbal, success, effort, mode, context), priming (perceptual, conceptual), and procedural memory (conditioning, motor, and nonmotor skill learning). To identify consistent activation patterns associated with these cognitive operations, data from 412 contrasts were summarized at the level of cortical Brodmann's areas, insula, thalamus, medial-temporal lobe (including hippocampus), basal ganglia, and cerebellum. For perception and imagery, activation patterns included primary and secondary regions in the dorsal and ventral pathways. For attention and working memory, activations were usually found in prefrontal and parietal regions. For language and semantic memory retrieval, typical regions included left prefrontal and temporal regions. For episodic memory encoding, consistently activated regions included left prefrontal and medial temporal regions. For episodic memory retrieval, activation patterns included prefrontal, medial temporal, and posterior midline regions. For priming, deactivations in prefrontal (conceptual) or extrastriate (perceptual) regions were consistently seen. For procedural memory, activations were found in motor as well as in non-motor brain areas. Analysis of regional activations across cognitive domains suggested that several brain regions, including the cerebellum, are engaged by a variety of cognitive

  5. Rotator cuff tears: assessment with MR arthrography in 275 patients with arthroscopic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Waldt, S.; Bruegel, M.; Mueller, D.; Holzapfel, K.; Rummeny, E.J.; Woertler, K. [Technische Universitaet Muenchen, Department of Radiology, Munich (Germany); Imhoff, A.B. [Technische Universitaet Muenchen, Department of Sports Orthopedics, Munich (Germany)

    2007-02-15

    We assessed the diagnostic performance of magnetic resonance (MR) arthrography in the diagnosis of articular-sided partial-thickness and full-thickness rotator cuff tears in a large symptomatic population. MR arthrograms obtained in 275 patients including a study group of 139 patients with rotator cuff tears proved by arthroscopy and a control group of 136 patients with arthroscopically intact rotator cuff tendons were reviewed in random order. MR imaging was performed on a 1.0 T system (Magnetom Expert, Siemens). MR arthrograms were analyzed by two radiologists in consensus for articular-sided partial-thickness and full-thickness tears of the supraspinatus, infraspinatus, and subscapularis tendons. At arthroscopy, 197 rotator cuff tears were diagnosed, including 105 partial-thickness (93 supraspinatus, nine infraspinatus, three subscapularis) and 92 full-thickness (43 supraspinatus, 20 infraspinatus, 29 subscapularis) tendon tears. For full-thickness tears, sensitivity, specificity, and accuracy were 96%, 99%, and 98%, respectively, and for partial tears 80%, 97%, and 95%, respectively. False negative and positive assessments in the diagnosis of articular-sided partial-thickness tears were predominantly [78% (35/45)] observed with small articular-sided (Ellman grade1) tendon tears. MR arthrography is highly accurate in the diagnosis of full-thickness rotator cuff tears and is accurate in the diagnosis of articular-sided partial-thickness tears. Limitations in the diagnosis of partial-thickness tears are mainly restricted to small articular-sided tears (Ellman grade 1) due to difficulties in differentiation between fiber tearing, tendinitis, synovitic changes, and superficial fraying at tendon margins. (orig.)

  6. Rotator cuff tears: assessment with MR arthrography in 275 patients with arthroscopic correlation

    International Nuclear Information System (INIS)

    We assessed the diagnostic performance of magnetic resonance (MR) arthrography in the diagnosis of articular-sided partial-thickness and full-thickness rotator cuff tears in a large symptomatic population. MR arthrograms obtained in 275 patients including a study group of 139 patients with rotator cuff tears proved by arthroscopy and a control group of 136 patients with arthroscopically intact rotator cuff tendons were reviewed in random order. MR imaging was performed on a 1.0 T system (Magnetom Expert, Siemens). MR arthrograms were analyzed by two radiologists in consensus for articular-sided partial-thickness and full-thickness tears of the supraspinatus, infraspinatus, and subscapularis tendons. At arthroscopy, 197 rotator cuff tears were diagnosed, including 105 partial-thickness (93 supraspinatus, nine infraspinatus, three subscapularis) and 92 full-thickness (43 supraspinatus, 20 infraspinatus, 29 subscapularis) tendon tears. For full-thickness tears, sensitivity, specificity, and accuracy were 96%, 99%, and 98%, respectively, and for partial tears 80%, 97%, and 95%, respectively. False negative and positive assessments in the diagnosis of articular-sided partial-thickness tears were predominantly [78% (35/45)] observed with small articular-sided (Ellman grade1) tendon tears. MR arthrography is highly accurate in the diagnosis of full-thickness rotator cuff tears and is accurate in the diagnosis of articular-sided partial-thickness tears. Limitations in the diagnosis of partial-thickness tears are mainly restricted to small articular-sided tears (Ellman grade 1) due to difficulties in differentiation between fiber tearing, tendinitis, synovitic changes, and superficial fraying at tendon margins. (orig.)

  7. Potentiation of reactive oxygen species is a marker for synergistic cytotoxicity of MS-275 and 5-azacytidine in leukemic cells

    OpenAIRE

    Gao, Shan; Mobley, Aaron; Miller, Claudia; Boklan, Jessica; Chandra, Joya

    2007-01-01

    Epigenetic modifiers are currently in clinical use for various tumor types. Recently, numerous studies supporting the combination of histone deacetylase inhibitors (HDACi) and DNA methyltransferase inhibitors have emerged, encouraging early clinical trials of these agents together. Here we show that MS-275, an HDACi, and 5-azacytidine, a methyltransferase inhibitor, display synergistic cytotoxicity and apoptosis in AML and ALL cells. Intracellular production of reactive oxygen species (ROS), ...

  8. Differential cross sections for pion charge exchange on the proton at 27.5 MeV

    International Nuclear Information System (INIS)

    We have measured pion single charge exchange differential cross sections on the proton at 27.5 MeV incident π- kinetic energy in the center of momentum angular range between 0 degree and 55 degree. The extracted cross sections are compared with predictions of the standard pion-nucleon partial wave analysis and found to be in excellent agreement. copyright 1998 The American Physical Society

  9. Peripheral collisions in the reaction 40Ar + 93Nb at 27.5 MeV/nucleon

    International Nuclear Information System (INIS)

    This thesis describes an experimental study of the reaction 40Ar + 93Nb at 27.5 MeV/nucleon carried out at the GANIL accelerator. Reaction products were detected in a large position sensitive localization ionization chamber. The experimental data were used to obtain information concerning the reaction mechanism especially for peripheral collisions. A model using the properties of random works were applied successfully to the interpretation of the data. The importance of the deflection produced by the ion-ion potential as well as of the emission of alpha particles in the reaction is stressed

  10. Lambda0 polarization in p p ---> p Lambda0 K+ (pi+ pi-) at 27.5-GeV

    Energy Technology Data Exchange (ETDEWEB)

    Felix, J.; Christian, D.C.; Church, M.D.; Forbush, M.; Gottschalk, E.E.; Gutierrez, G.; Hartouni, E.P.; Holmes, Stephen D.; Huson, F.R.; Jensen, D.A.; Knapp, B.C.; Kreisler, M.N.; Uribe, J.; Stern, B.J.; Wang, M.H.L.S.; Wehmann, A.; Wiencke, L.R.; White, J.T.; /Guanajuato U. /Fermilab /Nevis Labs, Columbia U. /Texas A-M /Massachusetts U.,

    2004-10-01

    The polarization of 1973 {Lambda}{sup 0}'s from the specific reaction pp {yields} p{Lambda}{sup 0}K{sup +}({pi}{sup +}{pi}{sup -}){sup 5} created by 27.5 Gev incident protons on a liquid hydrogen target, as a function of {chi}{sub F}, P{sub T}, and M{sub {Lambda}{sup 0}K{sup +}}, is, within statistics, consistent with the polarization of {Lambda}{sup 0}'s from pp {yields} P{sub fast} {Lambda}{sup 0}K{sup +} at 800 GeV.

  11. Tris(6-carb­oxy­pyridine-2-carboxyl­ato)terbium(III) 2.75-hydrate

    OpenAIRE

    Soumaila Zebret; Céline Besnard; Josef Hamacek

    2011-01-01

    In the title compound, [Tb(C7H4NO4)3]·2.75H2O, the Tb3+ atom is coordinated by three tridentate 6-carboxypyridine-2-carboxylate ligands and lies on a crystallographic threefold rotation axis. The coordination polyhedron around TbIII adopts a distorted tricapped trigonal–prismatic geometry. Disordered water molecules with partial occupancy are also present in the crystal, one of which is associated with each of the carboxylate O atoms of the complex unit.

  12. Neutral Hydrogen Absorption and Emission in the Quasar/Galaxy Pair 3C275.1/\\NGC4651

    OpenAIRE

    Schneider, Stephen E.; Corbelli, Edvige

    1993-01-01

    3C275.1 and \\NGC4651 make a particularly interesting quasar/galaxy pairing because of the alignment of such a strong radio emitter behind the outer H\\I disk of a relatively undisturbed spiral galaxy. This provides an opportunity to study the spin-temperature characteristics of atomic hydrogen at low column densities, in an apparently star-free environment. We previously reported a tentative detection of absorption against the quasar based on VLA C--array observations; we have now made more se...

  13. A microstructural investigation of gas atomized Raney type Al-27.5 at.% Ni catalyst precursor alloys

    Energy Technology Data Exchange (ETDEWEB)

    Mullis, A.M., E-mail: a.m.mullis@leeds.ac.uk [Institute for Materials Research, University of Leeds, Leeds LS2 9JT (United Kingdom); Bigg, T.D., E-mail: t.bigg@leeds.ac.uk [Institute for Materials Research, University of Leeds, Leeds LS2 9JT (United Kingdom); Adkins, N.J., E-mail: n.j.e.adkins@bham.ac.uk [IRC in Materials Processing, University of Birmingham, Edgbaston, Birmingham B15-2TT (United Kingdom)

    2015-11-05

    Quantitative image analysis has been used to investigate the phase composition of gas atomized powders of a Raney type Ni catalyst precursor alloys of composition Al-27.5 at.% Ni in the powder size range 150–212 μm. We find that there are considerable variations in phase composition both between powders from the same batch and as a function distance from the particle surface within individual particles. Such variations may have significant implications for the future production and uptake of such catalysts, including the necessity for post-production crushing of gas atomized powders. Models are proposed to account for both variations. - Highlights: • The phase composition of powder Raney-Ni catalysts has been investigated. • Image analysis is used to quantify differences between and within particles. • Phase composition can vary by up to 10% between the particle surface and centre. • Differences of up to 10% in the mean composition are also found between particles.

  14. THE RATIONALE FOR THE USE OF TWO-PHASE SWITCHES FOR THREE-PHASE CONNECTIONS OF DISTRIBUTIVE DEVICE 27.5 KV

    Directory of Open Access Journals (Sweden)

    Yu. Ya. Sheika

    2008-12-01

    Full Text Available On the basis of materials of scientists of Moscow and Petersburg State Universities of C Ways and NIIEFAENERGO Ltd.» the author of this article with additions has considered a practical possibility of us bipolar switches on three-phase connections of distributive device 27,5 кV.

  15. 41 CFR 102-37.275 - May a SASP accept personal checks and non-official payment methods in payment of service charges?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May a SASP accept personal checks and non-official payment methods in payment of service charges? 102-37.275 Section 102-37... non-official payment methods in payment of service charges? No, service charge payments must...

  16. 32 CFR Appendix M to Part 275 - Format for Certificate of Compliance With the Right to Financial Privacy Act of 1978

    Science.gov (United States)

    2010-07-01

    ... Right to Financial Privacy Act of 1978 M Appendix M to Part 275 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL... liability to the customer in connection with the disclosure of these financial records....

  17. 275例女性泌尿生殖道支原体感染及药敏分析

    Institute of Scientific and Technical Information of China (English)

    施根林; 刘金波; 凌玲; 李定宪

    2014-01-01

    目的:了解本地区女性泌尿生殖道支原体感染现状及常用抗菌药物的耐药性,为临床诊疗及合理用药提供依据。方法对2011年1月至2012年12月在妇科就诊的275例疑似支原体感染患者进行解脲支原体(U u )、人型支原体(M h )的培养鉴定及药敏试验,并进行统计分析。结果275例标本中阳性173例,总阳性率62.9%。在173例阳性患者中U u单一感染130例,占75.1%;M h单一感染5例,占2.9%;U u +M h混合感染38例,占22.0%。在12种常规测试的抗菌药物中,强力霉素(DOX )、美满霉素(MIN)和交沙霉素(JOS)敏感率均在90%以上;对氧氟沙星(OFL)、司帕沙星(SPA)、罗红霉素(ROX)、阿奇霉素(AZI)、克拉霉素(CLA)、螺旋霉素(ASP)和左氧氟沙星(LEV)的敏感性,单纯Uu感染患者明显高于Uu+Mh混合感染患者(P<0.01)。结论喹诺酮类药物已不适合作为经验用药的选择,DOX、M IN和JOS可作为治疗支原体感染的首选药物。对确诊为支原体感染的患者,应根据药敏结果合理使用敏感抗菌药物,根据实际情况及时调整用药,以减少和预防支原体耐药菌的产生。

  18. Revealing the Anti-Tumor Effect of Artificial miRNA p-27-5p on Human Breast Carcinoma Cell Line T-47D

    Directory of Open Access Journals (Sweden)

    Hsueh-Fen Juan

    2012-05-01

    Full Text Available microRNAs (miRNAs cause mRNA degradation or translation suppression of their target genes. Previous studies have found direct involvement of miRNAs in cancer initiation and progression. Artificial miRNAs, designed to target single or multiple genes of interest, provide a new therapeutic strategy for cancer. This study investigates the anti-tumor effect of a novel artificial miRNA, miR P-27-5p, on breast cancer. In this study, we reveal that miR P-27-5p downregulates the differential gene expressions associated with the protein modification process and regulation of cell cycle in T-47D cells. Introduction of this novel artificial miRNA, miR P-27-5p, into breast cell lines inhibits cell proliferation and induces the first “gap” phase (G1 cell cycle arrest in cancer cell lines but does not affect normal breast cells. We further show that miR P-27-5p targets the 3′-untranslated mRNA region (3′-UTR of cyclin-dependent kinase 4 (CDK4 and reduces both the mRNA and protein level of CDK4, which in turn, interferes with phosphorylation of the retinoblastoma protein (RB1. Overall, our data suggest that the effects of miR p-27-5p on cell proliferation and G1 cell cycle arrest are through the downregulation of CDK4 and the suppression of RB1 phosphorylation. This study opens avenues for future therapies targeting breast cancer.

  19. Study of {Lambda}{sup 0} polarization in exclusive {ital pp} reactions at 27.5 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Felix, J.; Avilez, C.; Moreno, G. [Universidad de Guanajuato, Leon, Guanajuato (Mexico); Hartouni, E.P.; Jensen, D.A.; Kreisler, M.N.; Uribe, J.; Wang, M.H. [University of Massachusetts, Amherst, Massachusetts (United States); Christian, D.C.; Gutierrez, G.; Holmes, S.D.; Wehmann, A. [Fermilab, Batavia, Illinois (United States); Church, M.D.; Gottschalk, E.E.; Knapp, B.C.; Stern, B.J.; Wiencke, L.R. [Columbia University, Nevis Labs, New York (United States); Forbush, M.; Huson, F.R.; White, J.T. [Department of Physics, Texas AM University, College Station, Texas 77843 (United States)

    1998-10-01

    We report a measurement of the x{sub F} and P{sub T}{Lambda}{sup 0} polarization dependence; {Lambda}{sup 0}{close_quote}s were produced in the specific channels: pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}, pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}, pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}, and pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}} with 27.5 GeV/c protons incident on a liquid hydrogen target. We find that {Lambda}{sup 0} polarization is independent of the final state. {copyright} {ital 1998 American Institute of Physics.}

  20. {Lambda}{sup 0} polarization in exclusive {ital pp} reactions at 27.5 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Felix, J.; Avilez, C.; Moreno, G. [Universidad de Guanajuato, Leon, Guanajuato (Mexico); Jensen, D.A.; Uribe, J.; Kreisler, N.M.; Wang, M.H.L.S. [University of Massachusetts, Amherst, Massachusetts (United States); Gutierrez, G.; Holmes, S.D.; Wehmann, A. [Fermilab, Batavia, Illinois (United States); Gottschalk, E.E.; Knapp, B.C.; Stern, B.J.; Wiencke, L.R. [Columbia University, Nevis Labs, New York (United States); Huson, F.R.; White, J.T. [Department of Physics, Texas AM University, College Station, Texas 77843 (United States)

    1998-10-01

    In {Lambda}{sup 0}{close_quote}s created from the specific reactions: pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}, pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}, pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}, and pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}, using 27.5 GeV/c proton beam incident on a liquid hydrogen target, we measured {Lambda}{sup 0} polarization as a function of x{sub F} and P{sub T}. We found that {Lambda}{sup 0} polarization is independent of any particular final state and of any specific mechanism responsible of producing {Lambda}{sup 0}. {copyright} {ital 1998 American Institute of Physics.}

  1. PTF 13efv - An outburst 500 days prior to the SNHunt 275 explosion and its radiative efficiency

    CERN Document Server

    Ofek, E O; Shaviv, N J; Duggan, G; Strotjohann, N -L; Rubin, A; Kulkarni, S R; Gal-Yam, A; Sullivan, M; Cao, Y; Nugent, P E; Kasliwal, M M; Sollerman, J; Fransson, C; Filippenko, A V; Perley, D A; Yaron, O; Laher, R

    2016-01-01

    The progenitors of some supernovae (SNe) exhibit outbursts with super-Eddington luminosities prior to their final explosions. This behavior is common among Type IIn SNe, but the driving mechanisms of these precursors are not yet well understood. SNHunt 275 was announced as a possible new SN during May 2015. Here we report on pre-explosion observations of the location of this event by the Palomar Transient Factory (PTF) and report the detection of a precursor about 500 days prior to the 2015 May activity (PTF 13efv). The observed velocities in the 2015 transient and its 2013 precursor absorption spectra are low (1000-2000 km/s), so it is not clear yet if the recent activity indeed marks the final disruption of the progenitor. Regardless of the nature of this event, we use the PTF photometric and spectral observations, as well as Swift-UVOT observations, to constrain the efficiency of the radiated energy relative to the total kinetic energy of the precursor. We find that, using an order-of-magnitude estimate an...

  2. The Sloan Digital Sky Survey COADD: 275 deg2 of deep Sloan Digital Sky Survey imaging on stripe 82

    International Nuclear Information System (INIS)

    We present details of the construction and characterization of the coaddition of the Sloan Digital Sky Survey (SDSS) Stripe 82 ugriz imaging data. This survey consists of 275 deg2 of repeated scanning by the SDSS camera over –50° ≤ α ≤ 60° and –1.°25 ≤ δ ≤ +1.°25 centered on the Celestial Equator. Each piece of sky has ∼20 runs contributing and thus reaches ∼2 mag fainter than the SDSS single pass data, i.e., to r ∼ 23.5 for galaxies. We discuss the image processing of the coaddition, the modeling of the point-spread function (PSF), the calibration, and the production of standard SDSS catalogs. The data have an r-band median seeing of 1.''1 and are calibrated to ≤1%. Star color-color, number counts, and PSF size versus modeled size plots show that the modeling of the PSF is good enough for precision five-band photometry. Structure in the PSF model versus magnitude plot indicates minor PSF modeling errors, leading to misclassification of stars as galaxies, as verified using VVDS spectroscopy. There are a variety of uses for this wide-angle deep imaging data, including galactic structure, photometric redshift computation, cluster finding and cross wavelength measurements, weak lensing cluster mass calibrations, and cosmic shear measurements.

  3. First firm spectral classification of an early-B pre-main-sequence star: B275 in M17

    CERN Document Server

    Ochsendorf, B B; Chini, R; Hartoog, O E; Hoffmeister, V; Waters, L B F M; Kaper, L

    2011-01-01

    The optical to near-infrared (300 - 2500 nm) spectrum of the candidate massive Young Stellar Object (YSO) B275, embedded in the star forming region M17, has been observed with X-shooter on the ESO Very Large Telescope. The spectrum includes both photospheric absorption lines and emission features (H and Ca triplet emission lines, 1st and 2nd overtone CO bandhead emission), as well as an infrared excess indicating the presence of a (flaring) circumstellar disk. The strongest emission lines are double-peaked with a peak separation ranging between 70 and 105 km s^-1 and provide information on the physical structure of the disk. The underlying photospheric spectrum is classified as B6-B7, significantly cooler than a previous estimate based on modeling of the spectral energy distribution. This discrepancy is solved by allowing for a larger stellar radius (i.e. a bloated star), and thus positioning the star above the main sequence. This constitutes the first firm spectral classification of an early-B pre-main-seque...

  4. The dissociative photoionization of hydrogen via two-electron excitation at 27.5 eV and 30.5 eV

    International Nuclear Information System (INIS)

    The kinetic energy spectra of the protons produced in the dissociative photoionization of H2 directed predominantly along the E vector of a photon beam have been measured at photon energies of 27.5 and 30.5 eV. Protons arising from autoionization of the lowest two-electron excited states exhibit an energy distribution which, unlike previous experimental results, is in accord with theory. (Author)

  5. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Supplement 27 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for a license to operate Diablo Canyon Nuclear Power Plant, Unit 1 (Docket No. 50-275), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement addresses the revisions to the license conditions and to the Technical Specifications as they relate to Amendment 10 to Diablo Canyon, Unit 1 Facility Operating License, DPR-76

  6. The temperature evolution of the out-of-plane correlation lengths of charge-stripe ordered La1.725Sr0.275NiO4

    DEFF Research Database (Denmark)

    Freeman, P.G.; Christensen, Niels Bech; Prabhakaran, D.;

    2010-01-01

    The temperature dependence of the magnetic order of stripe-ordered La1.725Sr0.275NiO4 is investigated by neutron diffraction. Upon cooling, the widths of the magnetic Bragg peaks are observed to broaden. The degree of broadening is found to be very different for l = odd-integer and l = even......-integer magnetic peaks. We argue that the observed behaviour is a result of competition between magnetic and charge order....

  7. Influenza A(H1N1)pdm09 virus exhibiting enhanced cross-resistance to oseltamivir and peramivir due to a dual H275Y/G147R substitution, Japan, March 2016.

    Science.gov (United States)

    Takashita, Emi; Fujisaki, Seiichiro; Shirakura, Masayuki; Nakamura, Kazuya; Kishida, Noriko; Kuwahara, Tomoko; Shimazu, Yukie; Shimomura, Takeshi; Watanabe, Shinji; Odagiri, Takato

    2016-06-16

    An influenza A(H1N1)pdm09 virus carrying a G147R substitution in combination with an H275Y substitution in the neuraminidase protein, which confers cross-resistance to oseltamivir and peramivir, was detected from an immunocompromised inpatient in Japan, March 2016. This dual H275Y/G147R mutant virus exhibited enhanced cross-resistance to both drugs compared with the single H275Y mutant virus and reduced susceptibility to zanamivir, although it showed normal inhibition by laninamivir. PMID:27336226

  8. Mutation (G275E) of the nicotinic acetylcholine receptor α6 subunit is associated with high levels of resistance to spinosyns in Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae).

    Science.gov (United States)

    Silva, Wellington M; Berger, Madeleine; Bass, Chris; Williamson, Martin; Moura, Danielle M N; Ribeiro, Lílian M S; Siqueira, Herbert A A

    2016-07-01

    The tomato leafminer, Tuta absoluta, now a major pest of tomato crops worldwide, is primarily controlled using chemical insecticides. Recently, high levels of resistance to the insecticide spinosad have been described in T. absoluta populations in Brazil. Selection of a resistant field-collected strain led to very high levels of resistance to spinosad and cross-resistance to spinetoram, but not to other insecticides that target the nicotinic acetylcholine receptor (nAChR). In this study the mechanisms underlying resistance to spinosad were investigated using toxicological, biochemical and molecular approaches. Inhibition of metabolic enzymes using synergists and biochemical assessment of detoxification enzyme activity provided little evidence of metabolic resistance in the selected strain. Cloning and sequencing of the nAChR α6 subunit from T. absoluta, the spinosad target-site, from susceptible and spinosad-resistant strains were done to investigate the role of a target-site mechanism in resistance. A single nucleotide change was identified in exon 9 of the α6 subunit of the resistant strain, resulting in the replacement of the glycine (G) residue at position 275 observed in susceptible T. absoluta strains with a glutamic acid (E). A high-throughput DNA-based diagnostic assay was developed and used to assess the prevalence of the G275E mutation in 17 field populations collected from different geographical regions of Brazil. The resistant allele was found at low frequency, and in the heterozygous form, in seven of these populations but at much higher frequency and in the homozygous form in a population collected in the Iraquara municipality. The frequency of the mutation was significantly correlated with the mortality of these populations in discriminating dose bioassays. In summary our results provide evidence that the G275E mutation is an important mechanism of resistance to spinosyns in T. absoluta, and may be used as a marker for resistance monitoring in

  9. Blockade of the ERK pathway enhances the therapeutic efficacy of the histone deacetylase inhibitor MS-275 in human tumor xenograft models

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, Toshiaki; Ozaki, Kei-ichi; Fujio, Kohsuke; Kajikawa, Shu-hei [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Uesato, Shin-ichi [Department of Biotechnology, Faculty of Engineering, Kansai University, Osaka 564-8680 (Japan); Watanabe, Kazushi [Proubase Technology Inc., Kanagawa 211-0063 (Japan); Tanimura, Susumu [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Koji, Takehiko [Department of Histology and Cell Biology, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8523 (Japan); Kohno, Michiaki, E-mail: kohnom@nagasaki-u.ac.jp [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Proubase Technology Inc., Kanagawa 211-0063 (Japan); Kyoto University Graduate School of Pharmaceutical Sciences, Kyoto 606-8501 (Japan)

    2013-04-19

    Highlights: •Blockade of the ERK pathway enhances the anticancer efficacy of HDAC inhibitors. •MEK inhibitors sensitize human tumor xenografts to HDAC inhibitor cytotoxicity. •Such the enhanced efficacy is achieved by a transient blockade of the ERK pathway. •This drug combination provides a promising therapeutic strategy for cancer patients. -- Abstract: The ERK pathway is up-regulated in various human cancers and represents a prime target for mechanism-based approaches to cancer treatment. Specific blockade of the ERK pathway alone induces mostly cytostatic rather than pro-apoptotic effects, however, resulting in a limited therapeutic efficacy of the ERK kinase (MEK) inhibitors. We previously showed that MEK inhibitors markedly enhance the ability of histone deacetylase (HDAC) inhibitors to induce apoptosis in tumor cells with constitutive ERK pathway activation in vitro. To evaluate the therapeutic efficacy of such drug combinations, we administered the MEK inhibitor PD184352 or AZD6244 together with the HDAC inhibitor MS-275 in nude mice harboring HT-29 or H1650 xenografts. Co-administration of the MEK inhibitor markedly sensitized the human xenografts to MS-275 cytotoxicity. A dose of MS-275 that alone showed only moderate cytotoxicity thus suppressed the growth of tumor xenografts almost completely as well as induced a marked reduction in tumor cellularity when administered with PD184352 or AZD6244. The combination of the two types of inhibitor also induced marked oxidative stress, which appeared to result in DNA damage and massive cell death, specifically in the tumor xenografts. The enhanced therapeutic efficacy of the drug combination was achieved by a relatively transient blockade of the ERK pathway. Administration of both MEK and HDAC inhibitors represents a promising chemotherapeutic strategy with improved safety for cancer patients.

  10. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Supplement 34 to the Safety Evaluation Report for the application by Pacific Gas and Electric Company (PG ampersand E) for licenses to operate Diablo Canyon Nuclear Power Plant, Unit Nos. 1 and 2 (Docket Nos. 50-275 and 50-323, respectively) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement documents the NRC staff review of the Long-Term Seismic Program conducted by PG ampersand E in response to License Condition 2.C.(7) of Facility Operating License DPR-80, the Diablo Canyon Unit 1 operating license. 111 refs., 20 figs., 31 tabs

  11. Pressure effect of glass transition temperature in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk metallic glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Roseker, W.; Sikorski, M.;

    2004-01-01

    was detected from the change of the slope of peak position as a function of temperature. It is found that the glass transition temperature increases with pressure by 4.4 K/GPa for the Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass, and the supercooled liquid range decreases with pressure by 2.9 K/GPa in a pressure...... range of 0-2.2 GPa. This method opens a possibility to study the pressure effect of glass transition process in glassy systems under high pressures (>1 GPa). (C) 2004 American Institute of Physics....

  12. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Supplement 21 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the status of the staffs resolution of outstanding allegations or concerns pertaining to Diablo Canyon as directed by the Commission on October 28, 1983. The status of a number of the allegations or concerns are considered sensitive and not addressed here since disclosure would impede possible enforcement actions or identify allegers that have requested anonymity

  13. 组蛋白去乙酰化酶抑制剂MS-275对创伤性脑损伤大鼠的神经保护作用%Neuroprotective effect of histone deacetylases inhibitor MS-275 following traumatic brain injury in rats

    Institute of Scientific and Technical Information of China (English)

    曹鹏; 宋振全; 于春泳; 冯思哲; 胡国汉; 卢亦成

    2013-01-01

    目的 探讨组蛋白去乙酰化酶(histone deacetylases,HDAC)抑制剂MS-275对大鼠中度创伤性颅脑损伤(traumatic brain injury,TBI)的神经保护作用. 方法 68只SD成年雄性大鼠按随机数字表法分为4组:无损伤对照+安慰剂组(对照组)、脑损伤+安慰剂组(损伤组)、脑损伤+ 15mg/kg MS-275组(治疗Ⅰ组)和脑损伤+45mg/kg MS-275组(治疗Ⅱ组).大鼠侧方液压打击装置诱导形成中度实验性TBI模型.MS-275溶解于二甲基亚砜中,15,45 mg/kg两种浓度的MS-275伤后连续7d(1次/d)腹腔注射大鼠体内,首次给药于伤后30 min完成.伤后记录各组大鼠体重变化,伤后10 ~ 14 d行Morris水迷宫测试评估大鼠空间探索及记忆存储功能.脑组织经提取固定后通过免疫组化及甲酚紫组织染色方法比较不同组别海马CA2 ~3区乙酰化组蛋白H3水平和存活神经细胞数量的差异. 结果 与对照组比较,其余3组伤后前3d体重均显著下降(P<0.05),伤后4~5d体重逐渐增加至伤前基础体重水平,但各组间差异无统计学意义(F=0.149,P>0.05).行为学测试结果显示,与损伤组比较,两治疗组均可明显改善大鼠伤后认知行为表现(P<0.01).组织染色结果显示,两治疗组均可明显增加脑组织乙酰化组蛋白H3水平,与对照组比较差异无统计学意义;伤后14 d两治疗组均表现出脑组织海马CA2 ~3区神经细胞存活数量增加的趋势(P>0.05). 结论 MS-275可显著改善大鼠TBI后急性期乙酰化组蛋白水平及认知行为功能,同时改善TBI后的病理变化,对神经起到一定的保护作用.%Objective To evaluate the neuroprotective benefits of histone deacetylases (HDAC)inhibitor MS-275 in rats with moderate traumatic brain injury (TBI).Methods Sixty-eight adult male SD rats were assigned to sham injury + placebo treatment (control group),TBI + placebo treatment (injury group),TBI + MS-275 (15 mg/kg) treatment (treatment group Ⅰ) and TBI + MS-275 (45

  14. 组蛋白去乙酰化酶抑制剂MS-275显著改变肝癌HepG2细胞中exosome免疫相关分子种类和含量%Histone deacetylase inhibitor MS-275 treatment alters immune molecule content and categories in hepatocarcinoma exosomes

    Institute of Scientific and Technical Information of China (English)

    李秋文; 郝怡鑫; 王如良; 宋林萍; 叶明; 肖文华; 萨仁高娃; 董伟伟; 赵惠霞; 段昕妤; 朱建华; 康欢荣; 付艳

    2012-01-01

    Objective To investigate the effects of the histone deacetylase inhibitor,MS-275,on the immune molecule content and categories in hepatocarcinoma exosomes.Methods Exosomes were isolated from the human hepatocarcinoma cell lines,HepG2 and Hep3b,and purified by a combination technique of ultrafiltration centrifugation and sucrose gradient ultracentrifugation.The expressions of heat shock protein (HSP)70,human leukocyte antigen (HLA)-I,HLA-DR,cluster of differentiation (CD) 80 and NY-ESO-1 on exosomes were analyzed with immunoelectron microscopy and Western blotting before and after MS-275 treatment.Intergroup differences were statistically analyzed by the Student's paired t-test.Results MS-275 treatment of both HepG2 and Hep3b cell types significantly increased the numbers of exosomes,their total protein content,and expression of HSP70,HLA-I and CD80 (per 100 exosomes),as compared to non-treated cells (all,P < 0.01).MS-275 was also found to induce de novo expression of HLA-DR,but had no significant effect on NY-ESO-1 expression (P > 0.05).The findings from immunoelecton microscopy confirmed those from Western blotting.Conclusion The histone deacetylase inhibitor,MS-275,can significantly alter the immune molecule content and categories in exosomes of hepatocarcinoma cells.The differential expression profile may reflect an anti-cancer immune response and represent molecular targets for novel anti-hepatoma therapeutic or preventative strategies.%目的 探讨组蛋白去乙酰化酶抑制剂MS-275修饰的肝癌细胞exosome所含肿瘤抗原和免疫分子的变化. 方法 采用蔗糖梯度离心联合超滤技术分离和纯化肝癌HepG2细胞在MS-275处理前后分泌的exosome,并用免疫电镜和Western blot杂交技术分别观察exosome表达热休克蛋白70、人类白细胞抗原(HLA)-I、HLA-II、NY-ESO-1和CD80等免疫分子的变化.MS-275处理前后样本均数的比较用配对t检验.结果 经MS-275处理后,肝癌HepG2细胞分泌exosome的

  15. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Supplement 20 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter of November 19, 1981 to the licensee. Specifically, Supplement 20 addresses those issues and other matters identified in Supplements 18 and 19 that must be resolved prior to Unit 1 achieving criticality and operating at power levels up to 5% of rated full power. This SER Supplement applies only to Diablo Canyon Unit 1

  16. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Suppl. 22

    International Nuclear Information System (INIS)

    Supplement 22 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. This supplement provides the criteria that were used by the staff to determine which of the allegations that have been evaluated and must be resolved prior to Unit 1 achieving criticality and operating at power level up to 5 percent of rated power (i.e., low power operation). The supplement also reports on the status of the staff's investigation, inspection and evaluation of 219 allegations or concerns that have been identified to the NRC as of March 9, 1984, excluding those recently received under 10 CFR 2.206 petitions

  17. Thermal conductivity measurement of suspended Si-N membranes from 10 K to 275 K using the 3ω-Völklein method

    International Nuclear Information System (INIS)

    The thermal properties of suspended thin films prepared by the micro-machining process have been measured using the 3ω dynamic method coupled to a Völklein geometry. A transducer (heater/thermometer) centered on the membrane is driven by an ac current causing periodic thermal oscillations. The measurement of the temperature oscillation on the membrane is made at the third harmonic using a Wheatstone bridge set up. Here by coupling the 3ω method to a Völklein geometry (suspended membrane) we obtained a highly sensitive technique to measure the thermal conductance with a resolution of (ΔK/K = 10−3) and a sensitivity of the order of nanoWatt/K, thanks to a very sensitive niobium nitride thermometry. This method is applied to measure the in-plane thermal conductivity of 100 nm silicon nitride membrane, in the temperature range of 10–275 K.

  18. The Histone Deacetylase Inhibitors MS-275 and SAHA Suppress the p38 Mitogen-Activated Protein Kinase Signaling Pathway and Chemotaxis in Rheumatoid Arthritic Synovial Fibroblastic E11 Cells

    Directory of Open Access Journals (Sweden)

    Hai-Shu Lin

    2013-11-01

    Full Text Available MS-275 (entinostat and SAHA (vorinostat, two histone deacetylase (HDAC inhibitors currently in oncological trials, have displayed potent anti-rheumatic activities in rodent models of rheumatoid arthritis (RA. To further elucidate their anti-inflammatory mechanisms, the impact of MS-275 and SAHA on the p38 mitogen-activated protein kinase (MAPK signaling pathway and chemotaxis was assessed in human rheumatoid arthritic synovial fibroblastic E11 cells. MS-275 and SAHA significantly suppressed the expression of p38α  MAPK, but induced the expression of MAPK phosphatase-1 (MKP-1, an endogenous suppressor of p38α  in E11 cells. At the same time, the association between p38α and MKP-1 was up-regulated and consequently, the activation (phosphorylation of p38α  was inhibited. Moreover, MS-275 and SAHA suppressed granulocyte chemotactic protein-2 (GCP-2, monocyte chemotactic protein-2 (MCP-2 and macrophage migration inhibitory factor (MIF in E11 cells in a concentration-dependent manner. Subsequently, E11-driven migration of THP-1 and U937 monocytes was inhibited. In summary, suppression of the p38 MAPK signaling pathway and chemotaxis appear to be important anti-rheumatic mechanisms of action of these HDAC inhibitors.

  19. Structure and expression of major histocompatibility complex-binding protein 2, a 275-kDa zinc finger protein that binds to an enhancer of major histocompatibility complex class I genes

    NARCIS (Netherlands)

    Veer, L.J. van 't; Lutz, P.M.; Isselbacher, K.J.; Bernards, R.A.

    1992-01-01

    We have isolated a cDNA encoding a transcription factor that binds to the enhancer of major histocompatibility complex (MHC) class I genes. MHC-binding protein 2 (MBP-2) is a 275-kDa protein, containing two sets of widely separated zinc fingers and a stretch of highly acidic amino acids, a putative

  20. Volumetric and viscometric study of aqueous binary mixtures of some glycol ethers at T = (275.15 and 283.15) K

    International Nuclear Information System (INIS)

    Graphical abstract: Highlights: → Study of aqueous solutions of glycol ethers at low temperatures is presented. → Glycol ethers are industrially important liquids. → Reduction in the volume was observed upon addition of all glycol ethers to water. → Glycol ethers act as structure makers in aqueous medium. - Abstract: The experimental data for the density (ρ) and viscosity (η) are reported for aqueous binary mixtures of different glycol ethers, namely ethylene glycol monomethyl ether (EGMME), ethylene glycol monoethyl ether (EGMEE), diethylene glycol monomethyl ether (DEGMME), and diethylene glycol monoethyl ether (DEGMEE), at different temperatures (T = 275.15 K and 283.15 K) within the concentration range 0 mol . kg-1 to 0.1 mol . kg-1. The values of density (ρ) and viscosity (η) of the solutions were used to compute different derived parameters, such as apparent molar volume (φV) of the solute, excess molar volume (VE) of the solution, viscosity B and D coefficients of solution and temperature coefficient of viscosity B-coefficient (dB/dT) of solution. The limiting apparent molar volume of the solutes (φV0) have been obtained for aqueous binary mixtures of these glycol ethers by smooth extrapolation of φV-m curves to zero concentration. By using the values of φV0, the limiting excess partial molar volumes (V-bar20E) have also been calculated. The results are interpreted in term of various interactions such as solute-solvent interactions and hydrogen bonding.

  1. Radiation effects on crystalline L-asparagine, revisited: Radical formation by EMR and periodic DFT after X-irradiation at 275 K

    International Nuclear Information System (INIS)

    Radical formation by X-irradiation of single crystals of L-asparagine monohydrate at 275 K has been investigated at 240 K and 295 K using Electron Paramagnetic Resonance (EPR), Electron Nuclear DOuble Resonance (ENDOR) and ENDOR-Induced EPR spectroscopic techniques. Free radical structures suggested by detailed analysis of the experimental data were assessed by Density Functional Theory calculations in a periodic approach. The combined experimental and computational evidence revealed three stable radical species at room temperature. Two of these could reliably be established as net H-abstracted species, one from the methylene group in the amino acid side chain and the second from the amino acid back-bone carbon atom. For the third room temperature radical species, a variety of deamination- and decarboxylation products were investigated and dismissed. Even if an unambiguous structure could not be established, this radical is tentatively suggested to descend from a side-chain O3-protonated amide anion by hydrogen atom transfer from the C3 to the C4 position. - Highlights: • Radicals in L-aspargine at 295 K investigated using EPR, ENDOR, EIE and DFT. • Radicals by net loss of H-atom from the backbone and sidechain are identified. • A possible successor from a primary side-chain amide anion has been observed. • Radical characterization has been supported by periodic boundary DFT calculations. • Deamination and decarboxylation radicals at room temperature were not observed

  2. Dynamic mechanical properties in a Zr46.8Ti13.8Cu12.5Ni10Be27.5 bulk metallic glass

    International Nuclear Information System (INIS)

    The dynamic mechanical response was investigated in a bulk metallic glass Zr46.8Ti13.8Cu12.5Ni10Be27.5 (called Vit4). Mechanical spectroscopy was performed either using continuous heating or isothermal measurements. A main visco-elastic relaxation is observed before the onset of crystallization. A drastic decrease of the storage modulus and a maximum of the loss modulus indicate this relaxation in the amorphous state. The very large activation energy (EA=4.5eV) and the very high value of the pre-exponential factor (τ0-1=2.5x10-35s) indicate that this relaxation involves the collective movement of a large number of atoms, as in many amorphous materials (polymers, oxide or molecular glasses). Master curves are plotted, indicating that the time-temperature superposition principle is obeyed. These master curves can be described using a physical model based on the concept of quasi-point defects. Finally, the elastic, visco-elastic and visco-plastic contributions to the deformation are separated and discussed

  3. Analysis of oseltamivir-resistant H275Y mutation in a novel A/H1N1 influenza virus strain%一株新型甲型H1N1流感病毒H275Y的奥司他韦耐药变异分析

    Institute of Scientific and Technical Information of China (English)

    苏彤; 李淑华; 鹿文英; 韩磊; 韩一芳; 曹广文

    2009-01-01

    Objective To elucidate the genetic characteristics and variations of glycosylation sites of neuraminidase (NA) gene of the novel A/H1N1 influenza pandemic virus in 2009. Methods The sequences of NA gene of 110 A/H1N1 influenza virus strains isolated at different time and locations were downloaded from NCBI database. MEGA4.0 software and NJ method were used for nucleotide sequence alignment, coding protein sequence alignment and the phylogenetic tree construction. Results The NA gene of the novel A/H1N1 influenza virus strains isolated from different areas in 2009 shared an extremely high homology of 99. 5%-100%, but it was different from that of A/human/H1N1 influenza virus. The novel A/H1N1 influenza virus strains and Europe A/swine/HlNl influenza virus strains shared a high homology of 89. 6% - 92. 9%, with similar glycosylation sites at 50, 58, 63, 68, 88, 146, 235 and 386. Moreover, the homology of NA gene between the novel A/H1N1 influenza virus and A/chicken/H5N1 influenza virus amounted to 83. 6% -85. 3%. Amino acid residues at the enzyme active sites of the NA were strictly conservative in most novel A/H1N1 influenza virus strains, still manifesting as R118, D151, R152, R225, E277, R293, R368, Y402, E119, R156, W179, S180, D199, 1223, E228, H275, E278, N295 and E425. Four strains isolated from Denmark, Japan, and HongKong and Hunan province showed a H275Y mutatioa The NA gene of the novel A/H1N1 influenza virus might originate from Europe A/swine/HlNl influenza virus, and had genetic relationship with A/ chicken/H5N1 influenza virus. Conclusions The novel A/H1N1 influenza pandemic virus in 2009 might be a reassorted virus rather than the result of gradual evolution of A/human/HlNl influenza virus. A novel A/H1N1 influenza virus strain isolated from Hunan has a H275Y mutation which might be oseltamivir resistant.%目的 探讨2009年新型甲型H1N1流感病毒神经氨酸酶(NA)基因的进化规律,分析NA蛋白酶活性位点以及糖基

  4. Study of {Lambda}{sup 0} Polarization in Four Different Exclusive pp Reactions at 27.5 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Felix, J.; Avilez, C.; Moreno, G. [Universidad de Guanajuato, Leon, Guanajuato (Mexico); Hartouni, E.P.; Jensen, D.A.; Kreisler, M.N.; Uribe, J.; Wang, M.H. [University of Massachusetts, Amherst, Massachusetts 01003 (United States); Christian, D.C.; Gutierrez, G.; Holmes, S.D.; Wehmann, A. [Fermilab, Batavia, Illinois 60510 (United States); Church, M.D.; Gottschalk, E.E.; Knapp, B.C.; Stern, B.J.; Wiencke, L.R. [Columbia University, Nevis Laboratories, Irvington, New York 10533 (United States); Forbush, M.; Huson, F.R.; White, J.T. [Department of Physics, Texas AM University, College Station, Texas 77843 (United States)

    1999-06-01

    We have measured the x{sub F} and P{sub T} dependence of the polarization of {Lambda}{sup 0} hyperons produced in exclusive final states pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +} {pi}{sup {minus}} , pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +} {pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}} , pp{r_arrow}p{Lambda}{sup 0}K{sup + }{pi}{sup +}{pi}{sup {minus}}{pi}{sup +} {pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}} , and pp{r_arrow}p{Lambda}{sup 0}K{sup +}{pi}{sup +} {pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus}}{pi}{sup +}{pi}{sup {minus} } at 27.5thinspthinspGeV/c . We present an empirical parametrization for {Lambda}{sup 0} polarization as a function of x{sub F} and P{sub T} : P=({minus}0.443{plus_minus}0.03 7)x{sub F}P{sub T} for {minus}1{le}x{sub F}{le}1 and 0{le}P{sub T}{le}1.8 GeV/ c . This parametrization is independent of the final state and provides a good description of the data. We note that the mechanism responsible for {Lambda}{sup 0} polarization appears to be independent of the production mechanism. {copyright} {ital 1999} {ital The American Physical Society}

  5. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 26

    International Nuclear Information System (INIS)

    Supplement 26 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection and evaluation of those allegations or concerns that have been identified to the NRC as of July 8, 1984. The report specifically addresses those allegations which the staff determined must be satisfactorily resolved prior to full power operation of Diablo Canyon Unit 1

  6. Safety-evaluation report related to the operation of Diablo Canyon Nuclear Power Plants, Units 1 and 2. Docket Nos. 50-275 and 50-323. Supplement No. 18

    International Nuclear Information System (INIS)

    Supplement 18 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter to the licensee

  7. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 28

    International Nuclear Information System (INIS)

    Supplement 28 to the Safety Evaluation Report for the Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of those allegations or concerns that have been identified to the NRC as of March 1, 1985

  8. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 25

    International Nuclear Information System (INIS)

    Supplement 25 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323) has been prepared by the Office of Nuclear Reactor Regulation (NRR) of the US Nuclear Regulatory Commission. This supplement reports on the staff's inspection and evaluation efforts on the matter of piping and piping supports as related to the seven technical license conditions in an Order Modifying License issued by NRR on April 18, 1984

  9. Re-Design Pompa Sentrifugal Double Admission dengan Fluida Kerja Semi Lean Benfield Solution (K2CO3 pada Kapasitas 700 m3/h dan Head 275.8 m, (STUDI KASUS : PT. PETROKIMIA GRESIK

    Directory of Open Access Journals (Sweden)

    Fathur Rahim

    2013-09-01

    Full Text Available Penggunaan pompa sentrifugal dalam dunia industri, khususnya di PT. Petrokimia Gresik memiliki peran yang sangat penting, terutama untuk memindahkan fluida kerja dari satu tempat ke tempat lain. PT. Petrokima Gresik dalam menggunakan jenis pompa untuk mengalirkan semi lean benfield solution ( yang berfungsi sebagai absorber dalam proses pembuatan amoniak. Seiring berjalannya waktu, kapasitas pompa sentrifugal double admission yang semula 582,3ingin ditingkatkan menjadi 700 Oleh karena itu, dilakukan perancangan ulang pompa sentrifugal double admission untuk fluida kerja semi lean benfield solution ( .Setelah itu dilakukan perancangan ulang pompa dengan data yang telah diolah meliputi perancangan poros, impeller dengan bentuk sudu double curvature, volute, pasak dan bearing. Dari perancangan ulang, didapatkan desain pompa sentrifugal double admission untuk fluida kerja semi lean benfield solution ( yang sesuai dengan kapasitas 700pada head 275,8 m serta daya BHP sebesar 886 Kwatt dengan effisiensi 74%.

  10. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 24

    International Nuclear Information System (INIS)

    Supplement 24 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the U.S. Nuclear Regulatory Commission. This supplement reports on the independent design verification program (IDVP) for Diablo Canyon Unit 1 that was performed between November 1981 and May 1984 in response to Commission Order CLI-81-30 and an NRC letter to the licensee of November 19, 1981 and its application by PG and E in the Internal Technical Program (ITP). Specifically, Supplement 25 presents the final resolution of the remaining issues and other matters identified in Supplements 18, 19 and 20. This SER Supplement applies only to Diablo Canyon Unit 1

  11. N33*++ isobar production and isospin 2 ππ interaction studied in the reaction π- p → p π+π-π- at 2.75 GeV/c

    International Nuclear Information System (INIS)

    A study of the reaction π- p → p π+π-π- at 2.75 GeV/c was carried out in an 81 cm liquid hydrogen bubble chamber at the CERN proton synchrotron. One observes that the abundant N33*++ (1236 MeV) isobar production occurs predominantly backwards in the center of mass of the reaction. This feature suggests a peripheral production mechanism with π exchange. The validity of this hypothesis, which allows the study of the π-π- interaction within the frame of the Chew and Low model, is verified. Among other results one finds for the isospin-2 state the values of the elastic ππ cross section and of the S and D wave phase shifts. (author)

  12. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 33

    International Nuclear Information System (INIS)

    Supplement 33 to the Safety Evaluation Report for the Pacific Gas and Electric Company's Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of allegations and concerns that have been identified to the NRC through March 1986. The report includes a complete listing of all allegations and concerns, indicating the status of their resolution. The NRC staff concludes that the technical issues raised in the allegations with regard to the design, construction, and safe operation of Diablo Canyon Units 1 and 2 have been satisfactorily resolved and no further action is required

  13. Construction and characterization of recombinant human adenovirus type 5 expressing foot-and-mouth disease virus capsid proteins of Indian vaccine strain, O/IND/R2/75

    Directory of Open Access Journals (Sweden)

    Ramesh Kumar

    2015-02-01

    Full Text Available Aim: Generation of recombinant human adenovirus type 5 expressing foot-and-mouth disease virus (FMDV capsid protein genes along with full-length 2B, 3B and 3Cpro and its characterization. Materials and Methods: FMD viral RNA isolation, cDNA synthesis, and polymerase chain reaction were performed to synthesize expression cassettes (P1-2AB3BCwt and P1-2AB3BCm followed by cloning in pShuttle-CMV vector. Chemically competent BJ5183-AD-1 cells were transformed with the recombinant pShuttle-CMV to produce recombinant adenoviral plasmids. HEK-293 cells were transfected with the recombinant adenoviral plasmids to generate recombinant adenoviruses (hAd5/P1-2AB3BCwt and hAd5/P1-2AB3BCm. Expression of the target proteins was analyzed by sandwich ELISA and indirect immunofluorescence assay. The recombinant adenoviruses were purified and concentrated by CsCl density gradient ultracentrifugation. Growth kinetics and thermostability of the recombinant adenoviruses were compared with that of non-recombinant replication-defective adenovirus (dAd5. Results: The recombinant adenoviruses containing capsid protein genes of the FMDV O/IND/R2/75 were generated and amplified in HEK-293 cells. The titer of the recombinant adenoviruses was approximately 108, 109.5 and 1011 TCID50/ml in supernatant media, cell lysate and CsCl purified preparation, respectively. Expression of the FMDV capsid protein was detectable in sandwich ELISA and confirmed by immunofluorescence assay. Growth kinetics of the recombinant adenoviruses did not reveal a significant difference when compared with that of dAd5. A decrement of up to 10-fold at 4°C and 21-fold at 37°C was recorded in the virus titers during 60 h incubation period and found to be statistically significant (p<0.01. Conclusion: Recombinant adenoviruses expressing capsid proteins of the FMDV O/IND/R2/75 were constructed and produced in high titers. In vitro expression of the target proteins in the adenovirus vector system was

  14. Physical aging in Zr46.75Ti8.25Cu7.5Ni10Be27.5 typical bulk metallic glass manifested as enthalpy relaxation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Enthalpy recovery is not only an important characteristic of physical aging of glass,but also a good tool to investigate the physical aging. Using differential scanning calorimeter (DSC),the enthalpy recovery of Zr46.75Ti8.25Cu7.5Ni10Be27.5 bulk metallic glass (BMG) was studied. The typical characteristics of enthalpy recovery of glass including the sub-Tg peak and ‘overshot’ were found in BMG. The evolution of the sub-Tg peak and ‘overshot’ were described by the free volume theory and Hodge’s model,respectively. It was found that the former failed to describe the enthalpy recovery in the BMG,while the latter could give a qualitative explanation. In com-bination with the dynamics in the BMG,the origin of the enthalpy recovery in the BMG was discussed. The results show that BMGs are an ideal material to investi-gate the physical aging. The further understanding of physical aging of BMGs is useful to clarify the nature of glass and improve the application and device of new types of BMGs.

  15. Physical aging in Zr46.75Ti8.25Cu7.5Ni10Be27.5 typical bulk metallic glass manifested as enthalpy relaxation

    Institute of Scientific and Technical Information of China (English)

    WEN Ping; ZHAO ZuoFeng; WANG WeiHua

    2008-01-01

    Enthalpy recovery is not only an important characteristic of physical aging of glass, but also a good tool to investigate the physical aging. Using differential scanning calorimeter (DSC), the enthalpy recovery of Zr46.75Ti8.25Cu7.5Ni10Be27.5 bulk metallic glass (BMG) was studied. The typical characteristics of enthalpy recovery of glass including the sub-Tg peak and 'overshot' were found in BMG. The evolution of the sub-Tg peak and 'overshot' were described by the free volume theory and Hodge's model, respectively. It was found that the former failed to describe the enthalpy recovery in the BeG, while the latter could give a qualitative explanation. In com-bination with the dynamics in the BMG, the origin of the enthalpy recovery in the BMG was discussed. The results show that BMGs are an ideal material to investi-gate the physical aging. The further understanding of physical aging of BMGs is useful to clarify the nature of glass and improve the application and device of new types of BMGs.

  16. Influence of long-term annealing on tensile properties and fracture of near-α titanium alloy Ti-6Al-2.75Sn-4Zr-0.4Mo-0.45Si

    International Nuclear Information System (INIS)

    Long-term exposure at 600 C of the near-alpha titanium alloy Ti-6Al-2.75Sn-4Zr-0.4Mo-0.45Si (TIMETAL 1100) influences tensile properties and fracture morphology due to microstructural changes by aging as well as environmentally induced effects. The influences of aging and oxygen penetration on the subsurface of the alloy were evaluated individually. Metallographic investigations, microhardness measurements, and Auger electron spectroscopy (AES) were performed to examine the oxygen-affected zone. Whereas ultimate tensile stress (UTS) and 0.2 pct yield stress (YS) are mainly influenced by aging at 600 C up to 1,000 hours in bimodal and lamellar microstructures, ductility sensitivity depends on oxygen embrittlement of the subsurface zone. Hereafter, little strain cracks are initiated which rapidly penetrate into the unaffected material. Fracture morphology which was investigated by scanning electron microscopy changes little during exposure. Ductile fracture exhibiting honeycomb morphology was observed on bimodal microstructure and interlamellar fracture with little ductile portion on lamellar microstructure. The oxygen-penetrated zone fails by brittle fracture

  17. Study of thermodynamic properties of aqueous binary mixtures of glycine, L-alanine and β-alanine at low temperatures (T = 275.15, 279.15, and 283.15) K

    International Nuclear Information System (INIS)

    Highlights: ► Study of aqueous solutions of amino acids at low temperatures is presented. ► Amino acids are biologically important compounds. ► Different interactions among solute and solvents have been investigated. ► Hydrogen bonding plays pivotal role in these systems. - Abstract: In the present communication, experimental values of density (ρ) and speed of sound (u) of aqueous solutions of three amino acids, namely glycine, L-alanine and β-alanine at different temperatures i.e.T = (275.15, 279.15, and 283.15) K are reported. From the experimental values, different derived parameters such as apparent molar volume of solute (φV), isentropic compressibility of solution (βS), apparent molar isentropic compressibility of solute (φKS) have been calculated. The limiting values of apparent molar volume of solute (φV0), apparent molar isentropic compressibility of solute (φKS0) and apparent molar expansivity (φE0) in the aqueous medium have also been obtained. The temperature coefficients of these limiting properties have also been computed. The results obtained were interpreted in terms of solute–solvent and solute–solute interactions, and structure making and structure breaking abilities of the solute in aqueous medium.

  18. Structural and magnetic properties of (Sm1-xPrx)3Fe27.5Ti1.5 [x=0.2, 0.5, 0.8, 1.0] and their nitrides

    International Nuclear Information System (INIS)

    (Sm1-xPrx)3Fe27.5Ti1.5 [x=0.2, 0.5, 0.8, 1.0] compounds belonging to the novel 3:29 class have been prepared in order to investigate the effects of the combination of rare earths having opposite signs of second-order Stevens coefficient on their structural and magnetic properties. The amounts of different phases have been estimated from the Rietveld analysis of powder X-ray diffractograms. The changes in the easy magnetization direction in these compounds are explained as the resultant of two competing anisotropies from the rare earths occupying the two crystallographically inequivalent sites, 2a and 4i. Nitrogenation has increased the saturation magnetization and Curie temperature which could be due to magnetovolume effect and the changes in the densities of states in the 3d band. Changes in the easy magnetization direction upon nitrogenation are due to the modification of rare earth anisotropy. 57Fe Moessbauer spectra have been analyzed in a Wigner-Seitz cell approach

  19. Rescue of infective virus from a genome-length cDNA clone of the FMDV serotype O (IND-R2/75) vaccine strain and its characterization.

    Science.gov (United States)

    Rajasekhar, R; Hosamani, Madhusudan; Basagoudanavar, Suresh H; Sreenivasa, B P; Tamil Selvan, R P; Saravanan, Paramasivam; Venkataramanan, Ramamurthy

    2013-08-01

    We report here the construction and characterization of an infectious cDNA clone of the Indian vaccine strain of foot and mouth disease virus (FMDV) serotype O, IND-R2/75. Viral genome was amplified by reverse transcription-polymerase chain reaction (RT-PCR) in five fragments and subsequently assembled sequentially in a plasmid vector to generate a complete cDNA clone, flanked by the T7 RNA polymerase promoter and poly (A) tail at 5' and 3' ends, respectively. Transfection of BHK-21 cells with the RNA transcribed from this genome-length cDNA construct allowed the recovery of infectious recombinant FMDV particles as evidenced by cytopathic effect in BHK-21 cells. Characterization of the recombinant virus revealed its similarity to the parental strain. Recombinant virus could be distinguished from the parental virus based on the presence of a unique marker sequence in the former, which was incorporated in the cDNA using a silent mutation. The virus showed no significant amino acid changes in the capsid-coding region when serially passaged up to ten times in BHK-21 cells, while retaining the marker sequence. PMID:23465777

  20. 7 CFR 275.14 - Review processing.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... schedules in the quality control review process. (b) Handbooks. The reviewer shall follow the procedures outlined in the Quality Control Review Handbook, FNS Handbook 310, to conduct quality control reviews....

  1. 48 CFR 211.275-2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... that— (1) Contain items in any of the following classes of supply, as defined in DoD 4140.1-R, DoD Supply Chain Materiel Management Regulation, AP1.1.11: (i) Subclass of Class I—Packaged operational... administrative and housekeeping supplies and equipment. (iii) Class IIIP—Packaged petroleum, lubricants,...

  2. BDML Metadata: 275 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics o...f wild-type embryo quantitative information about nuclear division dynamics in wild-type embryo C. elegans nuclear division dynamic

  3. Fully Enzymatic Membraneless Glucose|Oxygen Fuel Cell That Provides 0.275 mA cm(-2) in 5 mM Glucose, Operates in Human Physiological Solutions, and Powers Transmission of Sensing Data.

    Science.gov (United States)

    Ó Conghaile, Peter; Falk, Magnus; MacAodha, Domhnall; Yakovleva, Maria E; Gonaus, Christoph; Peterbauer, Clemens K; Gorton, Lo; Shleev, Sergey; Leech, Dónal

    2016-02-16

    Coimmobilization of pyranose dehydrogenase as an enzyme catalyst, osmium redox polymers [Os(4,4'-dimethoxy-2,2'-bipyridine)2(poly(vinylimidazole))10Cl](+) or [Os(4,4'-dimethyl-2,2'-bipyridine)2(poly(vinylimidazole))10Cl](+) as mediators, and carbon nanotube conductive scaffolds in films on graphite electrodes provides enzyme electrodes for glucose oxidation. The recombinant enzyme and a deglycosylated form, both expressed in Pichia pastoris, are investigated and compared as biocatalysts for glucose oxidation using flow injection amperometry and voltammetry. In the presence of 5 mM glucose in phosphate-buffered saline (PBS) (50 mM phosphate buffer solution, pH 7.4, with 150 mM NaCl), higher glucose oxidation current densities, 0.41 mA cm(-2), are obtained from enzyme electrodes containing the deglycosylated form of the enzyme. The optimized glucose-oxidizing anode, prepared using deglycosylated enzyme coimmobilized with [Os(4,4'-dimethyl-2,2'-bipyridine)2(poly(vinylimidazole))10Cl](+) and carbon nanotubes, was coupled with an oxygen-reducing bilirubin oxidase on gold nanoparticle dispersed on gold electrode as a biocathode to provide a membraneless fully enzymatic fuel cell. A maximum power density of 275 μW cm(-2) is obtained in 5 mM glucose in PBS, the highest to date under these conditions, providing sufficient power to enable wireless transmission of a signal to a data logger. When tested in whole human blood and unstimulated human saliva maximum power densities of 73 and 6 μW cm(-2) are obtained for the same fuel cell configuration, respectively. PMID:26750758

  4. Temperaturabhängigkeit der Beryllium-Selbstdiffusion und des freien Volumens im metallischen Massivglas Zr46,8Ti8,2Cu7,5Ni10Be27,5

    OpenAIRE

    Rehmet, Achim

    2001-01-01

    Seit der Entwicklung von massiven metallischen Gläsern wie z.B. der hier untersuchten Legierung Zr46,8Ti8,2Cu7,5Ni10Be27,5 (V4) ist es möglich, an metallischen Systemen nicht nur den Glaszustand, sondern auch den unterkühlt-flüssigen Zustand zu untersuchen. Im ersten Teil dieser Arbeit wurde mit Hilfe der Radiotracer-Methode und unter Verwendung des Isotops 7Be die Temperaturabhängigkeit der Beryllium-Selbstdiffusion in der stark unterkühlten Zr46,8Ti8,2Cu7,5Ni10Be27,5-Schmelze bestimmt. Die ...

  5. CONDIÇÕES HIGIÊNICAS DE FATIADORES DE FRIOS AVALIADAS POR ATP-BIOLUMINESCÊNCIA E CONTAGEM MICROBIANA: SUGESTÃO DE HIGIENIZAÇÃO CONFORME RDC 275 DA ANVISA

    Directory of Open Access Journals (Sweden)

    A. C. S. PIRES

    2009-01-01

    Full Text Available

    As superfícies de fatiadores de frios de sete estabelecimentos comerciais foram consideradas em condições higiênicas insatisfatórias tanto pela análise microbiológica convencional quanto pela técnica do ATP-bioluminescência, de acordo com as recomendações propostas pelas entidades científicas e pesquisas relacionadas, uma vez que não existem padrões estabelecidos pela legislação. As contagens microbianas alcançaram valores elevados, atingindo médias de 3,87 log UFC.cm-2, 1,89 log UFC.cm-2 e 0,86 log UFC.cm-2 , para mesófilos aeróbios, coliformes totais e Staphylococcus coagulase positiva, respectivamente. As contagens de fungos filamentosos e leveduras variaram de 1,58 a 3,88 log UFC.cm-2 e a maioria das contagens de Staphylococcus spp. variou de 2,88 a 3,80 log UFC.cm-2. Constatou-se uma elevada contagem de Staphylococcus spp., que pode ser originária de manipuladores com hábitos higiênicos inadequados, ou dos próprios alimentos fatiados, particularmente no caso de queijos. Uma sugestão de procedimento operacional padronizado (POP para os fatiadores com base na RDC 275/2002 da ANVISA foi disponibilizada aos responsáveis pela higienização dos estabelecimentos comerciais. No POP, foram enfatizados os produtos químicos e as ajudas de limpeza; freqüência e descrição completa do procedimento que inclui concentração, pH, tempo e temperatura de contato. Além do monitoramento do procedimento, medidas de correção e riscos de uma higienização incorreta foram apontados.

  6. Long-range ordering in the Bi 1-xAe xFeO 3-x/2 perovskites: Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75

    Science.gov (United States)

    Lepoittevin, C.; Malo, S.; Barrier, N.; Nguyen, N.; Van Tendeloo, G.; Hervieu, M.

    2008-10-01

    Two-ordered perovskites, Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75, have been stabilized and characterized by transmission electron microscopy, Mössbauer spectroscopy and X-ray powder diffraction techniques. They both exhibit orthorhombic superstructures, one with a≈ b≈2 ap and c≈3 ap (S.G.: Pb2 n or Pbmn) for the Sr-based compound and one with a≈ b≈2 ap and c≈8 ap (S.G.: B222, Bmm2, B2 mm or Bmmm) for the Ca-based one. The high-resolution transmission electron microscopy (HRTEM) images evidence the existence of one deficient [FeO x] ∞ layer, suggesting that Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75 behave differently compared to their Ln-based homolog. The HAADF-STEM images allow to propose a model of cation ordering on the A sites of the perovskite. The Mössbauer analyses confirm the trivalent state of iron and its complex environment with three types of coordination. Both compounds exhibit a high value of resistivity and the inverse molar susceptibility versus temperature curves evidence a magnetic transition at about 730 K for the Bi 1/3Sr 2/3FeO 2.67 and a smooth reversible transition between 590 and 650 K for Bi 1/2Ca 1/2FeO 2.75.

  7. Long-range ordering in the Bi1-xAexFeO3-x/2 perovskites: Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75

    International Nuclear Information System (INIS)

    Two-ordered perovskites, Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75, have been stabilized and characterized by transmission electron microscopy, Moessbauer spectroscopy and X-ray powder diffraction techniques. They both exhibit orthorhombic superstructures, one with a∼b∼2ap and c∼3ap (S.G.: Pb2n or Pbmn) for the Sr-based compound and one with a∼b∼2ap and c∼8ap (S.G.: B222, Bmm2, B2mm or Bmmm) for the Ca-based one. The high-resolution transmission electron microscopy (HRTEM) images evidence the existence of one deficient [FeOx]∞ layer, suggesting that Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75 behave differently compared to their Ln-based homolog. The HAADF-STEM images allow to propose a model of cation ordering on the A sites of the perovskite. The Moessbauer analyses confirm the trivalent state of iron and its complex environment with three types of coordination. Both compounds exhibit a high value of resistivity and the inverse molar susceptibility versus temperature curves evidence a magnetic transition at about 730 K for the Bi1/3Sr2/3FeO2.67 and a smooth reversible transition between 590 and 650 K for Bi1/2Ca1/2FeO2.75. - Graphical abstract: Complex long-range ordering of Bi/Ae cations and oxygen/vacancies consisting of 12-fold and 32-fold enlargement of the perovskite unit cell is observed in Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75, respectively

  8. Synthesis and crystal structure of new layered perovskite compounds: Li2La0.833(Nb1.5Ti0.5)O7 and Li2La2.25(Nb1.25Ti2.75)O13

    International Nuclear Information System (INIS)

    Single crystals of Li2La0.833(Nb1.5Ti0.5)O7 and Li2La2.25(Nb1.25Ti2.75)O13 were grown in the system Li2O-La2O3-Nb2O5-TiO2. Both these compounds crystallize in the space group P42/mmm (No 136), Z = 4: a = 5.5334(2), c = 18.3907(2) angstrom and a = 5.4915(6), and c = 33.812(4) angstrom, respectively. Their crystal structures, determined from single crystal X-ray diffraction data, are related to the Ruddlesden-Popper phases An+1BnO3n+1, which could be better written here as Li2[AxBnO3n+1]: Li2La0.833(Nb1.5Ti0.5)O7 is an n = 2 member and Li2La2.25(Nb1.25Ti2.75)O13 corresponds to an n = 4 member. In both structures, Nb5+ and Ti4+ ions statistically occupy distorted B octahedral sites of the perovskite, La3+ ions partially fill the cages of the perovskite, and Li+ ions are found in tetrahedral coordination between the perovskite layers

  9. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  10. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  11. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  12. 17 CFR 275.204-3 - Written disclosure statements.

    Science.gov (United States)

    2010-04-01

    ... hours prior to entering into any written or oral investment advisory contract with such client or... solely to the provision of investment advisory services (i) by means of written material or oral...) through the issuance of statistical information containing no expression of opinion as to the...

  13. Cruise Report, Townsend Cromwell, Cruise 02-01 (TC-275)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Personnel from the Coral Reef Ecosystem Investigation (CRED), Honolulu Laboratory (HL), National Marine Fisheries Service (NMFS), and NOAA conducted reef...

  14. Dicty_cDB: AFL275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tsrcsrcit npkssssftl**rirfnfhlwrlyql*ylhhq*m*lswrfmes*finksleatsl*cnqr trk*r*cqihlfrskstflnwwk*lsihqlygcmaf...EFTLAEVHSXNFRKS Frame B: ---ivqlkxxxspkqvnlmlsvvqlqpyqpsfvfqvplkliplflilsmdgnksm**vhh qpqeliiiytimkn*iqfspma...asisnisenvv*nll*qrftqxisgsp Frame C: ---sfs*sxxxlqnr*ilcfqwfnfnltslhscsrcp*n*yhcf*fcqwma...Value N AC116551 |AC116551.2 Dictyostelium discoideum chromosome 2 map complement(581327-427576) strain AX4,...ome 12 clone RP11-778E19 map 12, WORKING DRAFT SEQUENCE, 30 unordered pieces. 40 1.5 7 AC150448 |AC150448.1

  15. Dicty_cDB: SLA275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um Tdd-4 transposable element flanking sequence, clone p435 right end. 258 2e-64 1 AF063866 |AF063866.1 Melanoplus sanguini...*qffhlytedll iiqffh*nhflqymiysprlipsap*pktilqssk*slenl*clkrimsiiftifslqsa vhtlglnig...nrnksfit*kk*rcwifyyw*nriiqfynyn*niisfslqf r*s**yylsf**itrsfliiliixxfsqknivyivyhqvitlnylsi--- -...--ycksk**ynpiifiivlvlhlkkvtlkt*yhpikivniy*kfkpnqinhhhy*iqny *mi*llyq*igqimnyqiy**illilckrskyfknenikikitkhhii...uence update 1999. 1.12 Translated Amino Acid sequence aisisllhefhmwnqiiflmiyllqqiqqnmv*ykkkkkn*titiiv*iiyniswymnly ylmikikvgni

  16. 7 CFR 275.13 - Review of negative cases.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... month or effective for the sample month shall be selected for quality control review. These negative... reasons for denial, suspension or termination on the Negative Quality Control Review Schedule, Form...

  17. 7 CFR 275.10 - Scope and purpose.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Quality Control (QC) Reviews... responsible for conducting quality control reviews. For food stamp quality control reviews, a sample of... date, was correct. Quality control reviews measure the validity of food stamp cases at a given...

  18. Dicty_cDB: SSG275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YKYLVIEPNQT IDCNKLFLLESLVISYNSPINENSLFEHTQITPGNILPFYQVPLLPKV*tlkeke Translated Amino Acid sequence (All Fram...FSILKTLVMFSKYKYLVIEPNQT IDCNKLFLLESLVISYNSPINENSLFEHTQITPGNILPFYQVPLLPKV*tlkeke Homology vs CSM-cDNA Score E

  19. Dicty_cDB: VHD275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vkvlkkisimklkkrkdkknlerecgktk*skrcsktkn Translated Amino Acid sequence (All Frames) Frame A: nnnnnnnnnnnnnnk...n*rfkentkd*qqkvkvlkkisimklkkrkdkknlerecgktk*skrcsktkn Frame B: ttttttttttttttnktkitittsttttsrrtsfttyik***i*k

  20. 9 CFR 2.75 - Records: Dealers and exhibitors.

    Science.gov (United States)

    2010-01-01

    ... of, including by euthanasia; (vi) The official USDA tag number or tattoo assigned to a dog or cat..., death, euthanasia, or donation. (2) Each dealer and exhibitor shall use Record of Aquisition and...

  1. 25 CFR 275.3 - Methods for staffing.

    Science.gov (United States)

    2010-04-01

    ... OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT... the program to continue under Bureau operation in connection with a contract for other portions of the... between the tribal organization, the employee, and the Area Director or Commissioner. Assistance will...

  2. 49 CFR 234.275 - Processor-based systems.

    Science.gov (United States)

    2010-10-01

    ... made subject to 49 CFR part 236, subpart H, by submitting a Product Safety Plan as prescribed in § 236... justifications. The Product Safety Plan in accordance with 49 CFR 236.907—or a PTC Development Plan and PTC Safety Plan required to be filed in accordance with 49 CFR 236.1013 and 236.1015—must explain how...

  3. Dicty_cDB: CHP275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 34 3e-0...ence. 48 7e-05 17 CK808739 |CK808739.1 Rasgsc1529 Salivary Gland 4th instar 3rd period (spinning...808037 |CK808037.1 Rasgsc0316 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana

  4. 40 CFR 98.275 - Procedures for estimating missing data.

    Science.gov (United States)

    2010-07-01

    ... for estimating missing data. A complete record of all measured parameters used in the GHG emissions... maximum mass or fuel flow rate for the combustion unit, or the maximum mass or flow rate that the...

  5. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... adaptive management tool shall include: (1) A method for prioritizing monitoring projects that clearly...—indication of whale/dolphin/pinniped) (C) Number of individuals (D) Calves observed (y/n) (E) Initial...) Species (if not possible, indicate whale, dolphin or pinniped) (C) Number of individuals (D)...

  6. 7 CFR 275.12 - Review of active cases.

    Science.gov (United States)

    2010-01-01

    ... responsibility to report any changes in the exempt status of any household member. (e) Error analysis. The... Social Security Administration personnel shall be reviewed following standard procedures. This includes... contained in the case record, such as public utility companies, telephone company, employers, or...

  7. 综合治疗肩周炎275例疗效观察%Complex therapy bursitis in shoulder 275 example curative effect observation

    Institute of Scientific and Technical Information of China (English)

    康永华; 吴晓峰

    2011-01-01

    肩周炎是常见病,多发病,治疗方法有很多种,往往单一疗效不确定,严重影响患者生活质量.笔者根据多年临床经验和体会,总结一套行之有效的综合治疗肩周炎方法,能够较快缓解病痛,直至治愈.下面详细介绍治疗方法,以供参考应用.

  8. Productivity for 275 Nests in Florida During the 2006 Breeding Season

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This table shows the productivity of snowy plover at various locations in Florida during 2006. The largest number of nests was found at St. Joseph State Park.

  9. IAEA Newsbriefs. V. 12, no. 2(75). Apr-May 1997

    International Nuclear Information System (INIS)

    This issue gives brief information on the following topics: IAEA safeguards inspectorate granted broader rights, Conferences on nuclear liability, waste safety in early September, States set nuclear safety review meeting, Statements of IAEA Director General, Namibia joins anti-trafficking programme, Symposium on desalination in Republic of Korea, Energy issues on agenda of nuclear fuel cycle symposium in June, IAEA seminars and symposia this autumn, Recent IAEA publications, Atoms for animal health and productivity, Studying the past to learn about the future, Nuclear power status around the world, and other short information

  10. 17 CFR 275.206(3)-2 - Agency cross transactions for advisory clients.

    Science.gov (United States)

    2010-04-01

    ... advisory client, provided that such written consent is obtained after full written disclosure that with... (iv) the source and amount of any other remuneration received or to be received by the investment... may state whether any other remuneration has been or will be received and that the source and...

  11. 41 CFR 102-33.275 - Are there restrictions on replacing aircraft by exchange or sale?

    Science.gov (United States)

    2010-07-01

    ...). In your letter of request to GSA, you must include the full details of your situation and the... request and justify a waiver from GSA, Aircraft Management Policy Division (MTA), 1800 F Street,...

  12. Voice Biometrics over the Internet in the Framework of COST Action 275

    Directory of Open Access Journals (Sweden)

    Laurent Besacier

    2004-04-01

    Full Text Available The emerging field of biometric authentication over the Internet requires both robust person authentication and secure computer network protocols. This paper presents investigations of vocal biometric person authentication over the Internet, both at the protocol and authentication robustness levels. As part of this study, an appropriate client-server architecture for biometrics on the Internet is proposed and implemented. It is shown that the transmission of raw biometric data in this application is likely to result in unacceptably long delays in the process. On the other hand, by using data models (or features, the transmission time can be reduced to an acceptable level. The use of encryption/decryption for enhancing the data security in the proposed client-server link and its effects on the transmission time are also examined. Furthermore, the scope of the investigations includes an analysis of the effects of packet loss and speech coding on speaker verification performance. It is experimentally demonstrated that whilst the adverse effects of packet loss can be negligible, the encoding of speech, particularly at a low bit rate, can reduce the verification accuracy considerably. The paper details the experimental investigations conducted and presents an analysis of the results.

  13. ENGAGE- 501: phase II study of entinostat (SNDX-275) in relapsed and refractory Hodgkin lymphoma.

    Science.gov (United States)

    Batlevi, Connie Lee; Kasamon, Yvette; Bociek, R Gregory; Lee, Peter; Gore, Lia; Copeland, Amanda; Sorensen, Rachel; Ordentlich, Peter; Cruickshank, Scott; Kunkel, Lori; Buglio, Daniela; Hernandez-Ilizaliturri, Francisco; Younes, Anas

    2016-08-01

    Classical Hodgkin lymphoma treatment is evolving rapidly with high response rates from antibody-drug conjugates targeting CD30 and immune checkpoint antibodies. However, most patients do not achieve a complete response, therefore development of novel therapies is warranted to improve patient outcomes. In this phase II study, patients with relapsed or refractory Hodgkin lymphoma were treated with entinostat, an isoform selective histone deacetylase inhibitor. Forty-nine patients were enrolled: 33 patients on Schedule A (10 or 15 mg oral entinostat once every other week); 16 patients on Schedule B (15 mg oral entinostat once weekly in 3 of 4 weeks). Patients received a median of 3 prior treatments (range 1-10), with 80% of the patients receiving a prior stem cell transplant and 8% of patients receiving prior brentuximab vedotin. In the intention-to-treat analysis, the overall response rate was 12% while the disease control rate (complete response, partial response, and stable disease beyond 6 months) was 24%. Seven patients did not complete the first cycle due to progression of disease. Tumor reduction was observed in 24 of 38 (58%) evaluable patients. Median progression-free survival and overall survival was 5.5 and 25.1 months, respectively. The most frequent grade 3 or 4 adverse events were thrombocytopenia (63%), anemia (47%), neutropenia (41%), leukopenia (10%), hypokalemia (8%), and hypophosphatemia (6%). Twenty-five (51%) patients required dose reductions or delays. Pericarditis/pericardial effusion occurred in one patient after 12 cycles of therapy. Future studies are warranted to identify predictive biomarkers for treatment response and to develop mechanism-based combination strategies. (clinicaltrials.gov identifier: 00866333). PMID:27151994

  14. Alternative Training Options for Structurally Unemployed Older Workers. Information Series No. 275.

    Science.gov (United States)

    Helwig, Andrew A.

    The need for a national policy for the development and use of human resources is evident. One part of the human resource development issue centers around the needs of adult workers who are unemployed or threatended with unemployment because of structural changes in the labor market. The issue of retraining adult workers was examined in detail in…

  15. Determination of the curves, torque harnesses of performance of an agricultural tractor Massey Ferguson MF 275

    Energy Technology Data Exchange (ETDEWEB)

    Paula, Vanderson Rabelo de [Universidade de Sao Paulo (ESALQ/USP), Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz; Silva, Breno Alves; Santos, Thiago Castro Vidal dos; Porto, Rodrigo Padovani; Volpato, Carlos Eduardo Silva; Barbosa, Jackson Antonio [Universidade Federal de Lavras (UFLA), MG (Brazil)

    2008-07-01

    The globalization of the economy has approached the markets and one of the consequences of this approach is the entrance of new equipment and highly competitive machines in cost terms. This is the same reality of the Brazilian agricultural sector that today counts on new options of machines and very interesting implements of the point of view of the acquisition cost. In this context, this work aimed at the dynamometric assay of an agricultural tractor for attainment of its curves of torque, power using the B100 soybean fuels, B100 olive, B100 diesel. (author)

  16. 78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes

    Science.gov (United States)

    2013-01-03

    ... 12866, (2) Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... Directives; REIMS Aviation S.A. Airplanes AGENCY: Federal Aviation Administration (FAA), Department of Transportation (DOT). ACTION: Notice of proposed rulemaking (NPRM). SUMMARY: We propose to adopt a...

  17. RESULTS OF SURGICAL TREATMENT IN CERVICAL HERNIATED DISC ANALYSIS OF 275 CASES

    OpenAIRE

    L. Eva

    2010-01-01

    Background: Problems of surgical treatment of cervical disc hernia are still far from being resolved. It shows variety of surgical procedures it. The operations for cervical level with radiculopatie were quite limited. Limits method were dictated by the absence of accurate diagnosis, microsurgical methods, extensions, sometimes unjustified, conservative treatment. Material and method Complex issue of cervical spine degenerative pathologies, particularly cervical disc hernia with radicular syn...

  18. 17 CFR 275.0-5 - Procedure with respect to applications and other matters.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Procedure with respect to... with respect to applications and other matters. The procedure hereinbelow set forth will be followed with respect to any proceeding initiated by the filing of an application, or upon the Commission's...

  19. Seismic engineering -- 1994: Volume 2. PVP-Volume 275-2

    International Nuclear Information System (INIS)

    Volume 2 of this 2-volume set is divided into four main sections: Probability and risk-based seismic engineering analysis methods; New developments in equipment qualification methods; New developments in damping, base isolation, and active control of seismic systems; and Seismic, shock, and vibration isolation. Twenty-five papers have been processed separately for inclusion on the data base

  20. Seismic engineering -- 1994: Volume 1. PVP-Volume 275-1

    International Nuclear Information System (INIS)

    Volume 1 of this 2-volume set is divided into three main sections: Design rules for Section III piping; International trends in design and analysis; and New trends and advanced topics in the seismic analysis of piping, equipment, and components. Two additional papers by student participants are also included. Thirty papers have been processed separately for inclusion on the data base

  1. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  2. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  3. Technical specifications: Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Safety limits and limiting safety system settings are presented for the reactivity control systems; power distribution limits; instrumentation; reactor coolant system; emergency core cooling system; containment systems; plant systems; electrical power systems; refueling operations; special test exceptions; radioactive effluents; and radiological environmental monitoring

  4. Strong conservation of the bird Z chromosome in reptilian genomes is revealed by comparative painting despite 275 million years divergence

    Czech Academy of Sciences Publication Activity Database

    Pokorná, Martina; Giovannotti, M.; Kratochvíl, L.; Kasai, F.; Trifonov, V. A.; O'Brien, P. C. M.; Caputo, V.; Olmo, E.; Ferguson-Smith, M. A.; Rens, W.

    2011-01-01

    Roč. 120, č. 5 (2011), s. 455-468. ISSN 0009-5915 R&D Projects: GA ČR GAP506/10/0718 Institutional research plan: CEZ:AV0Z50450515 Keywords : Distantly related marsupials * Avian sex-hromosomes * karyotype relationships Subject RIV: EG - Zoology Impact factor: 3.847, year: 2011

  5. 49 CFR 178.275 - Specification for UN Portable Tanks intended for the transportation of liquid and solid hazardous...

    Science.gov (United States)

    2010-10-01

    ... stop-valve located as close to the shell as reasonably practicable. Other openings, except for openings leading to venting or pressure relief devices, must be equipped with either a stop-valve or another..., discharging, heating of the contents or fire. (2) Pressure relief devices must be designed to prevent...

  6. 33 CFR 207.275 - McClellan-Kerr Arkansas River navigation system: use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    .... If a towboat is not equipped with a radio or its radio is out of service, pilots shall furnish this... when navigation is passing over the dam. During daylight hours a yellow and black disc will be... deckhands shall maintain their stations while tows are moving adjacent to any part of a lock. They...

  7. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  8. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  9. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  10. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  11. Technical specifications Diablo Canyon Nuclear Power Plant, Unit No. 1 (Docket No. 50-275). Appendix A to License No. DPR-80

    International Nuclear Information System (INIS)

    This Appendix includes definitions, safety limits and limiting safety system settings, limiting conditions for opertion and surveillance requirements, bases, design features, and administrative controls

  12. Spin density matrix elements in exclusive $\\omega$ electroproduction on $^1$H and $^2$H targets at 27.5 GeV beam energy

    CERN Document Server

    Airapetian, A; Akopov, Z; Augustyniak, W; Avetissian, A; Blok, H P; Borissov, A; Bryzgalov, V; Capiluppi, M; Capitani, G P; Cisbani, E; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; Deconinck, W; De Leo, R; De Sanctis, E; Diefenthaler, M; Di Nezza, P; Düren, M; Ehrenfried, M; Elbakian, G; Ellinghaus, F; Etzelmüller, E; Fabbri, R; Felawka, L; Frullani, S; Gabbert, D; Gapienko, G; Gapienko, V; Garibaldi, F; Gavrilov, G; Gharibyan, V; Hartig, M; Hasch, D; Holler, Y; Hristova, I; Ivanilov, A; Jackson, H E; Joosten, S; Kaiser, R; Karyan, G; Keri, T; Kinney, E; Kisselev, A; Korotkov, V; Kozlov, V; Kravchenko, P; Krivokhijine, V G; Lagamba, L; Lapikás, L; Lehmann, I; Lenisa, P; Lorenzon, W; Ma, B -Q; Mahon, D; Manaenkov, S I; Mao, Y; Marianski, B; Marukyan, H; Movsisyan, A; Murray, M; Naryshkin, Y; Nass, A; Nowak, W -D; Pappalardo, L L; Perez-Benito, R; Petrosyan, A; Reimer, P E; Reolon, A R; Riedl, C; Rith, K; Rostomyan, A; Ryckbosch, D; Schäfer, A; Schnell, G; Schüler, K P; Seitz, B; Shibata, T -A; Stahl, M; Stancari, M; Statera, M; Steffens, E; Steijger, J J M; Taroian, S; Terkulov, A; Truty, R; Trzcinski, A; Tytgat, M; Van Haarlem, Y; Van Hulse, C; Vikhrov, V; Vilardi, I; Wang, S; Yaschenko, S; Yen, S; Zeiler, D; Zihlmann, B; Zupranski, P

    2014-01-01

    Exclusive electroproduction of $\\omega$ mesons on unpolarized hydrogen and deuterium targets is studied in the kinematic region of Q$^2$>1.0 GeV$^2$, 3.0 GeV < W < 6.3 GeV, and -t'< 0.2 GeV$^2$. Results on the angular distribution of the $\\omega$ meson, including its decay products, are presented. The data were accumulated with the HERMES forward spectrometer during the 1996-2007 running period using the 27.6 GeV longitudinally polarized electron or positron beam of HERA. The determination of the virtual-photon longitudinal-to-transverse cross-section ratio reveals that a considerable part of the cross section arises from transversely polarized photons. Spin density matrix elements are presented in projections of Q$^2$ or -t'. Violation of s-channel helicity conservation is observed for some of these elements. A sizable contribution from unnatural-parity-exchange amplitudes is found and the phase shift between those amplitudes that describe transverse $\\omega$ production by longitudinal and transvers...

  13. Spin density matrix elements in exclusive ω electroproduction on {sup 1}H and {sup 2}H targets at 27.5 GeV beam energy

    Energy Technology Data Exchange (ETDEWEB)

    Airapetian, A. [Justus-Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); University of Michigan, Randall Laboratory of Physics, Ann Arbor, MI (United States); Akopov, N.; Avetissian, A.; Elbakian, G.; Gharibyan, V.; Karyan, G.; Marukyan, H.; Petrosyan, A.; Taroian, S. [Yerevan Physics Institute, Yerevan (Armenia); Akopov, Z.; Borissov, A.; Deconinck, W.; Hartig, M.; Holler, Y.; Rostomyan, A.; Schueler, K.P.; Zihlmann, B. [DESY, Hamburg (Germany); Augustyniak, W.; Marianski, B.; Trzcinski, A.; Zupranski, P. [National Centre for Nuclear Research, Warsaw (Poland); Blok, H.P. [National Institute for Subatomic Physics (Nikhef), Amsterdam (Netherlands); VU University, Department of Physics and Astronomy, Amsterdam (Netherlands); Bryzgalov, V.; Gapienko, G.; Gapienko, V.; Ivanilov, A.; Korotkov, V. [Institute for High Energy Physics, Protvino, Moscow Region (Russian Federation); Capiluppi, M.; Ciullo, G.; Dalpiaz, P.F.; Lenisa, P.; Pappalardo, L.L.; Stancari, M.; Statera, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Ferrara, Ferrara (Italy); Universita di Ferrara, Dipartimento di Fisica e Scienze della Terra, Ferrara (Italy); Capitani, G.P.; De Sanctis, E.; Di Nezza, P.; Hasch, D.; Reolon, A.R. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, Frascati (Italy); Cisbani, E.; Frullani, S.; Garibaldi, F. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma, Gruppo Collegato Sanita, Rome (Italy); Istituto Superiore di Sanita, Roma (Italy); Contalbrigo, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Ferrara, Ferrara (Italy); De Leo, R.; Lagamba, L.; Vilardi, I. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, Bari (Italy); Diefenthaler, M. [Universitaet Erlangen-Nuernberg, Physikalisches Institut, Erlangen (Germany); University of Illinois, Department of Physics, Urbana, IL (United States); Dueren, M.; Ehrenfried, M.; Etzelmueller, E.; Keri, T.; Perez-Benito, R.; Stahl, M. [Justus-Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); Ellinghaus, F.; Kinney, E. [University of Colorado, Nuclear Physics Laboratory, Boulder, CO (United States); Fabbri, R.; Gabbert, D.; Hristova, I.; Nowak, W.D. [DESY, Zeuthen (Germany); Felawka, L.; Yen, S. [TRIUMF, Vancouver, BC (Canada); Gavrilov, G. [DESY, Hamburg (Germany); B.P. Konstantinov Petersburg Nuclear Physics Institute, Gatchina, Leningrad Region (Russian Federation); TRIUMF, Vancouver, BC (Canada); Jackson, H.E.; Reimer, P.E. [Argonne National Laboratory, Physics Division, Argonne, IL (United States); Joosten, S. [Ghent University, Department of Physics and Astronomy, Gent (Belgium); University of Illinois, Department of Physics, Urbana, IL (United States); Kaiser, R.; Lehmann, I.; Mahon, D.; Murray, M.; Seitz, B. [University of Glasgow, SUPA, School of Physics and Astronomy, Glasgow (United Kingdom); Kisselev, A.; Kravchenko, P.; Manaenkov, S.I.; Naryshkin, Y.; Vikhrov, V. [B.P. Konstantinov Petersburg Nuclear Physics Institute, Gatchina, Leningrad Region (Russian Federation); Kozlov, V.; Terkulov, A. [Lebedev Physical Institute, Moscow (Russian Federation); Krivokhijine, V.G. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Lapikas, L.; Steijger, J.J.M. [National Institute for Subatomic Physics (Nikhef), Amsterdam (NL); Lorenzon, W. [University of Michigan, Randall Laboratory of Physics, Ann Arbor, MI (US); Ma, B.Q.; Mao, Y.; Wang, S. [Peking University, School of Physics, Beijing (CN); Movsisyan, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Ferrara, Ferrara (IT); Yerevan Physics Institute, Yerevan (AM); Nass, A.; Rith, K.; Steffens, E.; Zeiler, D. [Universitaet Erlangen-Nuernberg, Physikalisches Institut, Erlangen (DE); Riedl, C. [DESY, Zeuthen (DE); University of Illinois, Department of Physics, Urbana, IL (US); Ryckbosch, D.; Tytgat, M.; Haarlem, Y. van [Ghent University, Department of Physics and Astronomy, Gent (BE); Schaefer, A. [Universitaet Regensburg, Institut fuer Theoretische Physik, Regensburg (DE); Schnell, G. [University of the Basque Country UPV/EHU, Department of Theoretical Physics, Bilbao (ES); Ghent University, Department of Physics and Astronomy, Gent (BE); IKERBASQUE, Basque Foundation for Science, Bilbao (ES)

    2014-11-15

    Exclusive electroproduction of ω mesons on unpolarized hydrogen and deuterium targets is studied in the kinematic region of Q{sup 2} > 1.0 GeV{sup 2}, 3.0 GeV < W < 6.3 GeV, and -t' < 0.2 GeV{sup 2}. Results on the angular distribution of the ω meson, including its decay products, are presented. The data were accumulated with the HERMES forward spectrometer during the 1996-2007 running period using the 27.6 GeV longitudinally polarized electron or positron beam of HERA. The determination of the virtual-photon longitudinal-to-transverse cross-section ratio reveals that a considerable part of the cross section arises from transversely polarized photons. Spin density matrix elements are presented in projections of Q{sup 2} or -t'. Violation of s-channel helicity conservation is observed for some of these elements. A sizable contribution from unnatural-parity-exchange amplitudes is found and the phase shift between those amplitudes that describe transverse ω production by longitudinal and transverse virtual photons, γ{sub L}{sup *} → ω{sub T} and γ{sub T}{sup *} → ω{sub T}, is determined for the first time. A hierarchy of helicity amplitudes is established, which mainly means that the unnatural-parity-exchange amplitude describing the γ{sub T}{sup *} → ω{sub T} transition dominates over the two natural-parityexchange amplitudes describing the γ{sub L}{sup *} → ω{sub L} and γ{sub T}{sup *} → ω{sub T} transitions, with the latter two being of similar magnitude. Good agreement is found between the HERMES proton data and results of a pQCD-inspired phenomenological model that includes pion-pole contributions, which are of unnatural parity. (orig.)

  14. Spin density matrix elements in exclusive ω electroproduction on {sup 1}H and {sup 2}H targets at 27.5 GeV beam energy

    Energy Technology Data Exchange (ETDEWEB)

    Airapetian, A. [Giessen Univ. (Germany). II. Physikalisches Inst.; Michigan Univ., Ann Arbor, MI (United States). Randall Lab. of Physics; Akopov, N. [Yerevan Physics Inst., Yerevan (Armenia); Akopov, Z. [DESY, Hamburg (Germany); Collaboration: The HERMES Collaboration; and others

    2014-07-15

    Exclusive electroproduction of ω mesons on unpolarized hydrogen and deuterium targets is studied in the kinematic region of Q{sup 2} >1.0 GeV{sup 2}, 3.0 GeV

  15. Crystal structure, thermal behaviour and parageneses of koninckite, FePO.sub.4./sub.•2.75H.sub.2./sub.O

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Majzlan, J.; Wierzbicka-Wieczorek, M.; Kiefer, B.

    2015-01-01

    Roč. 79, č. 5 (2015), s. 1159-1173. ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : koninckite * ferric phosphate * synchrotron diffraction * crystal structure * density- functional theory Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.026, year: 2014

  16. Results of bone marrow examination in 275 patients with histological features that suggest an indolent type of cutaneous B-cell lymphoma

    NARCIS (Netherlands)

    Senff, Nancy J.; Kluin-Nelemans, Hanneke C.; Willemze, Rein

    2008-01-01

    Whether or not bone marrow biopsies should be performed routinely in patients with skin lesions that show histological features consistent with an indolent B-cell lymphoma [marginal zone lymphoma (MZL) or follicle centre lymphoma (FCL)] has been debated. As no studies have addressed this question fo

  17. SU-E-T-275: Radiobiological Evaluation of Intensity Modulated Radiotherapy Treatment for Locally Advanced Head and Neck Squamous Cell Carcinomas

    International Nuclear Information System (INIS)

    Purpose: To evaluate the radiobiological outcome of Intensity Modulated Radiotherapy Treatment (IMRT) for locally advanced head and neck squamous cell carcinomas using HART (Histogram Analysis in Radiation Therapy; J Appl Clin Med Phys 11(1): 137–157, 2010) program and compare with the clinical outcomes. Methods: We have treated 20 patients of stage III and IV HNSCC Oropharynx and hypopharynx with accelerated IMRT technique and concurrent chemotherapy. Delineation of tumor and normal tissues were done using Danish Head and Neck Cancer Group (DAHANCA) contouring guidelines and radiotherapy was delivered to a dose of 70Gy in 35 fractions to the primary and involved lymph nodes, 63Gy to intermediate risk areas and 56 Gy to lower risk areas, Monday to Saturday, 6 Days/week using 6 MV Photons with an expected overall treatment time of 6 weeks. The TCP and NTCP's were calculated from the dose-volume histogram (DVH) statistics using the Poisson Statistics (PS) and JT Lyman models respectively and the Resultwas correlated with clinical outcomes of the patients with mean follow up of 24 months. Results: Using HART program, the TCP (0.89± 0.01) of primary tumor and the NTCP for parotids (0.20±0.12), spinal cord (0.05±0.01), esophagus (0.30±0.2), mandible (0.35±0.21), Oral cavity (0.37±0.18), Larynx (0.30±0.15) were estimated and correlated with clinical outcome of the patients. Conclusion: Accelerated IMRT with Chemotherapy is a clinical feasible option in the treatment of locally advanced HNSCC with encouraging initial tumour response and acceptable acute toxicities. The correlation between the clinical outcomes and radiobiological model estimated parameters using HART programs are found to be satisfactory

  18. SU-E-T-275: Radiobiological Evaluation of Intensity Modulated Radiotherapy Treatment for Locally Advanced Head and Neck Squamous Cell Carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Rekha Reddy, B.; Ravikumar, M.; Tanvir Pasha, C.R; Anil Kumar, M.R; Varatharaj, C. [Kidwai Memorial Institute of Oncology Bangalore, Karnataka (India); Pyakuryal, A [University Illinois at Chicago, Chicago, IL (United States); Narayanasamy, Ganesh [UTHSCSA, San Antonio, TX (United States)

    2014-06-01

    Purpose: To evaluate the radiobiological outcome of Intensity Modulated Radiotherapy Treatment (IMRT) for locally advanced head and neck squamous cell carcinomas using HART (Histogram Analysis in Radiation Therapy; J Appl Clin Med Phys 11(1): 137–157, 2010) program and compare with the clinical outcomes. Methods: We have treated 20 patients of stage III and IV HNSCC Oropharynx and hypopharynx with accelerated IMRT technique and concurrent chemotherapy. Delineation of tumor and normal tissues were done using Danish Head and Neck Cancer Group (DAHANCA) contouring guidelines and radiotherapy was delivered to a dose of 70Gy in 35 fractions to the primary and involved lymph nodes, 63Gy to intermediate risk areas and 56 Gy to lower risk areas, Monday to Saturday, 6 Days/week using 6 MV Photons with an expected overall treatment time of 6 weeks. The TCP and NTCP's were calculated from the dose-volume histogram (DVH) statistics using the Poisson Statistics (PS) and JT Lyman models respectively and the Resultwas correlated with clinical outcomes of the patients with mean follow up of 24 months. Results: Using HART program, the TCP (0.89± 0.01) of primary tumor and the NTCP for parotids (0.20±0.12), spinal cord (0.05±0.01), esophagus (0.30±0.2), mandible (0.35±0.21), Oral cavity (0.37±0.18), Larynx (0.30±0.15) were estimated and correlated with clinical outcome of the patients. Conclusion: Accelerated IMRT with Chemotherapy is a clinical feasible option in the treatment of locally advanced HNSCC with encouraging initial tumour response and acceptable acute toxicities. The correlation between the clinical outcomes and radiobiological model estimated parameters using HART programs are found to be satisfactory.

  19. 275 Efficacy of Omalizumab in the Treatment of Urticaria-Vasculitis Associated to Churg-Strauss Syndrome: A Case Report

    OpenAIRE

    Varricchi, Gilda; Detoraki, Aikaterini; Liccardo, Bianca; Spadaro, Giuseppe; de Paulis, Amato; Marone, Gianni; Triggiani, Massimo

    2012-01-01

    Background Churg-Strauss Syndrome (CCS) is a rare systemic necrotizing small vessel vasculitis associated with bronchial asthma, peripheral blood eosinophilia and eosinophilic lung infiltration. Skin changes compatible with vasculitis are present in about 75% of patients. Previous reports suggest that patients with CSS can be treated with anti-IgE (omalizumab) in addition to conventional therapy to achieve asthma control. Here we report the efficacy of a 6-month treatment with omalizumab in a...

  20. Formation of quasicrystals in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass

    DEFF Research Database (Denmark)

    Wanderka, N.; Macht, M. P.; Siedel, M.; Mechler, S.; Ståhl, Kenny; Jiang, Jianzhong

    2000-01-01

    transmission electron microscopy. The structure of the quasicrystals is determined to be primitive icosahedral with a quasilattice constant of 4.779 Angstrom. The quasicrystals decompose into several intermetallic compounds after prolonged annealing at lower temperatures or in a short time period (less than 5...

  1. Raouf Ibrahim, Liquid Sloshing Dynamics: Theory and Applications , Cambridge University Press, Cambridge (2005) ISBN 0-521-83885-1 pp. xxi+948, £160, US$275, hbk.

    Science.gov (United States)

    Ohayon, Roger

    2008-08-01

    The appearance of this book is an event. Written by Professor Raouf Ibrahim, an internationally recognized expert in nonlinear vibrations and random responses of liquid-free surface and more generally liquid sloshing dynamics, this book is particularly welcome as it appears as a monumental monograph on various phenomena occurring in sloshing problems, mostly based on analytical results and discussions resulting from various particular tank geometries. As a consequence, this book will be a useful complement to computational mechanics studies of free surface sloshing effects-linear and nonlinear, periodic and random-in earthquake engineering, civil engineering (storage tanks), aerospace engineering (such as liquid propelled launchers), nuclear engineering, naval and offshore engineering, etc.

  2. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Dockets Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    Supplement 29 to the Safety Evaluation Report for the application by the Pacific Gas and Electric Company to operate the Diablo Canyon Nuclear Power Plant - Unit 2 (Docket No. 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. SSER 29 reports on the PG and E Internal Review Program for the Unit 2 applicability and resolution of concerns that had been raised during the Unit 1 design verification by the Independent Design Verification Program, PG and E by the applicant's Internal Technical Program and by the staff of the US Nuclear Regulatory Commission

  3. A Comparison of Students' Achievement in Arithemtic with Their Algorithmic Confidence. Mathematics Education Diagnostic and Instructional Centre (MEDIC) Report No. 2-75.

    Science.gov (United States)

    MacKay, Irene Douglas

    The purpose of this study was to investigate the relationship between a student's confidence in his computational procedures for each of the four basic arithmetic operations and the student's achievement on computation problems. All of the students in grades 5 through 8 in one school system (a total of 6186 students) were given a questionnaire to…

  4. Danish Post‐Secondary Students Use Public Libraries for Study Purposes. A review of: Pors, Niels Ole. “The Public Library and Students’ Information Needs.” New Library World 107.1226/12272 (2006): 275‐85.

    OpenAIRE

    Julie McKenna

    2007-01-01

    Objective – To determine whether and how Danish university and higher education students use public libraries for studypurposes.Design – Online survey.Setting – Post‐secondary programs in Denmark.Subjects – 1,575 students in university‐level programs or other higher education programs (vocational three‐to‐four‐year programs) in Denmark.Methods – A sample of students was drawn from the national database of students by selecting every student born on the 15th of every month (approximately 4,900...

  5. Safety-evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 16

    International Nuclear Information System (INIS)

    This supplement addresses certain allegations received by the staff concerning safety deficiencies at the Diablo Canyon project, specifically those relative to design aspects of the component cooling water system (CCWS), including its seismic classification, single failure considerations, and its heat removal capabilities. It is based on the staff's re-review of the Diablo Canyon Final Safety Analysis Report (FSAR); on a site walkdown conducted on January 12, 1983; on information obtained during meetings with the applicant dated March 15, 18, and 25, April 4, 7, and 15, and May 3 and 18, 1983

  6. Spin density matrix elements in exclusive {rho}{sup 0} electroproduction on {sup 1}H and {sup 2}H targets at 27.5 GeV beam energy

    Energy Technology Data Exchange (ETDEWEB)

    Airapetian, A.; Deconinck, W.; Gliske, S.; Lorenzon, W. [University of Michigan, Randall Laboratory of Physics, Ann Arbor, MI (United States); Akopov, N.; Akopov, Z.; Avakian, R.; Avetissian, A.; Elbakian, G.; Gharibyan, V.; Marukyan, H.; Taroian, S. [Yerevan Physics Institute, Yerevan (Armenia); Andrus, A.; Lamb, R.; Linden-Levy, L.A.; Makins, N.C.R.; Rubin, J. [University of Illinois, Department of Physics, Urbana, IL (United States); Aschenauer, E.C.; Boettcher, H.; Fabbri, R.; Gabbert, D.; Gregor, I.M.; Guler, H.; Hristova, I.; Kopytin, M.; Liebing, P.; Negodaev, M.; Nowak, W.D.; Stewart, J. [DESY, Zeuthen (Germany); Augustyniak, W.; Marianski, B.; Trzcinski, A.; Zupranski, P. [Andrzej Soltan Institute for Nuclear Studies, Warsaw (Poland); Avetissian, E.; Bianchi, N.; Capitani, G.P.; De Sanctis, E.; Di Nezza, P.; Fantoni, A.; Funel, A.; Hadjidakis, C.; Hasch, D.; Muccifora, V.; Reolon, A.R.; Riedl, C. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare, Frascati (Italy); Belostotski, S.; Izotov, A.; Jgoun, A.; Kravchenko, P.; Manaenkov, S.I.; Naryshkin, Y.; Veretennikov, D.; Vikhrov, V. [Petersburg Nuclear Physics Institute, Gatchina, Leningrad Region (Russian Federation); Blok, H.P.; Hesselink, W.H.A. [National Institute for Subatomic Physics (Nikhef), Amsterdam (Netherlands); Vrije Universiteit, Department of Physics, Amsterdam (Netherlands); Bonomo, C.; Capiluppi, M.; Ciullo, G.; Contalbrigo, M.; Dalpiaz, P.F.; Giordano, F.; Grebeniouk, O.; Lenisa, P.; Pappalardo, L.L.; Stancari, M.; Statera, M. [Universita di Ferrara, Istituto Nazionale di Fisica Nucleare, Sezione di Ferrara (Italy); Dipartimento di Fisica, Ferrara (Italy); Borissov, A. [DESY, Zeuthen (Germany); Univ. of Glasgow, Dept. of Physics and Astronomy, Glasgow (United Kingdom); Bryzgalov, V.; Gapienko, G.; Gapienko, V.; Ivanilov, A.; Korotkov, V.; Salomatin, Y.; Tchuiko, B. [Inst. for High Energy Physics, Protvino, Moscow Region (Russian Federation)] (and others)

    2009-08-15

    Spin Density Matrix Elements (SDMEs) describing the angular distribution of exclusive {rho}{sup 0} electroproduction and decay are determined in the HERMES experiment with 27.6 GeV beam energy and unpolarized hydrogen and deuterium targets. Eight (fifteen) SDMEs that are related (unrelated) to the longitudinal polarization of the beam are extracted in the kinematic region 1

  7. Spin density matrix elements in exclusive {rho}{sup 0} electroproduction on {sup 1}H and {sup 2}H targets at 27.5 GeV beam energy

    Energy Technology Data Exchange (ETDEWEB)

    Airapetian, A. [Michigan Univ., Ann Arbor, MI (United States). Randall Lab. of Physics; Akopov, N.; Akopov, Z. [Yerevan Physics Inst. (AM)] (and others)

    2008-12-15

    Spin Density Matrix Elements (SDMEs) describing the angular distribution of exclusive {rho}{sup 0} electroproduction and decay are determined in the HERMES experiment with 27.6 GeV beam energy and unpolarized hydrogen and deuterium targets. Eight (fifteen) SDMEs that are related (unrelated) to the longitudinal polarization of the beam are extracted in the kinematic region 1 GeV{sup 2}

  8. Danish Post‐Secondary Students Use Public Libraries for Study Purposes. A review of: Pors, Niels Ole. “The Public Library and Students’ Information Needs.” New Library World 107.1226/12272 (2006: 275‐85.

    Directory of Open Access Journals (Sweden)

    Julie McKenna

    2007-09-01

    Full Text Available Objective – To determine whether and how Danish university and higher education students use public libraries for studypurposes.Design – Online survey.Setting – Post‐secondary programs in Denmark.Subjects – 1,575 students in university‐level programs or other higher education programs (vocational three‐to‐four‐year programs in Denmark.Methods – A sample of students was drawn from the national database of students by selecting every student born on the 15th of every month (approximately 4,900 students. A letter describing the study and with an invitation to fill out an online questionnaire was sent to all students in the sample. There were 1,694 valid responses (approximately 35% response rate. Students following short vocational programs were deemed to be under‐represented and these subjects were omitted from the analysis of this report,which reflects the response of 1,575 students. The online questionnaire gathered demographic details (gender, age, educational institution, study topic, study year, geographical location, access to the Internet, etc. and used 110 questions or statements to gather information about student information‐seeking behaviour related to study purposes. These included use of the physical library and satisfaction with services, use of search engines, awareness and use of library Web‐based services, study behaviour, and participation in information literacy activities. Main results – For the purposes of this study, “academic library is used as a generic term covering university libraries, research libraries, educational libraries and all other kind of libraries outside the field of public libraries” (p. 278. The survey results confirmed many of the previous international reports of student information‐seeking behaviour: 85% of students use the academic library for study purposes; fewer than 10% of all students are able to cope without any library use; students in technology and engineering, the sciences and arts, architecture and music have a higher rate of non‐use of their academic libraries; a large percentage of students access the electronic resources from home; the physical library is still considered important to students; Google is used extensively and is nearly the exclusive choice for search engine. The public library is used for study purposes by about 58 percent of all students with the highest use (76% by students in higher education institutions (HEI; students of education, social topics and psychology are very frequent public library users. Female students in HEI were the most frequent users of the public library independent of study subject or year, or any other demographic variable. Seven per cent of students rely exclusively on the public library for study purposes and first‐year HEI students in the subject areas of education, social topics and psychology are over‐represented in this group (which additionally has less Internet access from home than the other students. Students perceive nearly all aspects of service in the academic library as superior; HEI students rate ambience, electronic resources and speed of inter‐library loan provision in the public library as higher than the academic. University students give a low rating to the collections of public library, although the students use the public library principally to supplement the collections available in their academic libraries. Another high use of public libraries by HEI students is for interlibrary loans placed through the national resource sharing system. Public library reference services are used often by only one per cent of students and only two per cent use the public library on a regular basis for “study related group activities.” Conclusion – Students use physical libraries to a great extent to support their studies and students have embraced digital access to collections, especially access from home. Google is the most heavily used search engine and is used by nearly all students;use of Google complements and supplements library use. Nearly 60% of all students use public libraries for study purposes and to supplement the collections of their academic library, but they find that the public library collections are insufficient to meet their needs. The inter‐library loan policies of public libraries are more lenient and accommodating to student needs and may drive the high use of public libraries. Students form a large constituency of the public library user population and they generally rate most aspects of service as substandard to those of academic libraries. There is a call for review of the public library’s role in meeting the information needs of students, and in particular, those of HEI programs who are most dependent on the public library.

  9. Ramón GARRABOU et José Manuel NAREDO [dir.], La fertilización en los sistemas agrarios. Una perspectiva histórica, Madrid, Fundacion Argentaria/Visor, 1996, 275 p.

    OpenAIRE

    Mayaud, Jean-Luc

    2005-01-01

    Issu de deux rencontres entre historiens et techniciens à Ségovie en 1994 et 1995, cet ouvrage est consacré à la mise en perspective historique des actions de fertilisation des terres en Espagne aux XIXe et XXe siècles. Sont ainsi développées neuf contributions réparties par les directeurs de l'ouvrage en deux parties. La première aborde les problèmes généraux et les instruments d'analyse à travers les difficultés d'évaluation quantitatives et qualitatives des utilisations des engrais ...

  10. Physical and mechanical properties of the nanocomposite and combined Ti-N-Si /WC-Co-Cr and Ti-N-Si/(CR3C275-(NiCr25 coatings

    Directory of Open Access Journals (Sweden)

    O.V. Kolisnichenko

    2009-01-01

    Full Text Available Two types of the combined nanocomposite coatings (Ti-N-Si /WC-Co-Cr and Ti-N-Si/ (Cr3C2Ni75-(NiCr25 of 160-320 μm thickness were produced using two deposition techniques: the cumulative-detonation and the vacuum-arc deposition with the high-frequency discharge. This gives the possibility (using the combined coatings to restore the size of worn areas of the tools and demonstrate the high corrosion and wear resistance, to increase the hardness, modulus of elasticity, and plasticity index. Composition of the top coating varied from Ti = 60 at.%, N = 30 at.%, and Si = 10 at.% to Ti = 75 at.%, N = 20 at.%, and Si = 5 at.%. In the first series of coatings the following phases were obtained: (Ti;Si and TiN in thin top coating and WC and W2C in thick bottom coating. The second series gives (Ti;SiN and TiN in top coating; Cr3Ni2 and pure Cr in bottom coating; and small amount of Ti19O17 in the transition region between thin and thick coatings. For the first series the grain size achieved 25 nm at the hardness of 38 GPa. For the second series the grain size was 15 nm at the hardness of 42 GРa ± 4 GPa. It is shown that the corrosion resistance in salt solution and acid media increases with the wear decrease as a result of the cylinder friction over the surface of combined coating.

  11. Physical and mechanical properties of the nanocomposite and combined Ti-N-Si /WC-Co-Cr and Ti-N-Si/(CR3C2)75-(NiCr)25 coatings

    OpenAIRE

    O.V. Kolisnichenko; N.A. Makhmudov; N.K. Erdybayeva; Beresnev, V. M.; G.V. Kirik; A.V. Pshyk; A.P. Shypylenko; M.V. Kaverin; M.V. Il’yashenko; A.D. Pogrebnjak; Yu.N. Tyurin; A.P.Shpak

    2009-01-01

    Two types of the combined nanocomposite coatings (Ti-N-Si /WC-Co-Cr and Ti-N-Si/ (Cr3C2Ni)75-(NiCr)25) of 160-320 μm thickness were produced using two deposition techniques: the cumulative-detonation and the vacuum-arc deposition with the high-frequency discharge. This gives the possibility (using the combined coatings) to restore the size of worn areas of the tools and demonstrate the high corrosion and wear resistance, to increase the hardness, modulus of elasticity, and plasticity index. C...

  12. Technical evaluation report TMI action: NUREG-0737 (II.D.1) relief and safety valve testing,. Diablo Canyon Units 1 and 2 (Docket Nos. 50-275, 50-323)

    International Nuclear Information System (INIS)

    Light water reactor operators have experienced a number of occurrences of improper performance of safety and relief valves installed in their primary coolant systems. Because of this, the authors of NUREG-0578 (TMI-2 Lessons Learned Task Status Report and Short-Term Recommendations) and subsequently NUREG-0737 (Clarification of TMI Action Plan Requirements) recommended that programs be developed and completed which would reevaluate the functional performance capabilities of Pressurized Water Reactor (PWR) safety, relief, and block valves and which would verify the integrity of the piping systems for normal, transient and accident conditions. This report provides the results of the review of these programs and their results by the Nuclear Regulatory Commission (NRC) and their consultant, EG and G Idaho, Inc. Specifically, this report has examined the response of the Licensee for Diablo Canyon Units 1 and 2, to the requirements of NUREG-0578 and NUREG-0737 and finds that the Licensee has provided an acceptable response, reconfirming that the General Design Criteria 14, 15 and 30 of Appendix A to 10 CRF 50 have been met. 18 refs

  13. Incomplete fusion and preequilibrium emission in the reactions 40Ar + 45Sc, 40Ar + 24Mg, 40Ar + 13C at 27.5 MeV by nucleon

    International Nuclear Information System (INIS)

    The evaporation residues were detected by means of a heavy ion time of flight system. As an attempt to examine in detail incomplete fusion for medium and light mass systems we have studied the reactions with experimental conditions allowing a complete separation and identification of the final products. We have analysed the velocity of the evaporation residues. The preequilibrium particles appear to be governed by two different regimes. The results show clearly that various compound nuclei are formed in the incomplete fusion process. The 40Ar + 13C reaction appears to be a special case. In the 40Ar+24Mg reaction, the study of preequilibrium particles in coincidence with evaporation residues confirms the results suggested for the heavy fragments

  14. Single-crystal Structure of Cd2+-exchanged Zeolite Y (FAU, Si/Al = 1.56), |Cd27.5(Cd8O4)2.5|[Si117Al75O384]-FAU

    International Nuclear Information System (INIS)

    The cations are quite mobile and may usually be exchanged by other cations. Ion exchange is the most important method for the modification of the physical and chemical properties of zeolites for use as catalysts, sorbents, and molecular sieves. The results of ion exchange into zeolites from aqueous solution are usually not simple. Often only a fraction of the original cations can be replaced, and attempts to overcome this may reveal a relatively sharp upper limit to exchange. When acetate salt of metal cations dissolves in water for exchange solution, metal hydroxide ions occurred. It can be exchanged for Na+ ions into zeolite framework, leading to over exchange. The catalytic activity of Cd2+-exchanged zeolite Y for the formation of acetonitrile was studied for comparison with activated alumina (Al2O3) and also examined for the formation of acetonitrile from ethane and ammonia. Its catalytic activity had much higher than that of Al2O3. It was found to be essentially inactive for the formation of acetonitrile from ethylamine

  15. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 31

    International Nuclear Information System (INIS)

    Supplement 31 to the Safety Evaluation Report for the application by Pacific Gas and Electric Company for a license to operate Diablo Canyon Nuclear Power Plant Unit 2 (Docket 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement addresses a number of matters related to the issuance of an operating license for Diablo Canyon Unit 2, in particular issues identified by the NRC staff in earlier supplements, commitments made by the applicant and certain license conditions to be included in the Unit 2 operating license

  16. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 30

    International Nuclear Information System (INIS)

    Supplement 30 to the Safety Evaluation Report for the application by the Pacific Gas and Electric Company (PG and E) to operate the Diablo Canyon Nuclear Power Plant - Unit 2 (Docket No. 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. SSER 30 reports on the staff's technical review and evaluation of the design and analysis of Unit 2 piping systems and pipe supports. The staff effort includes an evaluation of PG and E's treatment of issues raised during the Unit 1 design verification, actions resulting from low power License Condition 2.C.(11) in the Unit 1 low power license DPR-76 and the Unit 2 applicability and resolution of certain allegations related to piping and supports

  17. Surface circulation patterns and the pathways of sea surface carbon dioxide (CO2 off northern Chile (~27.5° S between 30 and 10 kyr BP: global and/or local forcing?

    Directory of Open Access Journals (Sweden)

    R. Torres

    2010-03-01

    Full Text Available We present a reconstruction of past changes in partial pressure of CO2 (pCO2 from northern Chile (~27° S, between 10 and 30 kyr BP, based on carbon isotope composition of C37:2-alkenone. The high-pCO2 during the entire time series indicates that northern Chile upwelling system has been a permanent source of CO2 to the atmosphere. The multiproxy reconstruction suggests that the CO2 outgassing and sequestration pathways were modulated by local and global mechanisms. During global glacial conditions, an enhanced coastal upwelling forcing resulted in high-availability of deep water macronutrients and a CO2-supersaturated water column, which combined with high-inputs of iron from the continent, intensified the carbon sequestration pathway of the biological pump, through diatom biomass export. During the deglacial, a decrease in the upwelling forcing, an increment in water column stability and reduced continental inputs of iron are consistent with a larger role of calcifying organisms in the plankton assemblage in terms of carbon sequestration pathway through the carbonate system.

  18. Impact of nutrition support on clinical outcomes for the patients with gastrointestinal disease at nutritional risk by Nutrition Risk Screening 2002 tool and the preliminary finding of cost-effectiveness analysis: a prospective cohort study for 275 patien%营养支持对有营养风险胃肠病患者临床结局的影响以及成本-效果比初步探讨:275例前瞻性队列研究

    Institute of Scientific and Technical Information of China (English)

    王艳; 蒋朱明; Jens Kondrup; 王杨; Marie Nolan; 钱家鸣; 于康

    2013-01-01

    Objective To evaluate the impact of nutrition support on the clinical outcomes of gastrointestinal disease patients at nutritional risk and explore the the cost-effectiveness of various nutrition support options.Methods A prospective cohort study was designed.The patients who met the predetermined inclusion criteria were followed up during the hospital stay.Nutritional risk was determined using the Nutrition Risk Screening 2002 on admission.The information with respect to nutritional support,occurrence and treatment of complications,length of hospital stay,and discharge destination was monitored and recorded.The direct costs of nutritional support and the costs of diagnosing and treating complications were calculated after discharge."Infectious complication-free patient" was used as the effectiveness indicator in the cost-effectiveness analysis.Results Patients who had received nutrition support had significantly lower infectious complications incidence (6.8% vs.19.6%,x2 =9.0,P=0.003) and significantly higher total hospitalization costs (P =0.0001).The adjusted (by general linear model) cost of parenteral nutrition (PN) cohort,enteral nutrition (EN) cohort,PN combined EN cohort,and the cohort without nutritional support were 5635,1212,5220,and 1339 China Yuan,respectively.The incremental cost effectiveness ratios were 36 101,-794,and 33 748 China Yuan for PN,EN,and PN-EN combination groups,respectively.Conclusions For the patients at nutritional risk,nutritional support can remarkably reduce the incidence of infectious complications.The preliminary resuits of cost-effectiveness:due to lack of enough data required by health economic professional,it can not be cited directly.%目的 研究营养支持对有营养风险的胃肠病患者的临床结局影响,并初步收集成本-效果有关信息,对成本-效果比进行初步探讨.方法 本研究为前瞻性队列研究设计,采用定点连续抽样,随访记录研究对象整个住院期间的营养支持应用情况、感染性并发症发病和治疗情况、住院天数等方面信息,并收集研究对象住院期间营养支持的直接费用、并发症的诊断和治疗费用.用多因素统计分析方法评估营养支持对感染性并发症的影响.将“无感染性并发症患者比例”作为效果指标,对肠内营养、肠外营养、肠内和肠外联合营养及无营养支持的4个队列进行成本-效果比的初步探讨.结果 对有营养风险的患者,接受营养支持群体与未接受营养支持群体相比感染性并发症发病率显著降低(6.8%比19.6%,x2 =9.0,P=0.003),但住院总费用增高(P =0.0001).肠外营养、肠内营养、肠外营养-肠内营养联合应用以及未使用营养支持队列,经多因素调整后的成本分别是5635、1212、5220和1339元,而“无感染性并发症患者比例”分别是92.3%、96.4%、91.9%和80.4%.肠外营养、肠内营养和肠外营养-肠内营养支持与无营养支持队列相比,增量成本效果比分别为36 101、-794及33 748元.结论 对有营养风险的胃肠病患者接受营养支持有助于改善患者结局.由于本研究收集成本-效果比有关数据的范围不够,无法通过“广义估计方程”对可能影响结果的因素进行调整,其结果不符合卫生经济学的全面要求,不能直接引用.本初步结果尚需收集更多成本-效果比方面数据的临床研究来校正和补充.

  19. Drug: D04997 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 275.7286 D04997.gif Antihypertensive USP drug classification [BR:br08302] Cardiovascular Agents Alpha-adrene...D04997 Drug Methyldopate hydrochloride (USP); Aldomet (TN) C12H17NO4. HCl 275.0924

  20. Drug: D02281 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02281 Drug Levalbuterol hydrochloride (USAN); Xopenex (TN) C13H21NO3. HCl 275.1288 275.7717 D02 ... 281.gif Bronchodilator; Asthma ... prophylactic [DS:H00079] beta2-adrenergic receptor ...

  1. Protein (Viridiplantae): 302856529 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71484 Volvox carteri f. nagariensis MRSASICDLQAYDKCDLQAYAICKNMPYAIC...KHMPYAICKHMPYAICKHMHLQAYAVCKHMPYAICKHMPYAICKHMPYAICKHMPYAICKDYNLQAYAICKHMRSASICDLQAYAICDLQAYAICDLQAYAICDLQAY...AICDLQAYAICDLQAHAICKHMPYAICKHMRSASICHMRSASICSLQAYAVCKHMQSVSICSLQTYAVCKHSNMQAYAVCKHVQSASICSLHAYAICKHMQSASICHM ...

  2. Protein (Viridiplantae): 302855471 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70544 Volvox carteri f. nagariensis MRSASICHYTICKHMPYAICKHMRSASICHY...AICKHMPYAICKHIPYAICEHMPYATCKHMRSASICDLQAYAICKHMRSHMPYAICKHMRSASICHYAICKHMPYAICKHIPYAICEHMPYATCKHMRSASICDLQAYAICKHIRSASIC...DLQAYAICKHMPSVICKHMRSASICDLQAYAICDLQACAICKHMRSTSICHYAICKHMPSCHLQAYAIMRSASISHYAICKHMPSCDLQAYAIMRSASICHYAICKHMPL ...

  3. Protein (Viridiplantae): 302841845 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_62449 Volvox carteri f. nagariensis MCFIYTNASYASICHMRCAIICDLQAYAMCNHIRSASIC...DVQSYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMPDAICKHMPHSICKHFFHLRSASICHIRCASICDLQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHIPHSMCKHMRYGSLCDHSYVLCYAMLCYAMLC ...

  4. Protein (Viridiplantae): 302855974 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70990, partial Volvox carteri f. nagariensis MRSASICDLQAYAICKHLGCASICDAQAYAIWKHMRSASIC...DLQVYALCKHIGCASVCDLQAYAIICDLQAYAICKHMRCASICALQAYAICKHMRYYMRSASICDLQAYATCKHMPYAICKHMPYAICKHMPYAICKHMPYAICKHMRSASICHMRSASICDLQAYAICDLQAYAMLCLLCLL ...

  5. Protein (Viridiplantae): 302857669 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_39614, partial Volvox carteri f. nagariensis ICKHMRYASICQMRCASICHIRCASICDLQAYAICKHMQSASIC...QMRSASICHIRCARICDMQAYAICKHIRSMLCCDMPYALCYATLCPYATCDVRSYVICKHIRSASICDLQAYAICKHMPDAICKHMLHSMCKHMRSASLCDLQAYTI ...

  6. Protein (Viridiplantae): 302855851 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70901, partial Volvox carteri f. nagariensis MQSASICNLQAYAICDLQAYAI...CKHMPYAICKHHMPYAICKHMRSASICDLQAYAICKHMLSASICDLQAYAVCKHMRSASICCLQAYAICKHLRSASICDLQAYVICKHMRSASICHMRSASICDLQAYAVCKHMRSASICSLQAYAVCKHMQSASICDLQAYAICKHMRFASMC ...

  7. Protein (Viridiplantae): 302856118 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71227 Volvox carteri f. nagariensis MRCANICDLQAYAICKHMGCASICDLQPYAICNHMRSASIC...DLQAYAMCKHMRCASICDLQAYAICKHMRCASICDLQAYAICKHMRSASICDLQAYAMCKHMRSASICDLQAYALCKHMGCASICDVQAYAMCKHMRCASICDVQAYAMCKHMRSASIC...ALQAYALCKHMRFASIWDVQAYEICKHMRCASICDLQAYALCKHMRSASICDVQAYAMCKHMRSASICDLQAYALCKHMGCASIC...DVQAYAMCKHMRCASICDVQAYAMCKHMRSASICALQAYALCKHMRFASIWDVQAYEICKHMRCASICDMQTYALCKHMRSASICDVQAYVLCKYM ...

  8. Protein (Viridiplantae): 302852975 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_68841 Volvox carteri f. nagariensis MPYAICKHMQYALCNHMQYAICKHMRSASICHMRPASMCNMRSASIC...DLQAYDKCDLQAYAICKNMPYAICKHMPYAICKHMPYAICKHMHLQAYAVCKHMPYAICKHMPYAICKHMPYAICKHMPYAICKDYNLQAYAICKHMRSASIC...DLQAYAICDLQACAICDLQAYAICKHMTNAICKHMPSARICHMRSASICHMRSASICHMRYAICDLQAYAVCKHTQSASICSL ...

  9. Protein (Viridiplantae): 302841701 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_62437, partial Volvox carteri f. nagariensis MRSASICHIRCASICELQAYAICKHVRSASIC...DRQAYAICKHMPDTICKHMPHSMCKHMRSASICQIRPASICHIRCASICDLQAYATCKHMRAASICDRQAYAICKHMPDAICKHMPHSMCKHMRSASICQMRSASICHIRCASICDLQAYARCDLQAYAICKHMRSASICQIRCASICDL ...

  10. Protein (Viridiplantae): 302837596 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_32364, partial Volvox carteri f. nagariensis YAICKHMRSASICDLQAYAICKHMRSASIC...DLQAYAICKHLPDTICKHMPHSMCKHMRSASICDLQAYAICKHMPSASICQMRSASICHIRCASICDLQAYARCDLQAYATFDVQTYAICKHLRSASICDLQAYAICKHMPHSMCKHMRYASLCDLQAYAIC ...

  11. Protein (Viridiplantae): 302856745 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71629 Volvox carteri f. nagariensis MRSASVCDLQAYAICKHMPDAICKHMPHSMCKHMRSASIC...DLQAYAICKHMRSASICDLQAYAICKHMPDAICKHMPHPMCKHMRSASICQMRSASICHIRCASICDLQAYATSDVQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMRSASIC...DLQAYAICKHLPDTICKHMPHSMCKHMRSASICDLQAYAICKHMPSASICQMRSASICHIRCASIC...DLQAYARCDLQAYATFDVQTYAICKHLRSASICDLQAYAICKHMPHSMCKHMRYASLCDLQAYAICKQMQSSVTLQ ...

  12. Protein (Viridiplantae): 302856603 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71521 Volvox carteri f. nagariensis MQAYATCDVQSYVICKHIRPASIYDLQAYAI...CKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMPDAICKHMPPSICDLQAYATFDVQAYAICKHMRSASICNLQAYAICKHMRSASICHIRCASICDLQAYAICKHMPDAICKRMPHSMCKHMRSASICDLQAYAICKHIPHSMCKHMRYASICDHSYAMLRYATL ...

  13. Protein (Viridiplantae): 302856498 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71475 Volvox carteri f. nagariensis MRSAGICHMLAYAICKHMPYAICKHMPLCDL...QAYAIMRSSSICHYAICKHMQSASICHMFAYAICKHMPYAICKHMPCAICKHMPYAICGHMRSASICHMLAYAICKHMPYAICKHMPLTICKHMPLCDQQAYAICKHMPYVCICDLQAYAIMRSAGICDLQAYAIMLSAGICDLQAYVICLHMRSASICHMRSASICH ...

  14. Protein (Viridiplantae): 302842271 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_81968 Volvox carteri f. nagariensis MRSARICDLQAYAICDLQAYAKCKHLPNASICDLQAYAICKHMRSA...SICDLQAYAICKHMRYAICKHMHYAHMRSASICHLQAYAICDLQAYAICDLQAYAICELQAYAICAIYAICKHMRSASICNMQVYAICKHMRSASRCTYAICDLQAYAICKHMRSASICDLQAYAICKHMCCILLNHNWMVASEDTDLEEFHPLK ...

  15. Protein (Viridiplantae): 302855547 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70645, partial Volvox carteri f. nagariensis MRSASICHIRCASICDLQAYAT...SDVQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMRSASICDLQAYAICKHLPDTICKHMPHSMCKHMRSASICDLQAYAICKHMPSASICQMRSASICHIRCASICDLQAYARCDLQAYATFDVQTYAICKHLRSASICDLQAYAICKHMPHSMCKH ...

  16. Protein (Viridiplantae): 302855864 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70912 Volvox carteri f. nagariensis MRSASICDLQAYVICKHIPYAICKHTPYAICKHMPYAICKHIPLCDLQAYAIMRSA...SICNYAIGKHMPLCDLQAYAICDLQAYTICDLQAYAICDLQAYAICKHMRSASICDLQAYMICKHIICDLQAYAICKHMRSASICDLQAYAICDLQAYAICKHMPYAICKHMPYAICKHMRSASICNLQAYAICDLQAYVICKHT ...

  17. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  18. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  19. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  20. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  1. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  2. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  3. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  4. The role of radiation loses in high-pressure blasted electrical arcs

    Czech Academy of Sciences Publication Activity Database

    Gregor, J.; Jakubová, I.; Šenk, J.; Mašláni, Alan

    2011-01-01

    Roč. 275, č. 1 (2011), 012007-012007. E-ISSN 1742-6596. [European Conference on High-Technology Plasma Processes (HTPP 11)/11th./. Brussels, 27.06.2010-02.07.2010] Institutional research plan: CEZ:AV0Z20430508 Keywords : High-pressure electrical arc * radiation loss * mathematical model Subject RIV: BL - Plasma and Gas Discharge Physics http://iopscience.iop.org/1742-6596/275/1/012007/pdf/1742-6596_275_1_012007.pdf

  5. AcEST: DK956045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_L10 566 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_L10. 5' end seq ... 19/157 (75%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 18/157 (75%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... 19/157 (75%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ...

  6. Dicty_cDB: Contig-U08414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gtcgttgnattatctaca 70 Query: 71 acttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaact 130 |||||||||||...||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 71 acttttctttcnccnactgtt...|||||||||||||||||| Sbjct: 275 aaattaggaagtgcacctttgataaatcaattctaaanncngtcgttgnattatctacaa 216 Query: 72 cttttctttcnccna...|||||||||||||| Sbjct: 215 cttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaactc 156 Query: 132 atacca

  7. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  8. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  9. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  10. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  11. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  12. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  13. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  14. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  15. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  16. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  17. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  18. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  19. Fungal ligninolytic enzymes in the forest soil environment: occurrence, distribution and role in soil organic matter transformation

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr; Šnajdr, Jaroslav; Valášková, Vendula

    Cairns: Verlag, 2006, s. 275-275. [International Mycological Congress /8/. Cairns (AU), 20.08.2006-25.08.2006] R&D Projects: GA ČR GA526/05/0168; GA AV ČR KJB600200516 Institutional research plan: CEZ:AV0Z50200510 Keywords : basidiomycetes * forest soil * saprotrophic fungi Subject RIV: EE - Microbiology, Virology

  20. Genetic and bibliographic information: KRT5 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available KRT5 keratin 5 human epidermolysis bullosa simplex ... (MeSH) Congenital, Hereditary, and Neonatal D ... Bullosa (C16.131.831.493) > Epidermolysis Bullosa Simplex ... (C16.131.831.493.180) Congenital, Hereditary, and ... Bullosa (C16.320.850.275) > Epidermolysis Bullosa Simplex ... (C16.320.850.275.180) Skin and Connective Tissue D ...

  1. Gclust Server: 203310 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 203310 Bja_bll2067=nfeC Cluster Sequences - 275 nodulate formation efficiency C pro...ciency C protein Number of Sequences 1 Homologs 1 Cluste...cluster sequences Cluster Sequences Link to related sequences - Sequence length 275 Representative annotation nodulate formation effi

  2. Unigene BLAST: CBRC-CELE-05-0147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0147 gnl|UG|Cel#S5720522 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-275) (srh-275) mRNA, complete cds /cds=p(1,972) /gb=NM_072475 /gi=17557557 /ug=Cel.28796 /len=972 9e-44 30% ...

  3. Mutually consistent thermodynamic potentials for fluid water, ice and seawater: a new standard for oceanography

    Czech Academy of Sciences Publication Activity Database

    Feistel, R.; Wright, D.G.; Miyagawa, K.; Harvey, A.H.; Hrubý, Jan; Jackett, D.R.; McDougall, T.J.; Wagner, W.

    2008-01-01

    Roč. 4, č. 4 (2008), s. 275-291. ISSN 1812-0784 Institutional research plan: CEZ:AV0Z20760514 Keywords : seawater * equation of state * metastable states Subject RIV: BJ - Thermodynamics www.ocean-sci.net/4/275/2008

  4. Drug: D08214 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08214 Drug Metronidazole benzoate (USP); Elyzol (TN) C13H13N3O4 275.0906 275.26 D08214.gif Antiprotozoa...cs Agents against Amebiasis and other antiprotozoals Nitroimidazole derivatives Metronidazole [ATC:A01AB17 D

  5. NCBI nr-aa BLAST: CBRC-PVAM-01-0618 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0618 ref|XP_002173758.1| DUF1941 family protein [Schizosaccharomyces j...aponicus yFS275] gb|EEB07465.1| DUF1941 family protein [Schizosaccharomyces japonicus yFS275] XP_002173758.1 8.5 32% ...

  6. NCBI nr-aa BLAST: CBRC-TSYR-01-0381 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0381 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 5e-38 27% ...

  7. NCBI nr-aa BLAST: CBRC-GGOR-01-1142 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1142 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 2e-22 33% ...

  8. NCBI nr-aa BLAST: CBRC-GGOR-01-0652 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0652 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 3e-23 35% ...

  9. NCBI nr-aa BLAST: CBRC-GGOR-01-0341 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0341 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 3e-19 30% ...

  10. NCBI nr-aa BLAST: CBRC-GGOR-01-0432 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0432 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 9e-36 34% ...

  11. NCBI nr-aa BLAST: CBRC-GGOR-01-1092 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1092 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 7e-24 32% ...

  12. NCBI nr-aa BLAST: CBRC-GGOR-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0832 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 3e-42 33% ...

  13. NCBI nr-aa BLAST: CBRC-GGOR-01-0201 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0201 ref|XP_002173208.1| predicted protein [Schizosaccharomyces japoni...cus yFS275] gb|EEB06915.1| predicted protein [Schizosaccharomyces japonicus yFS275] XP_002173208.1 2e-24 35% ...

  14. NCBI nr-aa BLAST: CBRC-MLUC-01-0903 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0903 ref|XP_002171541.1| branchpoint-bridging protein [Schizosaccharomyces... japonicus yFS275] gb|EEB05248.1| branchpoint-bridging protein [Schizosaccharomyces japonicus yFS275] XP_002171541.1 0.002 32% ...

  15. 19 CFR 144.38 - Withdrawal for consumption.

    Science.gov (United States)

    2010-04-01

    ... for tax purposes required by § 275.81 of the regulations of the Internal Revenue Service (26 CFR § 275... textile category. Editorial Note: For Federal Register citations affecting § 144.38, see the List of CFR... provided in § 141.61(e) of this chapter. (b) Withdrawal for exportation to Canada or Mexico. A...

  16. 78 FR 19088 - Airworthiness Directives; REIMS AVIATION S.A. Airplanes

    Science.gov (United States)

    2013-03-29

    ... in the Federal Register on January 3, 2013 (78 FR 275). That NPRM proposed to correct an unsafe... public the opportunity to participate in developing this AD. We received no comments on the NPRM (78 FR... intent that was proposed in the NPRM (78 FR 275, January 3, 2013) for correcting the unsafe...

  17. Seasonal variation in the flux of planktic foraminifera: Sediment trap results from the Bay of Bengal, Northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Guptha, M.V; Curry, W.B; Ittekkot, V; Muralinath, A.S.

    stream_size 15 stream_content_type text/plain stream_name J_Foramin_Res_27_5.pdf.txt stream_source_info J_Foramin_Res_27_5.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. Changes in resveratrol and piceid content in the rachis, pedicels and berries influenced by different stress factors

    Czech Academy of Sciences Publication Activity Database

    Tříska, Jan; Vrchotová, Naděžda; Kyseláková, M.; Mikeš, O.; Veverka, J.; Balík, J.

    Stuttgart: Forschungsring des Deutschen Weinbaus, 2007, s. 275-275. [59. Deutscher Weinbaukongress. 8.Internationales Symposium. Innovationen in der Kellerwirtschaft. Stuttgart (DE), 20.04.2007-23.04.2007] R&D Projects: GA ČR GA525/06/1757 Institutional research plan: CEZ:AV0Z60870520 Keywords : grape- wine * stress factors * stilbens Subject RIV: CB - Analytical Chemistry, Separation

  19. Detection of major histocompatibility complex/human cartilage gp-39 complexes in rheumatoid arthritis synovitis as a specific and independent histologic marker

    NARCIS (Netherlands)

    Baeten, D; Steenbakkers, PGA; Rijnders, AMW; Boots, AM; Veys, EM; De Keyser, F

    2004-01-01

    Objective. Peptide 263-275 is the immunodominant epitope of human cartilage (HC) gp-39, a candidate autoantigen in rheumatoid arthritis (RA). We recently generated and characterized a monoclonal antibody (mAb) called 12A, which is directed against HLA-DR4/HC gp-39(263-275) complexes and inhibits spe

  20. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  1. 76 FR 58827 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year (FY) 2009

    Science.gov (United States)

    2011-09-22

    ...) 325-2665 10 275,000.00 WA 92201 Private Enforcement Initiative/Performance-Mortgage Rescue Scam....00 Fair Housing Organizations Initiative/Continued Development-Mortgage Rescue Scam Component...

  2. Nová konstrukce rotoru heliové expanzní turbiny

    Czech Academy of Sciences Publication Activity Database

    Dupák, Jan; Hanzelka, Pavel; Michalička, Petr; Tuček, L.; Ustohal, V.

    č. 9 (2002), s. 275 - 276. ISSN 0447-6441 Institutional research plan: CEZ:AV0Z2065902 Keywords : helium expansion turbine * nickel-chrome-tungsten steel 16720 Subject RIV: BM - Solid Matter Physics ; Magnetism

  3. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275. ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.759, year: 2014

  4. Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    Los Angeles : Sage , 2012 - (Juergensmeyer, M.; Roof, W.), s. 275 ISBN 9780761927297 Institutional research plan: CEZ:AV0Z70280505 Keywords : Czech Republic * religion * sociology of religion Subject RIV: AO - Sociology, Demography

  5. Genetics Home Reference: benign chronic pemphigus

    Science.gov (United States)

    ... features, response to treatment and prognosis. Br J Dermatol. 1992 Mar;126(3):275-82. Citation on ... novel mutations in the ATP2C1 gene. J Invest Dermatol. 2002 Feb;118(2):338-43. Citation on ...

  6. 78 FR 22918 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-04-17

    ... Exchange Commission, Office of Investor Education and Advocacy, Washington, DC 20549-0213. Extension: Rule... examination programs. This collection of information is found at 17 CFR 275.204-3 and is mandatory....

  7. Stimulating Personal Development and Knowledge Sharing (editorial special issue)

    OpenAIRE

    Koper, Rob; Stefanov, Krassen; Dicheva, Darina

    2010-01-01

    Koper, R., Stefanov, K., & Dicheva, D. (2009). Stimulating Personal Development and Knowledge Sharing (editorial) [Special issue]. International Journal of Continuing Engineering Education and Life-Long Learning (IJCEELL), 19(Nos. 4/5/6), 271-275.

  8. Damir Barbarić (Hrsg.), Platon über das Gute und die Gerechtigkeit – Plato on Goodness and Justice – Platone sul Bene e sulla Giustizia

    OpenAIRE

    Šegedin, Petar

    2005-01-01

    Prikaz knjige Damir Barbarić (Hrsg.), Platon über das Gute und die Gerechtigkeit – Plato on Goodness and Justice – Platone sul Bene e sulla Giustizia, Königshausen & Neumann, Würzburg 2005, 275 str.

  9. Ultrahigh energy neutrinos scattering off relic light neutrinos to explain UHECR above GZK cut off and thin blazars

    CERN Document Server

    Fargion, D; Fargion, Daniele; Mele, Barbara

    1999-01-01

    UHE neutrinos may transfer highest cosmic-rays energies overcoming $2.75K^\\circ$ BBR and radio-waves opacities (the GZK cut off) from most distant AGN sources at the age of the Universe. These UHE $\

  10. Dedifferentiation of tobacco cells is associated with ribosomal RNA gene hypomethylation, increased transcription, and chromatin alterations

    Czech Academy of Sciences Publication Activity Database

    Koukalová, Blažena; Fojtová, Miloslava; Lim, Yoong Kar; Fulneček, Jaroslav; Leitch, Rowland Andrew; Kovařík, Aleš

    2005-01-01

    Roč. 139, - (2005), s. 275-286. ISSN 0032-0889 Institutional research plan: CEZ:AV0Z50040507 Keywords : pluripotent tobacco cells * epigenetic changes Subject RIV: BO - Biophysics Impact factor: 6.114, year: 2005

  11. Dicty_cDB: Contig-U07707-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available act 833 Query: 834 tgggtgaaattanttgttttagtatgtattataactttatgttatgttggcaattttcna 893 |||||||||||||||...||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 834 tgggtgaaattanttgttttagtatgtattataactttatgttat...aactttgtaatacatcaaattaaaaccagtacttggttaact 1581 Query: 834 tgggtgaaattanttgttttagtatgtattataactttatgttat...aactttgtaatacatcaaattaaaaccagtacttggttaacttgggtgaaattantt 848 Query: 1597 gtttta...|||||||||||||||||||||||||||||||||||| Sbjct: 334 ctttgtaatacatcaaattaaaaccagtacttggttaacttgggtgaaattanttgtttt 275 Query: 854 agtatgta

  12. Kuidas kirjutatakse ajalugu? / Peter Burke ; interv. Marek Tamm, tlk. Ainiki Väljataga

    Index Scriptorium Estoniae

    Burke, Peter

    2007-01-01

    Renessansiajastu kultuuriloost, keelest sotsiaalajaloo uurimisobjektina ning ajalookirjutuse ajaloost ja teooriast Cambridge'i Ülikooli kultuuriajaloo emeriitprofessoti P. Burke'i teostes. Varem ilm.: Burke, Peter. Kultuuride kohtumine : esseid uuest kultuuriajaloost. Tallinn, 2006. Lk. 275-286

  13. Městečko Rajhrad v letech 1918-1945: Spolkový a společenský život

    Czech Academy of Sciences Publication Activity Database

    Altman, Karel

    1. Rajhrad: Město Rajhrad, 2014, s. 275-311. ISBN 978-80-260-5803-8 Institutional support: RVO:68378076 Keywords : town * Rajhrad * 1918-1945 * social life * fellowship Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Horkheimer a Marcuse: tvůrci programových tezí kritické teorie

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    Olomouc : Nakladatelství Olomouc, 2009 - (Blecha, I.), s. 288-303 ISBN 978-80-7182-275-2 Institutional research plan: CEZ:AV0Z9009908 Keywords : criticism * description * normativity Subject RIV: AA - Philosophy ; Religion

  15. Comparison of diatom community structure from epilithon and fish guts: implications for inferring past changes in water quality

    Czech Academy of Sciences Publication Activity Database

    Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.

    2015-01-01

    Roč. 742, č. 1 (2015), s. 233-248. ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  16. 26 CFR 1.468B-6 - Escrow accounts, trusts, and other funds used during deferred exchanges of like-kind property...

    Science.gov (United States)

    2010-04-01

    ... average daily principal balances, and a 30-day month convention, as follows: Month Account's avg. daily bal. T's avg. daily bal. T's share*(percent) Monthly interest T's end. bal.** May $5,275,000...

  17. Impact of freshwater influx on microzooplankton mediated food web in a tropical estuary (Cochin backwaters - India)

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothibabu, R.; Madhu, N.V.; Jayalakshmi, K.V.; Balachandran, K.K.; Shiyas, C.C.; Martin, G.D.; Nair, K.K.C.

    and evenness of microzooplankton also showed similar trends as that of abundance and biomass. Grazing experiment showed that microzooplankton consumes 43 ± 1% of the daily phytoplankton standing stock during the high saline condition (27.5). Low abundance...

  18. The ν3 + ν5 combination band of DCF3: Modeling anharmonic and Coriolis interactions in a three-level system near 1700 cm−1

    Czech Academy of Sciences Publication Activity Database

    Ceausu-Velcescu, A.; Pracna, Petr

    2012-01-01

    Roč. 275, č. 276 (2012), s. 41-47. ISSN 0022-2852 Institutional support: RVO:61388955 Keywords : deuterated fluoroform * anharmonic * coriolis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.670, year: 2012

  19. Effect of gamma radiation and ethylene oxide on neomycin sulphate

    International Nuclear Information System (INIS)

    Neomycin is affected by ethylene oxide but not by gamma radiation (2.75 Mrad). Differential refractometry is more advantageous in quantitating neomycin A, B and C than is the ninhydrin method. (Auth.)

  20. Dinoflagellate community structure from the stratified environment of the Bay of Bengal, with special emphasis on harmful algal bloom species

    Digital Repository Service at National Institute of Oceanography (India)

    Naik, R.K.; Hegde, S.; Anil, A.C.

    and cannibalism on the bioluminescence of the heterotrophic dinoflagellates Protoperidinium spp. Marine Ecology Progress Series, 132, 275-285. Legrand, C., Granéli, E., & Carlsson, P. (1998). Induced phagotrophy in the photosynthetic dinoflagellate Heterocapsa...

  1. Sample information: 2218 [RED

    Lifescience Database Archive (English)

    Full Text Available 2218 2 T Metabolism Oryza sativa (rice) Notohikari callus-forming embryo with low sugar ... status 0 ... /g fresh weight glucose) after 2-day-incubation on sugar -free medium (see FEBS Lett.(1998)428: 275) ...

  2. Saw Palmetto

    Science.gov (United States)

    ... Events Multimedia (Video, Images, and Audio) NCCIH Clinical Digest A monthly newsletter with evidence-based information on ... require a viewer such as the free Adobe Reader . NCCIH Publication No.: D275 Created: May 2006 Updated: ...

  3. Römischův panteon na Malé Skále a jeho kontext. [Doslov

    Czech Academy of Sciences Publication Activity Database

    Petrasová, Taťána

    Praha : Argo, 2015, s. 275-282 ISBN 978-80-257-0608-4 Institutional support: RVO:68378033 Keywords : Malá Skála * pantheon * Franz Zacharias Römisch Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. 76 FR 66775 - Emergency Temporary Closure of the I-64 Sherman-Minton Bridge Over the Ohio River Between Indiana...

    Science.gov (United States)

    2011-10-27

    ...: http://www.gpoaccess.gov . Background The FHWA is responsible for enforcing the Federal regulations... Bridge, and Lawrenceburg I-275 Bridge. The KYTC is currently directing oversize and overweight...

  5. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  6. Intracranial EEG Connectivity Analysis and Result Imaging

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Petr; Janeček, Jiří; Jurák, Pavel; Halámek, Josef; Chládek, Jan; Brázdil, M.

    2012-01-01

    Roč. 2, č. 4 (2012), s. 275-279. ISSN 2010-3638 Institutional support: RVO:68081731 Keywords : Connectivity * Correlation * Intracranial EEG * Signal Processing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  7. 10 CFR 434.513 - Occupancy.

    Science.gov (United States)

    2010-01-01

    ... used in calculating the Energy Cost Budget. 513.2Table 513.2.a, Occupancy Density, establishes the... area Ft 2 person Assembly 50 Office 275 Retail 300 Warehouse 15000 School 75 Hotel/Motel 250...

  8. 75 FR 10230 - Inglis Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To...

    Science.gov (United States)

    2010-03-05

    ... Rousseau and Inglis dam, within the town of Inglis, in Levy, Citrus, and Marion counties, Florida. No... surface elevation of Lake Rousseau at 27.5 feet mean sea level. Flow releases would be determined by...

  9. Turbulent Flow with Embedded Vortical Structures Induced by Vortex Generators in a Cascade

    Czech Academy of Sciences Publication Activity Database

    Součková, Natálie; Uruba, Václav

    Darmstadt: TU Darmstadt, 2012 - (Alber, H.; Tropea, C.). s. 275-275 [Annual Meeting of the International Association of Applied Mathematics and Mechanics /83./. 26.03.2012-30.03.2012, Darmstadt] R&D Projects: GA ČR GA101/08/1112 Institutional support: RVO:61388998 Keywords : vortex generator * flow control * pasive actuator Subject RIV: BK - Fluid Dynamics http://www.gamm2012.tu-darmstadt.de/

  10. Wind Generated Ocean Waves

    DEFF Research Database (Denmark)

    Frigaard, Peter

    2001-01-01

    Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)......Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)...

  11. AcEST: BP917845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_C05 456 Adiantum capillus-veneris mRNA. clone: YMU001_000106_C05. BP917845 - Show ... ry: 96 MKYXXXXXXXXXXXXXXXTASSIGVVLKACGLHVTSIKIDPYLNTDA GTMSPFEHXXXXX 275 MKY ASS+G +LK+CGLHVT+IKIDPY+N DAG ... XXXXXXNYERFLDVTLTKDNNITRGKIYQSVISKERRGDYLGKTVQVVSHITDA ... 455 NYERFLD+ LTKDNN+T GKIYQSVI+KERRGDYLGKTVQVV HIT ... VDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDA ... 120 >sp|P70698|PYRG1_MOUSE CTP synthase 1 OS=Mus m ... ry: 96 MKYXXXXXXXXXXXXXXXTASSIGVVLKACGLHVTSIKIDPYLNTDA GTMSPFEHXXXXX 275 MKY ASS+G +LK+CGLHVTSIKIDPY+N DAG ...

  12. Glass melting phenomena, their ordering and melting space utilisation

    Czech Academy of Sciences Publication Activity Database

    Němec, Lubomír; Jebavá, Marcela; Dyrčíková, Petra

    2013-01-01

    Roč. 57, č. 4 (2013), s. 275-284. ISSN 0862-5468 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : glass melting * space utilization * melt flow * phenomena ordering Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.434, year: 2013 http://www.ceramics-silikaty.cz/2013/2013_04_275.htm

  13. Capacity analysis for high-speed terahertz wireless communications

    DEFF Research Database (Denmark)

    Dogadaev, Anton Konstantinovich; Lavrinenko, Andrei; Tafur Monroy, Idelfonso

    2012-01-01

    We report on the analytical capacity analysis of terahertz wireless communications supporting 275–325 GHz frequency band. Our goal in this paper is to provide design guidelines for close proximity links with transmission capacity beyond 100 Gbit/s.......We report on the analytical capacity analysis of terahertz wireless communications supporting 275–325 GHz frequency band. Our goal in this paper is to provide design guidelines for close proximity links with transmission capacity beyond 100 Gbit/s....

  14. Benchmark data for gamma-rays emitted by an Na-24 source penetrating stratified shielding slabs

    Science.gov (United States)

    Bakos, G. C.

    1995-04-01

    Experimentally determined scalar flux density spectra are presented for 1.37 and 2.75 MeV photons emitted by an Na-24 uniform disc source penetrating shields of six two-layer combinations. Also, the experimental facility is described. The benchmark data for photon energy 1.37 and 2.75 MeV fill a gap in the energy range of practical interest and provide useful reference values for computational method evaluation.

  15. Benchmark data for {gamma}-rays emitted by an Na-24 source penetrating stratified shielding slabs

    Energy Technology Data Exchange (ETDEWEB)

    Bakos, G.C. [Democritus Univ. of Thrace, Xanthi (Greece)

    1995-04-01

    Experimentally determined scalar flux density spectra are presented for 1.37 and 2.75 MeV photons emitted by an Na-24 uniform disc source penetrating shields of six two-layer combinations. Also, the experimental facility is described. The benchmark data for photon energy 1.37 and 2.75 MeV fill a gap in the energy range of practical interest and provide useful reference values for computational method evaluation.

  16. Drug: D08604 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08604 Drug Tipepidine (INN) C15H17NS2 275.0802 275.4322 D08604.gif Antitussive ATC code: R05DB2 ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ... L. COMBINATIONS WITH EXPECTORANTS R05DB Other cough ... suppressants R05DB24 Tipepidine D08604 Tipepidine ...

  17. AcEST: DK953617 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0018_E01 642 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_E01. 5' end seq ... 25/164 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 25/164 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  18. AcEST: DK951067 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0010_G11 686 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_G11. 5' end seq ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  19. AcEST: DK955780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_A06 639 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_A06. 5' end seq ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  20. AcEST: DK959674 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0005_F11 633 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_F11. 5' end seq ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  1. AcEST: DK959184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_A02 669 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_A02. 5' end seq ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  2. AcEST: DK960309 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0007_B04 614 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_B04. 5' end seq ... 28/167 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 28/167 (76%) Frame = +3 Query: 96 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 275 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  3. Drug: D07758 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07758 Drug Cyclobenzaprine (INN) C20H21N 275.1674 275.3874 D07758.gif Muscle relax...RELAXANTS, CENTRALLY ACTING AGENTS M03BX Other centrally acting agents M03BX08 Cyclobenzaprine D0775...8 Cyclobenzaprine (INN) USP drug classification [BR:br08302] Skeletal Muscle Relaxants Cyclobenzaprine D0775...8 Cyclobenzaprine (INN) CAS: 303-53-7 PubChem: 51092050 DrugBank: DB00924 LigandBox: D0775

  4. Acute serum sodium concentration changes in pediatric patients undergoing cardiopulmonary bypass and the association with postoperative outcomes

    OpenAIRE

    Lee, Jeong Jin; Kim, Young-Soon; Jung, Hae Hyuk

    2015-01-01

    The objective of this study is to investigate the degree of serum sodium changes and its association with patient outcomes in pediatrics undergoing heart surgery with cardiopulmonary bypass (CPB). We reviewed the medical records of 275 pediatric patients who underwent heart surgery with CPB. Prior to CPB, hyponatremia (≤135 mmol/L) was observed in 21 of 275 patients. After initiation of CPB, serum sodium decreased significantly and severe hyponatermia (≤130 mmol/L) subsequently developed in 3...

  5. Electronic structure and thermoelectric properties of In4Se3−x (x = 0, 0.25, 0.5, 0.75): First-principles calculations

    International Nuclear Information System (INIS)

    Highlights: • Se vacancy affects strongly on the thermoelectric properties of In4Se3−x. • Destroy degree of In–Se bonding determine the electrical behavior of In4Se2.75. • The semiconducting In4Se2.75 has a higher Seebeck coefficient than metallic ones. -- Abstract: Experimentally synthesized n-type In4Se3−x has a high thermoelectric figure of merit (ZT). The effect of Se vacancy on the electronic and thermoelectric properties of In4Se3 has been investigated by first-principles calculations. We find that the position and concentration of Se vacancy affect strongly on the thermoelectric properties of In4Se3. For In4Se2.75, three possible positions of Se vacancy lead to one type structure is semiconductor and other two structures are semimetal. Moreover, the semiconductor-type In4Se2.75 has a larger Seebeck coefficient than the semimetal type ones. The calculated low density of states near the Fermi level of the semimetal-type In4Se2.75 means that their metallicity is not so strong, which is helpful to their Seebeck coefficient. For In4Se2.75, the destroy degree of the In–Se bonding that plays a key role in determining whether the systems are metallic or semiconducting

  6. Experiments with Superheavy Nuclei

    Science.gov (United States)

    Hofmann, S.

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α -α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  7. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO3, HReO4) ΔHads(ReO3) = -190 ± 10 kJ/mol; ΔSads(ReO3) = -179±30 J/mol K; ΔHads(HReO4) = -77 ± 5 kJ/mol; ΔSads(HReO4) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176Re, 152-155Er, 151-154Ho, 218Po, and 214Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  8. Experiments with superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author) 34 refs, 7 figs

  9. Chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Schaedel, M. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan). Advanced Science Research Center; GSI Helmholtz Center for Heavy Ion Research, Darmstadt (Germany)

    2012-07-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  10. New elements produced at GSI

    Science.gov (United States)

    Hofmann, Sigurd

    1998-12-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  11. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A. [Paul-Scherrer-Inst., Villigen (Switzerland); Gaeggeler, H.W. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Paul-Scherrer-Inst., Villigen (Switzerland)

    1999-07-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) {r_reversible} X(ads) (X = ReO{sub 3}, HReO{sub 4}) {delta}H{sub ads}(ReO{sub 3}) = -190 {+-} 10 kJ/mol; {delta}S{sub ads}(ReO{sub 3}) = -179{+-}30 J/mol K; {delta}H{sub ads}(HReO{sub 4}) = -77 {+-} 5 kJ/mol; {delta}S{sub ads}(HReO{sub 4}) = -187{+-}50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes {sup 169,170,174,176}Re, {sup 152-155}Er, {sup 151-154}Ho, {sup 218}Po, and {sup 214}Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  12. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, J.C.; Mizel, A.; Cote, M.; Cohen, M.L.; Louie, S.G. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States))

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (B[sub o]), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (B[sub o]). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated B[sub o] for Hs is comparable to that of diamond. [copyright] [ital 1999] [ital The American Physical Society

  13. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  14. Experiments with superheavy nuclei

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  15. Synthesis of heavy and superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. (Gesellschaft fur Schwerionenforshung (GSI), Darmstadt (Germany))

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-de-excitation channels. The isotopes were ambiguously identified by means of [alpha]-[alpha] correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on this results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reaction using [sup 208]Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use the neutron deficient projectile isotopes and use of actinide targets is discussed.

  16. New elements produced at GSI

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed

  17. Dicty_cDB: Contig-U13887-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rmd *cfscqttsnskdstmyyqyh*strqkdsirsyr*ndpw*tktkas*stkgrtkryskes kdapaeepvatkdqkmddild*kkkkkin*kkkkkt*kl Translated Amino... gene. 275 6e-72 AF295956_1( AF295956 |pid:none) Drosophila melanogaster strain FrV... 275 6e-72 EU514494_1( EU514494 |pid:none) Daph...72 AF295962_1( AF295962 |pid:none) Drosophila melanogaster strain FrV... 275 6e-72 (Q9GSU7) RecNam...260 2e-67 ( P47773 ) RecName: Full=Heat shock cognate 71 kDa protein; &U224... 260 2e-67 AM410072_1( AM410072 |pid:none) Bythogra...L223Z ,2228,2546 est110= SSG789E ,2327,2590 est111= SLK865Z ,2448,2610 Translated Amino Acid sequence l*fnth

  18. AcEST: DK963198 [AcEST

    Lifescience Database Archive (English)

    Full Text Available X Result : Swiss-Prot sp_hit_id A4IYB1 Definition sp|A4IYB1|MIAA_FRATW tRNA delta(2)-isopentenylpyrophosphate transferase OS=Franci...i... 30 9.1 >sp|A4IYB1|MIAA_FRATW tRNA delta(2)-isopentenylpyrophosphate transferase OS=Francisella tularensis subsp. tularen...275 >sp|Q5NH42|MIAA_FRATT tRNA delta(2)-isopentenylpyrophosphate transferase OS=Francisella tularen...275 >sp|Q0BM87|MIAA_FRATO tRNA delta(2)-isopentenylpyrophosphate transferase OS=Francisella tularensis subsp...VKKGIVATRQLAKR 275 >sp|A0Q6S4|MIAA_FRATN tRNA delta(2)-isopentenylpyrophosphate transferase OS=Francisella tularensis subsp. novici

  19. Radio observations of the peripheral region of the Coma cluster near Coma A

    International Nuclear Information System (INIS)

    VLA and WSRT observations are reported for the extended radio source 1253+275 on the periphery of the Coma cluster and for two active Coma radio galaxies within 20 arcmin of 1253+275. The data are presented in contour maps and characterized in detail. Source 1253+275 is shown to be a relic radio galaxy with physical conditions similar to those seen in the external regions (30-50 kpc from the cores) of the two active sources (NGC 4789 and NGC 4827). It is suggested that these regions survived for long periods (400 Myr) after the last acceleration of the radiating electrons because transverse expansion was inhibited by the local intergalactic medium, which has a density comparable to that in other rich clusters of galaxies. 7 references

  20. Recombinant dengue type 1 virus NS5 protein expressed in Escherichia coli exhibits RNA-dependent RNA polymerase activity.

    Science.gov (United States)

    Tan, B H; Fu, J; Sugrue, R J; Yap, E H; Chan, Y C; Tan, Y H

    1996-02-15

    The complete nonstructural NS5 gene of dengue type 1 virus, Singapore strain S275/90 (D1-S275/90) was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein (126 kDa). The GST-NS5 fusion protein was purified and the recombinant NS5 protein released from the fusion protein by thrombin cleavage. The recombinant NS5 had a predicted molecular weight of 100 kDa and reacted with antiserum against D1-S275/90 virus in Western blot analysis. The purified recombinant NS5 protein possessed RNA-dependent RNA polymerase activity which was inhibited (>99%) by antibodies against the recombinant NS5 protein. The polymerase product was shown to be a negative-stranded RNA molecule, of template size, which forms a double-stranded complex with the template RNA. PMID:8607261

  1. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    International Nuclear Information System (INIS)

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose

  2. HDAC I inhibition in the dorsal and ventral hippocampus differentially modulates predator-odor fear learning and generalization

    Directory of Open Access Journals (Sweden)

    Robin K Yuan

    2015-09-01

    Full Text Available Although predator odors are ethologically relevant stimuli for rodents, the molecular pathways and contribution of some brain regions involved remain elusive. Inhibition of histone deacetylases (HDACs in the dorsal hippocampus has been shown to enhance shock-induced contextual fear learning, but it is unknown if HDACs have differential effects along the dorso-ventral hippocampal axis during predator odor fear learning. We injected MS-275, a class I HDAC inhibitor, bilaterally in the dorsal or ventral hippocampus of mice and found that it had no effects on innate anxiety in either region. We then assessed the effects of MS-275 at different stages of fear learning along the longitudinal hippocampal axis. Animals were injected with MS-275 or vehicle after context pre-exposure (pre-conditioning injections, when a representation of the context is first formed, or after exposure to coyote urine (post-conditioning injections, when the context becomes associated with predator odor. When MS-275 was administered after context pre-exposure, dorsally injected animals showed enhanced fear in the training context but were able to discriminate it from a neutral environment. Conversely, ventrally injected animals did not display enhanced learning in the training context but generalized the fear response to a neutral context. However, when MS-275 was administered after conditioning, there were no differences between MS-275 or vehicle control groups in either the dorsal or ventral hippocampus. Surprisingly, all groups displayed generalization to a neutral context, suggesting that predator odor exposure followed by the restraint necessary for the injections leads to fear generalization. These results may elucidate distinct functions of the dorsal and ventral hippocampus in predator odor-induced fear conditioning as well as some of the molecular mechanisms underlying fear generalization.

  3. Long-term mequindox treatment induced endocrine and reproductive toxicity via oxidative stress in male Wistar rats

    International Nuclear Information System (INIS)

    Mequindox (MEQ) is a synthetic antimicrobial chemical of quinoxaline 1, 4-dioxide group. This study was designed to investigate the hypothesis that MEQ exerts testicular toxicity by causing oxidative stress and steroidal gene expression profiles and determine mechanism of MEQ testicular toxicity. In this study, adult male Wistar rats were fed with MEQ for 180 days at five different doses as 0, 25, 55, 110 and 275 mg/kg, respectively. In comparison to control, superoxide dismutase (SOD), reduced glutathione (GSH) and 8-hydroxydeoxyguanosine (8-OHdG) levels were elevated at 110 and 275 mg/kg MEQ, whereas the malondialdehyde (MDA) level was slightly increase at only 275 mg/kg. Furthermore, in LC/MS-IT-TOF analysis, one metabolite 2-isoethanol 4-desoxymequindox (M11) was found in the testis. There was significant decrease in body weight, testicular weight and testosterone at 275 mg/kg, serum follicular stimulating hormone (FSH) at 110 and 275 mg/kg, while lutinizing hormone (LH) levels were elevated at 110 mg/kg. Moreover, histopathology of testis exhibited germ cell depletion, contraction of seminiferous tubules and disorganization of the tubular contents of testis. Compared with control, mRNA expression of StAR, P450scc and 17β-HSD in testis was significantly decreased after exposure of 275 mg/kg MEQ while AR and 3β-HSD mRNA expression were significantly elevated at the 110 mg/kg MEQ group. Taken together, our findings provide the first and direct evidence in vivo for the formation of free radicals during the MEQ metabolism through N → O group reduction, which may have implications to understand the possible mechanism of male infertility related to quinoxaline derivatives.

  4. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    Energy Technology Data Exchange (ETDEWEB)

    Kodera, Ryo, E-mail: kodera@cc.okayama-u.ac.jp [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Shikata, Kenichi [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Usui, Hitomi Kataoka [Department of Primary Care and Medical Education, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Makino, Hirofumi [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan)

    2014-01-17

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose.

  5. Characterization of a soluble, catalytically active form of Escherichia coli leader peptidase: requirement of detergent or phospholipid for optimal activity.

    Science.gov (United States)

    Tschantz, W R; Paetzel, M; Cao, G; Suciu, D; Inouye, M; Dalbey, R E

    1995-03-28

    Leader peptidase is a novel serine protease in Escherichia coli, which functions to cleave leader sequences from exported proteins. Its catalytic domain extends into the periplasmic space and is anchored to the membrane by two transmembrane segments located at the N-terminal end of the protein. At present, there is no information on the structure of the catalytic domain. Here, we report on the properties of a soluble form of leader peptidase (delta 2-75), and we compare its properties to those of the wild-type enzyme. We find that the truncated leader peptidase has a kcat of 3.0 S-1 and a Km of 32 microM with a pro-OmpA nuclease A substrate. In contrast to the wild-type enzyme (pI of 6.8), delta 2-75 is water-soluble and has an acidic isoelectric point of 5.6. We also show with delta 2-75 that the replacement of serine 90 and lysine 145 with alanine residues results in a 500-fold reduction in activity, providing further evidence that leader peptidase employs a catalytic serine/lysine dyad. Finally, we find that the catalysis of delta 2-75 is accelerated by the presence of the detergent Triton X-100, regardless if the substrate is pro-OmpA nuclease A or a peptide substrate. Triton X-100 is required for optimal activity of delta 2-75 at a level far below the critical micelle concentration. Moreover, we find that E. coli phospholipids stimulate the activity of delta 2-75, suggesting that phospholipids may play an important physiological role in the catalytic mechanism of leader peptidase. PMID:7696258

  6. Drug: D02124 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02124 Drug Penciclovir sodium (USAN); Denavir (TN) C10H14N5O3. Na 275.0994 275.239...LOGICAL USE D06B CHEMOTHERAPEUTICS FOR TOPICAL USE D06BB Antivirals D06BB06 Penciclovir D02124 Penciclovir s... J05AB Nucleosides and nucleotides excl. reverse transcriptase inhibitors J05AB13 Penciclov...ir D02124 Penciclovir sodium (USAN) USP drug classification [BR:br08302] Antivirals Antiherpetic Agents Penciclov...ir D02124 Penciclovir sodium (USAN) Antiinfectives [BR:br08307] Antivirals Anti-HSV agent DNA

  7. AcEST: DK953582 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0018_C13 571 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0018_C13. 5' end seq ... VLVPCLKAGHVGVVSVEFIAPALEG 383 Query: 174 RYVSHWRLSAPSG QKFGHRVWVVIHVVPH-GEKSP 275 Y SHWRLS GQ+FG RVW I V P ... VLVPCLKAGHVGVVSVEFIAPALEG 453 Query: 174 RYVSHWRLSAPSG QKFGHRVWVVIHVVPH-GEKSP 275 Y SHWRLS GQ+FG RVW I V P ... SLEPQ----EIADVSVQMCSPSTAGMYQ 156 Query: 183 SHWRLSAPSG QKFGHRVWVVIHV 251 WR+ +G +G +WV++ V Sbjct: 157 GQWR ... VLVPCLKAGHVGVVSVEFIAPTLEG 454 Query: 174 RYVSHWRLSAPSG QKFGHRVWVVIHVVP 257 Y SHWRLS GQ+FG RVW I V P Sbjct: ...

  8. AcEST: DK956868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0026_N23 491 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_N23. 5' end seq ... s = 38/64 (59%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL W ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ... aps = 2/80 (2%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL + ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ...

  9. Revisiting Oxidative Dehydrogenation of Ethane by W Doping into MoVMn Mixed Oxides at Low Temperature

    Directory of Open Access Journals (Sweden)

    Mohammed H. Al-Hazmi

    2015-01-01

    Full Text Available The catalytic performance of MoVMnW mixed oxides was investigated in the oxidative dehydrogenation of ethane at three different reaction temperatures (235, 255, and 275°C using oxygen as an oxidant. The catalysts were characterized by using X-ray diffraction, temperature-programmed reduction, and scanning electron microscopy. The MoVMnW mixed oxide catalyst showed the 70–90% of ethylene selectivity at the reaction temperatures. However, a significant decrease in the selectivity of ethylene was observed by increasing the reaction temperature from 235°C to 275°C.

  10. Drug: D01605 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01605 Drug Meticrane (JP16/INN); Arresten (TN) C10H13NO4S2 275.0286 275.3445 D0160...agents 214 Antihypertensives 2149 Others D01605 Meticrane (JP16/INN) Anatomical Therapeutic Chemical (ATC) c... C03BA Sulfonamides, plain C03BA09 Meticrane D01605 Meticrane (JP16/INN) Target-b...4426] [TC:2.A.30.4.2] Meticrane [ATC:C03BA09] D01605 Meticrane (JP16/INN) CAS: 1084-65-7 PubChem: 7848668 Li

  11. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, Northeastern Pacific Ocean

    Science.gov (United States)

    Simoneit, B.R.T.; Schoell, M.; Kvenvolden, K.A.

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source.We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7 per mill, respectively) reflect a primarily terrestrial organic matter source.

  12. Effects of irradiation at low temperature on V-4Cr-4Ti

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, D.J.; Snead, L.L.; Zinkle, S.J. [Oak Ridge National Lab., TN (United States)] [and others

    1996-10-01

    Irradiation at low temperatures (100 to 275{degrees}C) to 0.5 dpa causes significant embrittlement and changes in the subsequent room temperature tensile properties of V-4Cr-4Ti. The yield strength and microhardness at room temperature increase with increasing irradiation temperature. The tensile flow properties at room temperature show large increases in strength and a complete loss of work hardening capacity with no uniform ductility. Embrittlement, as measured by an increase in the ductile-to-brittle transition temperature, increases with increasing irradiation temperature, at least up to 275{degrees}C. This embrittlement is not due to pickup of O or other interstitial solutes during the irradiation.

  13. Factores de riesgo asociados al inicio de relaciones sexuales en adolescentes mujeres estudiantes de secundaria en La Paz, Bolivia

    OpenAIRE

    Ana Torrico Espinoza; Ariel Salas Mallea; Alvaro Gutiérrez Avilés; Mauricio Arce Carreón; Jorge Salazar Fuentes

    2004-01-01

    Objetivo: identificar factores de riesgo asociados al inicio de la actividad sexual en adolescentes mujeres estudiantes de secundaria en La Paz, Bolivia. Métodos: se realizó un estudio transversal mediante una encuesta anónima aplicada a estudiantes mujeres de los dos últimos años de secundaria de colegios públicos y privados de la ciudad de La Paz. Resultados: se analizaron 275 encuestas (n = 275). La edad promedio fue de 17 ± 0.8 años. Los factores de riesgo identificados fueron consumo de ...

  14. Numerical and experimental investigations of air flow turbulence characteristics in the wind tunnel contraction

    Czech Academy of Sciences Publication Activity Database

    Michalcová, V.; Kuznetsov, Sergeii; Brožovský, J.; Pospíšil, Stanislav

    Vol. 617. Pfaffikon: Trans Tech Publications, 2014 - (Kotrasova, K.; Melcer, J.), s. 275-279 ISBN 978-3-03835-197-9. ISSN 1660-9336. [International scientific conference on dynamic of civil engineering and transport structures and wind engineering /6./. Donovaly (SK), 25.05.2014-29.05.2014] R&D Projects: GA ČR(CZ) GA14-12892S Institutional support: RVO:68378297 Keywords : aerodynamics * wind tunnel contraction * CFD Subject RIV: JN - Civil Engineering http://scientific.stp.net/AMM.617.275

  15. Heat load and deuterium plasma effects on SPS and WSP tungsten

    Czech Academy of Sciences Publication Activity Database

    Vilémová, Monika; Matějíček, Jiří; Nevrlá, Barbara; Chernyshova, M.; Gasior, P.; Kowalska-Strzeciwilk, E.; Jäger, Aleš

    2015-01-01

    Roč. 60, č. 2 (2015), s. 275-283. ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA ČR(CZ) GA14-12837S Institutional support: RVO:61389021 ; RVO:68378271 Keywords : Tungsten * fusion * heat loading * irradiation * bubbles * surface damage Subject RIV: JJ - Other Materials; JJ - Other Materials (FZU-D) Impact factor: 0.477, year: 2014 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p275f.pdf

  16. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  17. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A.

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  18. Use of osteoplastic material to guide bone tissue regeneration deffect.

    Science.gov (United States)

    Machavariani, A; Mazmishvili, K; Grdzelidze, T; Menabde, G; Amiranashvili, I

    2011-12-01

    The goal of research was study of restoration processes in jaw-teeth bone defects by application of osteoplastic materials in the experiment. The experiment was performed over 32 white (6-12 month old) rats; the animals were divided into 2 groups; 16 animals were enrolled in the first group; the section was performed in the edge of lower jaw; the lower jaw body was revealed. Under the effect of the dental drilling machine and the # 1 cooling mean by the fissure bohrium (distilled water) the defect of the dimension of 2x2 mm was created; the defect was washed by 0/9% saline to remove the bone sawdust; the wound was sutured tightly, in layers. The second group of the experiment was staffed with 16 animals (main group); the similar bone defect of the size 2 x 2mm was created on the rat's jaw's body. After washing of modeled defect we inserted osteopathic materials PORESORB-TCP crystals with the size of 0,6-1.0 mm the wound was sutured tightly, in layers. After the 3-rd, 15-th, 30-th and 90-th days from the date of operation there was performed X-ray and morphological examination over the animals in the control as well as the main group. The analysis of the examination performed over the experimental materials showed that in the control group in samples taken at 90th day the defects were not completely restored. In the test group in samples taken at 90th day reparative regeneration is confirmed. This is stimulated by the factor that within the main group's animals the defect regeneration process is supported with the osteoplastic material PORESORB-TCP. PMID:22306506

  19. Chemical characterization of element 112.

    Science.gov (United States)

    Eichler, R; Aksenov, N V; Belozerov, A V; Bozhikov, G A; Chepigin, V I; Dmitriev, S N; Dressler, R; Gäggeler, H W; Gorshkov, V A; Haenssler, F; Itkis, M G; Laube, A; Lebedev, V Ya; Malyshev, O N; Oganessian, Yu Ts; Petrushkin, O V; Piguet, D; Rasmussen, P; Shishkin, S V; Shutov, A V; Svirikhin, A I; Tereshatov, E E; Vostokin, G K; Wegrzecki, M; Yeremin, A V

    2007-05-01

    The heaviest elements to have been chemically characterized are seaborgium (element 106), bohrium (element 107) and hassium (element 108). All three behave according to their respective positions in groups 6, 7 and 8 of the periodic table, which arranges elements according to their outermost electrons and hence their chemical properties. However, the chemical characterization results are not trivial: relativistic effects on the electronic structure of the heaviest elements can strongly influence chemical properties. The next heavy element targeted for chemical characterization is element 112; its closed-shell electronic structure with a filled outer s orbital suggests that it may be particularly susceptible to strong deviations from the chemical property trends expected within group 12. Indeed, first experiments concluded that element 112 does not behave like its lighter homologue mercury. However, the production and identification methods used cast doubt on the validity of this result. Here we report a more reliable chemical characterization of element 112, involving the production of two atoms of (283)112 through the alpha decay of the short-lived (287)114 (which itself forms in the nuclear fusion reaction of 48Ca with 242Pu) and the adsorption of the two atoms on a gold surface. By directly comparing the adsorption characteristics of (283)112 to that of mercury and the noble gas radon, we find that element 112 is very volatile and, unlike radon, reveals a metallic interaction with the gold surface. These adsorption characteristics establish element 112 as a typical element of group 12, and its successful production unambiguously establishes the approach to the island of stability of superheavy elements through 48Ca-induced nuclear fusion reactions with actinides. PMID:17476264

  20. Synthesis of the heaviest nuclei in cold fusion reactions

    Science.gov (United States)

    Münzenberg, G.; Morita, K.

    2015-12-01

    Cold fusion of heavy ions paved the way to superheavy elements. It was proposed by Yu.Ts. Oganessian more than forty years ago in 1974 [1,2]. First experiments were carried out at JINR Dubna, starting with the reaction 40Ar + 208Pb → 248Fm* where several hundreds to thousand atoms were produced on one day. The large production rate indicating an enhancement of the fusion cross section, especially for the evaporation of two or three neutrons, proved the concept of cold-fusion with the use of the doubly magic nucleus 208Pb as a target. The Dubna experiments were extended to the transactinide region beyond rutherfordium. The breakthrough came with the separation in-flight. Two different approaches were used: kinematic separation with the velocity filter SHIP [3] at GSI Darmstadt, and with the gasfilled separator GARIS [4,5] at RIKEN. With SHIP the concept of cold fusion of massive nuclear systems was convincingly confirmed by the observation of the one-neutron evaporation channel in the production of 247Rf in an irradiation of 208Pb with 50Ti [6] in 1981 which opened the way to the transactinide region. At SHIP the elements bohrium (107) to copernicium (112) were discovered [7]. A new closed shell region around hassium was found. The RIKEN experiments started in 2002. They confirmed the GSI results and in addition improved the data on structure and production of elements hassium to copernicium significantly. The heaviest element ever created in a cold fusion reaction, Z = 113, was observed at GARIS [8,9].

  1. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  2. MicroSISAK for the chemistry of the heaviest elements; MikroSISAK fuer die Chemie der schwersten Elemente

    Energy Technology Data Exchange (ETDEWEB)

    Hild, Daniel

    2012-05-18

    This thesis describes experiments with an apparatus called MicroSISAK which is able to perform liquid-liquid-extraction on a microliter-scale. Two immiscible liquids are mixed in a microstructured mixer unit and separated again via a Teflon membrane. In the first experiments, different extraction systems were explored for elements of the groups 4 and 7 of the periodic table. Their results were compared with those from batch experiments. The initial achieved extraction yields were insufficient for the envisaged experiments, for which reason different modifications were arranged to obtain improvements. With the aid of a heating element, which was connected to the MicroSISAK apparatus, one was able to rise the temperature for the extraction inside. This led to the expected increasing of the extraction yield. Furthermore the MikroSISAK apparatus was modified by the Institut fuer Mikrotechnik Mainz, which had developed and constructed this apparatus. The contact time of the two phases between the mixer and the separation unit was extended. This also led to an increased yield. Now the performance appeared to be sufficient to connect the apparatus to the TRIGAreactor Mainz to perform online-experiments. Fission products (technetium) produced in a nuclear reaction were guided to the MicroSISAK apparatus to separate them and to detect their decay in a γ-ray detector. Apart from the successful separations, the experiments also proved the functionality of a new degasser system and that an adequate detection system can be coupled to MicroSISAK. With this, the prerequisites for the vision of an application of MicroSISAK are realised: The investigation of the chemical properties of short-lived superheavy elements (SHE) at a heavy-ion accelerator. It is obvious to plan such an experiment for the heavy homolog of technetium, element 107, bohrium.

  3. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  4. New elements - approaching Z = 114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1998-06-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z = 107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavierelements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  5. Chemical characterization of element 112

    Science.gov (United States)

    Eichler, R.; Aksenov, N. V.; Belozerov, A. V.; Bozhikov, G. A.; Chepigin, V. I.; Dmitriev, S. N.; Dressler, R.; Gäggeler, H. W.; Gorshkov, V. A.; Haenssler, F.; Itkis, M. G.; Laube, A.; Lebedev, V. Ya.; Malyshev, O. N.; Oganessian, Yu. Ts.; Petrushkin, O. V.; Piguet, D.; Rasmussen, P.; Shishkin, S. V.; Shutov, A. V.; Svirikhin, A. I.; Tereshatov, E. E.; Vostokin, G. K.; Wegrzecki, M.; Yeremin, A. V.

    2007-05-01

    The heaviest elements to have been chemically characterized are seaborgium (element 106), bohrium (element 107) and hassium (element 108). All three behave according to their respective positions in groups 6, 7 and 8 of the periodic table, which arranges elements according to their outermost electrons and hence their chemical properties. However, the chemical characterization results are not trivial: relativistic effects on the electronic structure of the heaviest elements can strongly influence chemical properties. The next heavy element targeted for chemical characterization is element 112; its closed-shell electronic structure with a filled outer s orbital suggests that it may be particularly susceptible to strong deviations from the chemical property trends expected within group 12. Indeed, first experiments concluded that element 112 does not behave like its lighter homologue mercury. However, the production and identification methods used cast doubt on the validity of this result. Here we report a more reliable chemical characterization of element 112, involving the production of two atoms of 283112 through the alpha decay of the short-lived 287114 (which itself forms in the nuclear fusion reaction of 48Ca with 242Pu) and the adsorption of the two atoms on a gold surface. By directly comparing the adsorption characteristics of 283112 to that of mercury and the noble gas radon, we find that element 112 is very volatile and, unlike radon, reveals a metallic interaction with the gold surface. These adsorption characteristics establish element 112 as a typical element of group 12, and its successful production unambiguously establishes the approach to the island of stability of superheavy elements through 48Ca-induced nuclear fusion reactions with actinides.

  6. MicroSISAK for the chemistry of the heaviest elements

    International Nuclear Information System (INIS)

    This thesis describes experiments with an apparatus called MicroSISAK which is able to perform liquid-liquid-extraction on a microliter-scale. Two immiscible liquids are mixed in a microstructured mixer unit and separated again via a Teflon membrane. In the first experiments, different extraction systems were explored for elements of the groups 4 and 7 of the periodic table. Their results were compared with those from batch experiments. The initial achieved extraction yields were insufficient for the envisaged experiments, for which reason different modifications were arranged to obtain improvements. With the aid of a heating element, which was connected to the MicroSISAK apparatus, one was able to rise the temperature for the extraction inside. This led to the expected increasing of the extraction yield. Furthermore the MikroSISAK apparatus was modified by the Institut fuer Mikrotechnik Mainz, which had developed and constructed this apparatus. The contact time of the two phases between the mixer and the separation unit was extended. This also led to an increased yield. Now the performance appeared to be sufficient to connect the apparatus to the TRIGAreactor Mainz to perform online-experiments. Fission products (technetium) produced in a nuclear reaction were guided to the MicroSISAK apparatus to separate them and to detect their decay in a γ-ray detector. Apart from the successful separations, the experiments also proved the functionality of a new degasser system and that an adequate detection system can be coupled to MicroSISAK. With this, the prerequisites for the vision of an application of MicroSISAK are realised: The investigation of the chemical properties of short-lived superheavy elements (SHE) at a heavy-ion accelerator. It is obvious to plan such an experiment for the heavy homolog of technetium, element 107, bohrium.

  7. New elements - approaching Z = 114

    International Nuclear Information System (INIS)

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z = 107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  8. New elements - approaching ?

    Science.gov (United States)

    Hofmann, S.

    1998-06-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements 0034-4885/61/6/002/img2 were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of 0034-4885/61/6/002/img3 correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small 0034-4885/61/6/002/img4-, 0034-4885/61/6/002/img5- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using 0034-4885/61/6/002/img6 targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  9. An experimental paradigm opening the world of superheavy elements

    Science.gov (United States)

    Armbruster, P.; Münzenberg, Gottfried

    2012-07-01

    The history of the discovery of the six elements Z = 107 ∓ 112, bohrium, hassium, meitnerium, darmstadtium, roentgenium, and copernicium goes back to the early 1960s. An experimental method to separate and identify rare nuclear reaction products, the recoil separation, was developed and optimised for beams of fission products at European research reactors. Chemical elements beyond the then first transactinides ( Z = 104), which owe their stability to the internal structure of atomic nuclei, were predicted theoretically. A big brother of the shell-stabilised nucleus 208Pb, a spherical magic nucleus at Z = 114∓126 and N = 184, might reach lifetimes long enough to be detected. In the seventies, hunting superheavy elements (SHE) was on the agenda of nuclear chemistry. Could the Periodic Table of Elements be extended to Z = 120, and is the order of electrons in the atom still following the laws established for lighter elements? In Germany, the heavy ion accelerator (UNILAC) was built by Christoph Schmelzer and his team at GSI, Darmstadt. SHE and UNILAC met the recoil separators in 1968, and SHIP (Separator for Heavy Ion reaction Products) was ready together with the first UNILAC-beams in 1976. Recoil separation is orders of magnitude more sensitive, selective, and faster than earlier methods used to synthesise elements up to seaborgium, Z = 106. The experimental paradigm we introduced opened the world of SHEs. At SHIP we discovered and investigated the elements Z = 107∓112 in the years 1980-2000. Our laboratory was the world champion during this time. Today our experimental method is used worldwide in the search for SHEs, but the leadership went to the Russian laboratory JINR in Dubna, which extended the Periodic Table by 6 more elements to Z = 118, the candidate for the next rare gas.

  10. Development of molecular assays for the identification of the 11 Eimeria species of the domestic rabbit (Oryctolagus cuniculus)

    Czech Academy of Sciences Publication Activity Database

    Oliveira, U. C.; Fraga, J. S.; Licois, D.; Pakandl, Michal; Gruber, A.

    2011-01-01

    Roč. 176, 2/3 (2011), 275-280. ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Eimeria * Rabbit * Coccidiosis * ITS1 * Ribosomal DNA * PCR-based diagnosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011

  11. Atlas of isoseismal maps of selected Greek earthquakes (1953-2003)

    Czech Academy of Sciences Publication Activity Database

    Schenková, Zdeňka; Kalogeras, I.; Schenk, Vladimír; Pichl, Richard; Kourouzidis, M.; Stavrakakis, G.

    Geneva: Swiss Seismological Service, 2006. s. 275. [European Conference on Earthquake Engineering and Seismology/1./. 03.09.2006-08.09.2006, Geneva] R&D Projects: GA MŠk ME 694 Institutional research plan: CEZ:AV0Z30460519 Keywords : isoseimal maps * kriging * Greek earthquakes Subject RIV: DB - Geology ; Mineralogy

  12. High-resolution infrared spectroscopy of the ν2 = ν6 = 1 combination level of DCF3

    Czech Academy of Sciences Publication Activity Database

    Pracna, Petr; Pretkowski, T.; Lodyga, W.; Kreglewski, M.

    2012-01-01

    Roč. 275, č. 276 (2012), s. 31-34. ISSN 0022-2852 R&D Projects: GA MŠk LC06071 Institutional research plan: CEZ:AV0Z40400503 Keywords : deuterated fluoroform * high-resolution IR spectroscopy * combination bands Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.670, year: 2012

  13. DFT calculations of vibrational spectra of oxidized (111) diamond surface

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Kozak, Halyna; Remeš, Zdeněk

    2015-01-01

    Roč. 7, č. 4 (2015), s. 275-278. ISSN 2164-6627 R&D Projects: GA ČR GPP205/12/P331; GA MŠk LH12186 Institutional support: RVO:68378271 Keywords : density functional theory * vibrational spectra * FTIR * diamond nanoparticles * functionalized diamond surface Subject RIV: JJ - Other Materials

  14. Specific expression of an oxytocin-enhanced cyan fluorescent protein fusion transgene in the rat hypothalamus and posterior pituitary

    Czech Academy of Sciences Publication Activity Database

    Katoh, A.; Fujihara, H.; Ohbuchi, T.; Onaka, T.; Scott, W. S. III.; Dayanithi, Govindan; Yamasaki, Y.; Kawata, M.; Suzuki, H.; Otsubo, H.; Suzuki, Hi.; Murphy, D.; Ueta, Y.

    2010-01-01

    Roč. 204, č. 3 (2010), s. 275-285. ISSN 0022-0795 Institutional research plan: CEZ:AV0Z50390703 Keywords : magnocellular neurons * neurosecretory-cells * hypothalamus Subject RIV: FH - Neurology Impact factor: 3.099, year: 2010

  15. Teaching Managerial Economics in MBA Programs: A Survey of AACSB Colleges

    Science.gov (United States)

    Kolluri, Bharat; Singamsett, Rao

    2007-01-01

    There is a significant variation in the managerial economics course in terms of the prerequisites, contents and delivery in the MBA programs of AACSB [Association to Advance Collegiate Schools of Business] institutions. In order to get detailed information on these aspects, we conducted a survey of 275 AACSB institutions and reported the results.…

  16. Soil biota and upper soil layer development in two contrasting post-mining chronosequences

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Keplin, B.; Pižl, Václav; Tajovský, Karel; Starý, Josef; Lukešová, Alena; Nováková, Alena; Balík, Vladimír; Háněl, Ladislav; Materna, Jan; Düker, Ch.; Chalupský, Josef; Rusek, Josef; Heinkele, T.

    2001-01-01

    Roč. 17, - (2001), s. 275-284. ISSN 0925-8574 R&D Projects: GA MŠk ME 076; GA ČR GA526/98/P156 Institutional research plan: CEZ:AV0Z6066911 Keywords : succession * coal mining * soil formation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.601, year: 2001

  17. Observation of reproductive behaviour of the common bream .i.Abramis brama./i. by the scientific echosounder

    Czech Academy of Sciences Publication Activity Database

    Prchalová, M.; Kubečka, Jan

    Praha: ICARIS, 2002. s. 275. [International Conference on Reservoir Limnology and Water Quality /4./. 12.08.2002-16.08.2002, České Budějovice] Institutional research plan: CEZ:AV0Z6017912 Keywords : reproductive behaviour * common bream Subject RIV: EH - Ecology, Behaviour

  18. Chaos and stability of age-0 fish assemblages in a temperate deep reservoir: unpredictable success and stable habitat use

    Czech Academy of Sciences Publication Activity Database

    Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Blabolil, Petr; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Muška, Milan; Peterka, Jiří; Prchalová, Marie; Říha, Milan; Tušer, Michal; Kubečka, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 217-234. ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : horizontal migration * Římov reservoir * trawling * seining * fry distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  19. 46 CFR 2.75-70 - Welding procedure and performance qualifications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Welding procedure and performance qualifications. 2.75... for Construction Personnel § 2.75-70 Welding procedure and performance qualifications. (a) Welding... requirements for the welding of pressure piping, boilers, pressure vessels, and nonpressure vessel type...

  20. 75 FR 35632 - Transparency Provisions of Section 23 of the Natural Gas Act

    Science.gov (United States)

    2010-06-23

    .... 704, FERC Stats. & Regs. ] 31,260, 73 FR 1014 (2007) (Final Rule) (Order No. 704). \\3\\ Energy Policy..., 73 FR 55726 (Sept. 26, 2008), FERC Stats. & Regs. ] 31,275 (2008) (Order No. 704-A). \\6\\ Transparency... contribute to a price index; however, if an unprocessed gas transaction is downstream of a plant (or no...

  1. Computers, pattern, chaos and beauty

    CERN Document Server

    Pickover, Clifford A

    1980-01-01

    Combining fractal theory with computer art, this book introduces a creative use of computers. It describes graphic methods for detecting patterns in complicated data and illustrates simple techniques for visualizing chaotic behavior. ""Beautiful."" - Martin Gardner, Scientific American. Over 275 illustrations, 29 in color.

  2. Study of adhesion of cement mixture and fibres and changes of its tension properties

    Czech Academy of Sciences Publication Activity Database

    Trčková, Jiřina; Řezba, Karel

    2009-01-01

    Roč. 6, č. 4 (2009), s. 475-482. ISSN 1214-9705 R&D Projects: GA ČR GA103/08/1197 Institutional research plan: CEZ:AV0Z30460519 Keywords : fibre cement mixture * pullout test * tension properties Subject RIV: JM - Building Engineering Impact factor: 0.275, year: 2009

  3. Filamentous hemagglutinin of Bordetella pertussis: a key adhesin with immunomodulatory properties?

    Czech Academy of Sciences Publication Activity Database

    Villarino Romero, Rodrigo; Osička, Radim; Šebo, Peter

    2014-01-01

    Roč. 9, č. 12 (2014), s. 1339-1360. ISSN 1746-0913 R&D Projects: GA ČR(CZ) P302/11/0580; GA ČR(CZ) GA13-14547S Institutional support: RVO:61388971 Keywords : Bordetella * adhesion * integrins * filamentous hemagglutinin Subject RIV: EE - Microbiology, Virology Impact factor: 4.275, year: 2014

  4. Analysis of organic colouring and binding components in colour layer of art works

    Czech Academy of Sciences Publication Activity Database

    Kučková, Š.; Němec, I.; Hynek, R.; Hradilová, J.; Grygar, Tomáš

    2005-01-01

    Roč. 382, č. 2 (2005), s. 275-282. ISSN 1618-2642 R&D Projects: GA ČR GA203/04/2091 Institutional research plan: CEZ:AV0Z40320502 Keywords : proteins * binders * painting Subject RIV: CA - Inorganic Chemistry Impact factor: 2.695, year: 2005

  5. Homeschooling. ERIC Digest.

    Science.gov (United States)

    Lines, Patricia M.

    Homeschooling has grown over the past several decades. It is estimated that 923,700 to 1,275,098 children will be homeschooled by the 2001-02 school year. Homeschooling families come from all major ethnic, cultural, and religious backgrounds and all income levels. Homeschooling parents are commonly active in their communities and join community…

  6. 76 FR 67315 - Supplemental Nutrition Assistance Program: Quality Control Error Tolerance Threshold

    Science.gov (United States)

    2011-11-01

    ... Service 7 CFR Part 275 RIN 0584-AE24 Supplemental Nutrition Assistance Program: Quality Control Error... direct final rule is amending the Quality Control (QC) review error threshold in our regulations from $25... Assistance Program: Quality Control Error Tolerance Threshold Direct Rule, in the subject line of the...

  7. Environmental Effects Exceed Genetic Effects on Perceived Intensity and Pleasantness of Several Odors

    DEFF Research Database (Denmark)

    Knaapila, Antti; Tuorila, Hely; Silventoinen, Karri;

    2008-01-01

    pleasantness of cinnamon, chocolate, turpentine, and isovaleric acid (sweaty) odors by quantitative genetic modeling of odor rating data from 856 twin individuals (including 83 complete monozygotic and 275 dizygotic twin pairs) aged 10-60 years (44% males and 56% females) from Australia, Denmark, and Finland...

  8. Predicted levels of HIV drug resistance

    DEFF Research Database (Denmark)

    Cambiano, Valentina; Bertagnolio, Silvia; Jordan, Michael R;

    2014-01-01

    with nonnucleoside reverse transcriptase inhibitor (NNRTIs)-resistant virus in South Africa, 275 000 in majority virus [Non-nucleoside reverse transcriptase inhibitor resistant virus present in majority virus (NRMV)] with an unsuppressed viral load. If current diagnosis and retention in care and...

  9. 75 FR 43840 - Inflation Adjustment of the Ordinary Maximum and Aggravated Maximum Civil Monetary Penalties for...

    Science.gov (United States)

    2010-07-27

    ... civil monetary penalties per the Inflation Act. See 74 FR 68701 (December 29, 2009). FRA's maximum and... materials violation was $275. 69 FR 30590, May 28, 2004. To implement these SAFETEA-LU amendments to the maximum and minimum penalties, FRA issued a final rule that was published on December 26, 2006, 71...

  10. Arboviruses pathogenic for domestic and wild animals

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Nowotny, N.

    2014-01-01

    Roč. 89, č. 5 (2014), s. 201-275. ISSN 0065-3527 Institutional support: RVO:68081766 Keywords : West-Nile virus * Tick-borne encephalitis * Louping-ill virus * Cache-Valley virus * African-swine-fever * California serogroup virus * Kyasanur-forest-disease * sparrows Passer domesticus Subject RIV: EE - Microbiology, Virology Impact factor: 4.571, year: 2014

  11. Relationship between School Administrators' Organizational Power Sources and Teachers' Organizational Citizenship Behaviors

    Science.gov (United States)

    Altinkurt, Yahya; Yilmaz, Kursad

    2012-01-01

    The main purpose of the research was to determine correlation between school administrators' organizational power sources and teachers' organizational citizenship behaviors in primary schools. The research was a correlational survey model study. 275 participants were randomly chosen for the research. The data were collected by "Administrators'…

  12. 76 FR 77842 - Announcement of Funding Awards; Indian Community Development Block Grant Program; Fiscal Year 2011

    Science.gov (United States)

    2011-12-14

    ... A. Barrett, Chairman, 1601 S. Gordon Cooper Drive, Shawnee, OK 74801, (405) 275-3121. Comanche... housing units. Chairman 2678 Mexeye Loop, Coos Bay, OR 97420, (541) 756-0904. Crow Creek Housing Authority... Cedric 750,000 Public Facility Upgrade water system to Black Eagle, Tribal Chairman, P.O....

  13. Slides and the Foreign Language Teacher: A Bibliography.

    Science.gov (United States)

    Galt, Alan

    This bibliography lists 275 items relating to the use of visual and audiovisual aids in the foreign language classroom. The items are entered under the following major headings: (1) Audiovisual Aids; (2) Photography; (3) Picture Composition; (4) Slides and Photographs for Teaching; and (5) Slides and Slide Shows: Production and Presentation.…

  14. Genetic variation in the Hieracium rohacsense group (Hieracium sect. Alpina)

    Czech Academy of Sciences Publication Activity Database

    Mráz, P.; Chrtek, Jindřich; Kirschner, Jan

    2001-01-01

    Roč. 41, č. 2 (2001), s. 269-276. ISSN 0079-2047 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae, Compositae, Hieracium * Apomixis, isozymes * Flora of the Carpathians Subject RIV: EF - Botanics Impact factor: 0.275, year: 2001

  15. 75 FR 67333 - Telecommunications Relay Services and Speech-to-Speech Services for Individuals With Hearing and...

    Science.gov (United States)

    2010-11-02

    ... Rulemaking Proceedings, 63 FR 24121, May 1, 1998. Electronic Filers: Comments may be filed electronically... Commission issued the First Internet-based TRS Order, (73 FR 41307, July 18, 2010) in which it adopted a... Order, FCC 08-275 (75 FR 29914, May 28, 2010) released on December 19, 2008, the Commission...

  16. Drug: D04857 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04857 Mixture, Drug Zinc oxide - eugenol mixt; Neodyne (TN) Zinc oxide [DR:D01170]...s affecting individual organs 27 Dental preparations 275 Pulp capping agents 2750 Pulp capping agents D04857 Zinc oxide - eugenol mixt PubChem: 17398198 ...

  17. Spatial and temporal diversity of smlaa shallow waters in river Lužnice floodplain

    Czech Academy of Sciences Publication Activity Database

    Pithart, David; Pichlová, R.; Bílý, M.; Hrbáček, J.; Novotná, K.; Pechar, Libor

    2007-01-01

    Roč. 584, - (2007), s. 265-275. ISSN 0018-8158 R&D Projects: GA MŽP(CZ) SL/1/6/04 Institutional research plan: CEZ:AV0Z60870520 Keywords : floodplain * terrestrial-aquatic interactions * phytoplankton * zooplankton * shading * flooding Subject RIV: EH - Ecology, Behaviour Impact factor: 1.201, year: 2007

  18. Factors affecting growth and viability of natural diatom populations in the meso-eutrophic Římov Reservoir (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Znachor, Petr; Rychtecký, Pavel; Nedoma, Jiří; Visocká, Veronika

    2015-01-01

    Roč. 762, č. 1 (2015), s. 253-265. ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : diatom * growth rate * viability * PDMPO * SYTOX green * reservoir Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  19. Spatio-temporal study of phytoplankton cell viability in a eutrophic reservoir using SYTOX Green nucleic acid stain

    Czech Academy of Sciences Publication Activity Database

    Rychtecký, Pavel; Znachor, Petr; Nedoma, Jiří

    2014-01-01

    Roč. 740, č. 1 (2014), s. 177-189. ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : phytoplankton * reservoir * cell death * SYTOX Green Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  20. Swimming against the current: genetic structure, host mobility and the drift paradox in trematode parasites

    Czech Academy of Sciences Publication Activity Database

    Blasco-Costa, Maria Isabel; Waters, J. M.; Poulin, R.

    2012-01-01

    Roč. 21, č. 1 (2012), s. 207-217. ISSN 0962-1083 Institutional support: RVO:60077344 Keywords : freshwater * genetic diversity loss * linear ecosystems * population genetic structure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 6.275, year: 2012 http://onlinelibrary.wiley.com/doi/10.1111/j.1365-294X.2011.05374.x/pdf

  1. Dicty_cDB: Contig-U06991-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06991-1 no gap 275 6 3240869 3241135 PLUS 1 2 U06991 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Co ... 2 ( CP000848 ) Rickettsia rickettsii str. 'Sheila Smith ', comple... 30 4.1 2 ( CU928685 ) Pig DNA sequence ...

  2. Layered hydroxides intercalated with organic anions and their application in preparation of LDH/polymer nanocomposites

    Czech Academy of Sciences Publication Activity Database

    Kovanda, F.; Jindová, E.; Doušová, B.; Koloušek, D.; Pleštil, Josef; Sedláková, Zdeňka

    2009-01-01

    Roč. 6, č. 1 (2009), s. 111-119. ISSN 1214-9705 R&D Projects: GA AV ČR KAN100500651 Institutional research plan: CEZ:AV0Z40500505 Keywords : hydrotalcite * layered double hydroxides * intercalation Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.275, year: 2009

  3. Dealing with Drought: A Comparison of Perceptions and Coping Strategies of Iranian Farmers from Regions with Different Drought Intensities

    Science.gov (United States)

    Zarafshani, Kiumars; Gorgievski, Marjan J.; Zamani, Ghossein H.

    2007-01-01

    According to the World Disaster Report (Walter, 2004), drought and famine have proven to be the deadliest disasters of the decade worldwide, accounting for at least 275,000 deaths since 1994. This was nearly half the total for all natural disasters. The agricultural sector has been found to experience the largest variety of economic impacts…

  4. Hadron Multiplicities at HERMES

    OpenAIRE

    Hillenbrand, A.; Hartig, M.

    2005-01-01

    Hadron multiplicities of $\\pim$, $\\pip$, $\\km$ and $\\kp$ have been measured in the deep-inelastic scattering of 27.5 GeV positrons off a hydrogen target. The data used in this analysis have been collected during the 2000 HERA running period. The multiplicities were obtained for 0.15$< z

  5. Informed trading and the bid-ask spread: evidence from an emerging market

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Podpiera, R.

    2003-01-01

    Roč. 31, č. 2 (2003), s. 275-296. ISSN 0147-5967 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : market microstructure * bid-ask spread * informed trading Subject RIV: AH - Economics Impact factor: 0.746, year: 2003

  6. Drug: D00817 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available NO. HCl 275.0844 276.2021 D00817.gif Antidepressant ATC code: N06AX12 dopamine noradrenalin selective reupta...ANTIDEPRESSANTS N06AX Other antidepressants N06AX12 Bupropion D00817 Bupropion hydrochloride (JAN/USP) USP d...ropion D00817 Bupropion hydrochloride (JAN/USP) Antidepressants Antidepressants,

  7. Verzeihen und Versprechen als 'Mächte' politischen Handelns? Ansätze bei Hannah Arendt

    Czech Academy of Sciences Publication Activity Database

    Hagedorn, Ludger

    Würzburg : Königshausen und Neumann, 2007 - (Leghissa, G.; Staudigl, M.), s. 275-292 ISBN 978-3-8260-3586-9 Institutional research plan: CEZ:AV0Z90090514 Keywords : Political Theory * Forgiveness * Human Condition * Promising * Theory of Action Subject RIV: AA - Philosophy ; Religion

  8. Towards a better understanding of small scale distribution of littoral age-0 fish in a deep-valley reservoir: day or night surveys?

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Michal; Vašek, Mojmír; Peterka, Jiří; Draštík, Vladislav; Čech, Martin; Jůza, Tomáš; Muška, Milan; Matěna, Josef; Kubečka, Jan

    2014-01-01

    Roč. 728, č. 1 (2014), s. 125-139. ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : spatial distribution * habitat use * juvenile fish * littoral zone * deep reservoirs * electrofishing Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  9. Mounting of the travelling bridge crane with different legs at the Huragua NPP

    International Nuclear Information System (INIS)

    Specific features of erection of in-service travelling bridge crane with different legs having the load-carrying capacity of 32/5 t and span of 27.5 m at the Huragua NPP (Cuba) are considered. Schematic diagrams of the main erection operation realizations are given. The advantages of the method suggested are demonstrated

  10. An Investigation of Psychometric Properties of Coping Styles Scale Brief Form: A Study of Validity and Reliability

    Science.gov (United States)

    Bacanli, Hasan; Surucu, Mustafa; Ilhan, Tahsin

    2013-01-01

    The aim of the current study was to develop a short form of Coping Styles Scale based on COPE Inventory. A total of 275 undergraduate students (114 female, and 74 male) were administered in the first study. In order to test factors structure of Coping Styles Scale Brief Form, principal components factor analysis and direct oblique rotation was…

  11. New states in SmS

    International Nuclear Information System (INIS)

    Quasihydrostatic pressure resistivity experiments on a single crystal of SmS are reported up to 27.5 kbar. At low temperature, a regime change occurs at P approximately 20 kbar, between a ''quasiinsulating'' behavior (P 20 kbar). Striking similarities appear with TmSe and TmS cases. (author)

  12. Study of endogenic abscisic acids and cytokinin content in soybean crops of variable salt sensitivity as well as the effect of exogenically applied abscisic acid on Cl/sup -/ translocation. [in German

    Energy Technology Data Exchange (ETDEWEB)

    Roeb, G.

    1981-05-01

    A study of the phytohormones abscisic acid and cytokinin with respect to plant salt stress and its relationship to genetic control over endogen content. An analysis is made of the acid cytokinin content, and an investigation is made of the influence exerted by exogenic applied synthetic abscisic acid on Cl/sup -/ uptake and accumulation. 275 references, 14 figures, 11 tables.

  13. High resolution VLA observations of quasars with distorted radio structure

    International Nuclear Information System (INIS)

    To examine the physics of distorted quasars, the authors have mapped the quasars 3C 270.1 and 3C 275.1 in both I and P using the VLA A-Array at 20 cm and 6 cm. The results are displayed in tables and figures but are not discussed. (Auth.)

  14. La frontera "de Arriba" Chilena y el camino de Chiloé a Valdivia, 1786-1788

    OpenAIRE

    Urbina Carrasco, María Ximena

    2005-01-01

    La "frontera huilliche" al sur de valdivia y al norte de chiloé - sus capitales distan 275 kms. - se intentó ocupar mediante los planes de conquista militar del intendente de chiloé francisco hurtado y los del gobernador de valdivia, mariano pusterla, que

  15. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275. ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  16. Hegelova teorie mravního státu

    Czech Academy of Sciences Publication Activity Database

    Chotaš, Jiří

    2003-01-01

    Roč. 51, č. 2 (2003), s. 275-291. ISSN 0015-1831 R&D Projects: GA ČR GA401/03/0863 Institutional research plan: CEZ:AV0Z9009908 Keywords : state * ethical state * Hegel * Popper Subject RIV: AA - Philosophy ; Religion

  17. A Proof of Concept Imaging System for Automated Cervical Cancer Screening in Peru

    Science.gov (United States)

    Raza Garcia, Mabel Karel

    2013-01-01

    Cervical cancer is the second most frequent cancer in women around the world and affects half a million women per year. The World Health Organization (WHO) estimates that 275,000 women die every year, and 80% to 85% of these deaths occur in low-resource countries in Africa and South America. In Peru, cervical cancer has the highest incidence and…

  18. Isotopic studies of beach rock carbonates from Konkan, central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, B.; Rajamanickam, G.V.; Gujar, A.R.

    .7% (PDB) and delta sup(18)O signatures lie in a narrow range of +27.5 to +28.6% (SMOW), respectively. Isotopic data obtained in this study show that cementation of beach rock carbonates might have taken place in a shallow vadose zone. The large variations...

  19. Continual Induction Hardening of Axi-Symmetric Bodies

    Czech Academy of Sciences Publication Activity Database

    Doležel, Ivo; Barglik, J.; Ulrych, B.

    2005-01-01

    Roč. 161, - (2005), s. 269-275. ISSN 0924-0136 R&D Projects: GA MŠk(CZ) LN00B084 Institutional research plan: CEZ:AV0Z20570509 Keywords : continual induction hardening * induction heating * electromagnetic field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.592, year: 2005

  20. On the amount of information resulting from empirical and theoretical knowledge

    Czech Academy of Sciences Publication Activity Database

    Vajda, Igor; Veselý, Arnošt; Zvárová, Jana

    2005-01-01

    Roč. 18, č. 2 (2005), s. 275-283. ISSN 1139-1138 R&D Projects: GA MŠk LN00B107; GA MŠk 1M0572 Institutional research plan: CEZ:AV0Z10750506 Keywords : ontology * knowledge area * empirical knowledge * amount of information Subject RIV: BA - General Mathematics