WorldWideScience

Sample records for bohrium 275

  1. From bohrium to copernicium and beyond SHE research at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Münzenberg, G., E-mail: G.Muenzenberg@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)

    2015-12-15

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 28 CFR 27.5 - Review.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Review. 27.5 Section 27.5 Judicial... Investigating Reprisal Allegations and Ordering Corrective Action § 27.5 Review. The Complainant or the FBI may..., review by the Deputy Attorney General of that determination or order. The Deputy Attorney General shall...

  4. Dicty_cDB: SLH275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH275 (Link to dictyBase) - - - Contig-U16280-1 SLH275Z (Link... to Original site) - - SLH275Z 543 - - - - Show SLH275 Library SL (Link to library) Clone ID SLH275 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH275Q.Seq.d/ Representative seq. ID SLH27...5Z (Link to Original site) Representative DNA sequence >SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ XXXXX...ignificant alignments: (bits) Value SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ 1076 0.0 SLH850 (SLH850Q)

  5. 21 CFR 556.275 - Fenbendazole.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Fenbendazole. 556.275 Section 556.275 Food and... Residues of New Animal Drugs § 556.275 Fenbendazole. (a) Acceptable daily intake (ADI). The ADI for total residues of fenbendazole is 40 micrograms per kilogram of body weight per day. (b) Tolerances—(1) Cattle—(i...

  6. 25 CFR 275.4 - Implementing regulations.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Implementing regulations. 275.4 Section 275.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM STAFFING § 275.4 Implementing regulations. Regulations to implement section 105 of the Act...

  7. 7 CFR 275.15 - Data management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Data management. 275.15 Section 275.15 Agriculture... § 275.15 Data management. (a) Analysis. Analysis is the process of classifying data, such as by areas of... management information sources available to: (1) Identify all deficiencies in program operations and systems...

  8. 47 CFR 25.275 - Particulars of operation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Particulars of operation. 25.275 Section 25.275 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.275 Particulars of operation. (a) Radio station authorizations issued under this...

  9. 14 CFR 171.275 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.275 Section 171.275... Reports. The owner of the ISMLS facility or his maintenance representative must make the following reports... the need for periodic maintenance visits to the facility, monthly reports from the remote monitoring...

  10. 21 CFR 173.275 - Hydrogenated sperm oil.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Hydrogenated sperm oil. 173.275 Section 173.275... CONSUMPTION Solvents, Lubricants, Release Agents and Related Substances § 173.275 Hydrogenated sperm oil. The food additive hydrogenated sperm oil may be safely used in accordance with the following prescribed...

  11. 21 CFR 73.275 - Dried algae meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture broth...

  12. 21 CFR 137.275 - Yellow corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yellow corn meal. 137.275 Section 137.275 Food and... Related Products § 137.275 Yellow corn meal. Yellow corn meal conforms to the definition and standard of identity prescribed by § 137.250 for white corn meal except that cleaned yellow corn is used instead of...

  13. 7 CFR 275.6 - Management units.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Management Evaluation (ME... management unit; (iii) Food Stamp Program participation, including the number of persons and number of... 7 Agriculture 4 2010-01-01 2010-01-01 false Management units. 275.6 Section 275.6 Agriculture...

  14. 7 CFR 2.75 - Deputy Chief Financial Officer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Financial Officer. 2.75 Section 2.75... AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Financial Officer § 2.75 Deputy Chief Financial Officer. Pursuant to § 2.28, the following delegation of authority is made by the...

  15. 7 CFR 275.16 - Corrective action planning.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Corrective action planning. 275.16 Section 275.16... Corrective action planning. (a) Corrective action planning is the process by which State agencies shall...)/management unit(s) in the planning, development, and implementation of corrective action are those which: (1...

  16. 17 CFR 275.206(4)-1 - Advertisements by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment advisers. 275.206(4)-1 Section 275.206(4)-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements by investment advisers. (a) It shall...

  17. 7 CFR 275.13 - Review of negative cases.

    Science.gov (United States)

    2010-01-01

    ... State systems, the review date for negative cases could be the date of the agency's decision to deny... household which was listed incorrectly in the negative frame. (f) Demonstration projects/SSA processing. A... 7 Agriculture 4 2010-01-01 2010-01-01 false Review of negative cases. 275.13 Section 275.13...

  18. Formation and early hydration characteristics of C2.75B1.25A3$ in binary system of C2.75B1.25A3$-C2S

    Directory of Open Access Journals (Sweden)

    Wang, Shoude

    2016-09-01

    Full Text Available C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2O3• SO3 is one of the important minerals and it govern-directly the early-strength of belite-barium calcium sulphoaluminate cement. In this paper a binary system C2.75B1.25A3$-C2S is selected to investigate the formation of C2.75B1.25A3$. In the range of 1100 °C–1200 °C, the earlier formed C2S hinders the formation of C2.75B1.25A3$. On the contrary, when the temperature is in the range of 1200 °C–1350 °C, the initially formed C2S could provide a surface for the nucleation of C2.75B1.25A3$ and cut down the potential barrier (?Gk* for the heterogeneous nucleation of C2.75B1.25A3$, which contributes to its formation. Moreover, at 1350 °C, the large amount of previously formed C2S benefits the extent of formation of C2.75B1.25A3$. The possible reason was that it could prevent sulfur evaporation. In early hydration age, AFm and AFt originating from C2.75B1.25A3$ hydration are found within 2 h and 12 h under 95% RH at 1 °C, respectively, whereas C2S is unhydrated at this moment.En el cemento de sulfoaluminato de calcio y bario, el C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2 O3• SO3 es una de las principales fases, y regula directamente la resistencia inicial del cemento. En este trabajo, se ha seleccionado el sistema binario C2.75B1.25A3$-C2S para investigar la formación de C2.75B1.25A3$. En el rango de 1100 °C-1200 °C, el C2S formado anteriormente impide la formación de C2.75B1.25A3$, mientras que cuando la temperatura está entre 1200 °C-1350 °C, el C2S proporcionaría una superficie de nucleación de C2.75B1.25A3$ reduciendo la barrera de potencial (?Gk* para la nucleación heterogénea de C2.75B1.25A3$, lo que contribuye a su formación. Además, a 1350 °C, la gran cantidad de C2S formado beneficia la formación de C2.75B1.25A3$, ya que podía prevenir la evaporación del azufre. En las primeras etapas de la hidratación (entre 2 y 12h y 95% HR a 1 ºC se pueden encontrar AFM y AFt

  19. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian

    2013-01-01

    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py...

  20. 32 CFR Appendix B to Part 275 - Obtaining Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Customer Authorization B Appendix B to... OF 1978 Pt. 275, App. B Appendix B to Part 275—Obtaining Customer Authorization A. A DoD law... feasible, obtain the customer's consent. B. Any authorization obtained under paragraph A. of this appendix...

  1. 17 CFR 275.203-2 - Withdrawal from investment adviser registration.

    Science.gov (United States)

    2010-04-01

    ... application). (b) Electronic filing. Once you have filed your Form ADV (17 CFR 279.1) (or any amendments to... file must be filed with the IARD, unless you have received a hardship exemption under § 275.203-3. (c... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203-2...

  2. 17 CFR 275.204-1 - Amendments to application for registration.

    Science.gov (United States)

    2010-04-01

    ... you have received a continuing hardship exemption under § 275.203-3. (2) If you have received a... (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.204-1 Amendments to application for... a complete Part 1A of Form ADV on paper with the SEC by mailing it to FINRA. (c) Special rule for...

  3. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of business...

  4. 32 CFR Appendix J to Part 275 - Format for Customer Authorization

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Format for Customer Authorization J Appendix J... OF 1978 Pt. 275, App. J Appendix J to Part 275—Format for Customer Authorization Pursuant to section 3404(a) of the Right to Financial Privacy Act of 1978, I, [Name of customer], having read the...

  5. 24 CFR 213.275 - Nature of the Cooperative Management Housing Insurance Fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of the Cooperative Management Housing Insurance Fund. 213.275 Section 213.275 Housing and Urban Development Regulations Relating... Nature of the Cooperative Management Housing Insurance Fund. The Cooperative Management Housing Insurance...

  6. 17 CFR 275.206(3)-2 - Agency cross transactions for advisory clients.

    Science.gov (United States)

    2010-04-01

    ... advisory clients. 275.206(3)-2 Section 275.206(3)-2 Commodity and Securities Exchanges SECURITIES AND... Agency cross transactions for advisory clients. (a) An investment adviser, or a person registered as a... advisory client, if: (1) The advisory client has executed a written consent prospectively authorizing the...

  7. Ário Dídimo, Epítome de Ética Estoica, 2.7.5A- 2.7.5B

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinto de Brito

    2016-06-01

    Full Text Available RESUMO: Tradução dos passos 2.7.5A- 2.7.5B da Epitome de Etica Estoica, do filósofo estoico e doxógrafo alexandrino Ário Dídimo (acme 30 a.C.. Não há traduções em língua moderna das obras completas de Ário Dídimo. Assim, para esta tradução, usamos a fixação da exposição sobre a ética estoica presente em Estobeu (Florilegio, realizada por Pomeroy (1999. A seção que traduzimos versa sobre o conceito estoico de excelência, explicando o que ela é, quais as virtudes que dela participam, e como. Por antítese, Ário Dídimo também elucida o conceito estoico de vício, o que ele é e qual a sua taxonomia.

  8. 9 CFR 2.75 - Records: Dealers and exhibitors.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE ANIMAL WELFARE REGULATIONS Records § 2.75 Records: Dealers and exhibitors. (a)(1) Each dealer... breed or type; (B) The sex; (C) The date of birth or approximate age; and (D) The color and any...

  9. 17 CFR 275.206(4)-2 - Custody of funds or securities of clients by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... of clients by investment advisers. 275.206(4)-2 Section 275.206(4)-2 Commodity and Securities... 1940 § 275.206(4)-2 Custody of funds or securities of clients by investment advisers. (a) Safekeeping... client funds or securities unless: (1) Qualified custodian. A qualified custodian maintains those funds...

  10. 43 CFR 27.5 - Equal opportunity terms.

    Science.gov (United States)

    2010-10-01

    ... contract will not exceed $10,000). (2) Recipient will make every good faith effort to secure the compliance... Public Law 93-153. (iv) Contractor's noncompliance with the nondiscrimination clauses of this contract or... UNDER TITLE II OF PUBLIC LAW 93-153 § 27.5 Equal opportunity terms. Each permit, right-of-way, public...

  11. 5 CFR 532.275 - Special wage schedules for ship surveyors in Puerto Rico.

    Science.gov (United States)

    2010-01-01

    ... in Puerto Rico. 532.275 Section 532.275 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... schedules for ship surveyors in Puerto Rico. (a) The Department of Defense shall establish special wage schedules for nonsupervisory ship surveyors and supervisory ship surveyors in Puerto Rico. (b) Rates shall...

  12. 17 CFR 275.206(3)-3T - Temporary rule for principal trades with certain advisory clients.

    Science.gov (United States)

    2010-04-01

    ... trades with certain advisory clients. 275.206(3)-3T Section 275.206(3)-3T Commodity and Securities... 1940 § 275.206(3)-3T Temporary rule for principal trades with certain advisory clients. (a) An..., sells to or purchases from an advisory client any security if: (1) The investment adviser exercises no...

  13. 24 CFR 990.275 - Project-based management (PBM).

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Project-based management (PBM). 990... URBAN DEVELOPMENT THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.275 Project-based... of rental housing at the project level. Under PBM, these property management services are arranged...

  14. 275 C Downhole Microcomputer System

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Hooi Miin Soo

    2008-08-31

    An HC11 controller IC and along with serial SRAM and ROM support ICs chip set were developed to support a data acquisition and control for extreme temperature/harsh environment conditions greater than 275 C. The 68HC11 microprocessor is widely used in well logging tools for control, data acquisition, and signal processing applications and was the logical choice for a downhole controller. This extreme temperature version of the 68HC11 enables new high temperature designs and additionally allows 68HC11-based well logging tools and MWD tools to be upgraded for high temperature operation in deep gas reservoirs, The microcomputer chip consists of the microprocessor ALU, a small boot ROM, 4 kbyte data RAM, counter/timer unit, serial peripheral interface (SPI), asynchronous serial interface (SCI), and the A, B, C, and D parallel ports. The chip is code compatible with the single chip mode commercial 68HC11 except for the absence of the analog to digital converter system. To avoid mask programmed internal ROM, a boot program is used to load the microcomputer program from an external mask SPI ROM. A SPI RAM IC completes the chip set and allows data RAM to be added in 4 kbyte increments. The HC11 controller IC chip set is implemented in the Peregrine Semiconductor 0.5 micron Silicon-on-Sapphire (SOS) process using a custom high temperature cell library developed at Oklahoma State University. Yield data is presented for all, the HC11, SPI-RAM and ROM. The lessons learned in this project were extended to the successful development of two high temperature versions of the LEON3 and a companion 8 Kbyte SRAM, a 200 C version for the Navy and a 275 C version for the gas industry.

  15. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  16. MicroRNA-275 and its target Vitellogenin-2 are crucial in ovary development and blood digestion of Haemaphysalis longicornis.

    Science.gov (United States)

    Hao, Jiawei; Luo, Jin; Chen, Ze; Ren, Qiaoyun; Guo, Jinxia; Liu, Xiaocui; Chen, Qiuyu; Wu, Feng; Wang, Zhen; Luo, Jianxun; Yin, Hong; Wang, Hui; Liu, Guangyuan

    2017-05-22

    The hard tick Haemaphysalis longicornis is widely distributed in eastern Asia, New Zealand and Australia and is considered the major vector of Theileria and Babesia, harmful parasites to humans and animals. Female ticks need successful blood meals to complete the life-cycle. Therefore, elucidation of the underlying molecular mechanisms of H. longicornis development and reproduction is considered important for developing control strategies against the tick and tick-borne pathogens. Luciferase assays were used to identify the targets of micro RNA miR-275 in vitro. RNAi of Vitellogenin (Vg) was used in phenotype rescue experiments of ticks with miR-275 inhibition, and these analyses were used to identify the authentic target of miR-275 in vivo. The expression of miR-275 in different tissues and developmental stages of ticks was assessed by real-time PCR. To elucidate the functions of miR-275 in female ticks, we injected a miR-275 antagomir into female ticks and observed the phenotypic changes. Statistical analyses were performed with GraphPad5 using Student's t-test. In this study, we identified Vg-2 as an authentic target of miR-275 both in vitro and in vivo by luciferase assays and phenotype rescue experiments. miR-275 plays the regulatory role in a tissue-specific manner and differentially in developmental stages. Silencing of miR-275 resulted in blood digestion problems, substantially impaired ovary development and significantly reduced egg mass (P development. These findings improve the molecular understanding of tick development and reproduction.

  17. 275 Uses and Gratifications of Home Videos among the Nigerian ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... (Pp. 275-290). Nnaji, Ndubuisi C. - Department of Mass Communication, University of ... the gratifications sought by teenagers in Enugu-North Local Government .... introduced special effects on film with this single innovation.

  18. 40 CFR 421.275 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... Nickel 0.000 0.000 (e) Sodium hypochlorite filter backwash. PSES for the Primary Rare Earth Metals...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Rare Earth Metals Subcategory § 421.275 Pretreatment standards for existing sources. Except as provided in 40 CFR...

  19. 21 CFR 172.275 - Synthetic paraffin and succinic derivatives.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Synthetic paraffin and succinic derivatives. 172... FOOD FOR HUMAN CONSUMPTION Coatings, Films and Related Substances § 172.275 Synthetic paraffin and succinic derivatives. Synthetic paraffin and succinic derivatives identified in this section may be safely...

  20. 17 CFR 275.222-2 - Definition of “client” for purposes of the national de minimis standard.

    Science.gov (United States)

    2010-04-01

    ... 1940 § 275.222-2 Definition of “client” for purposes of the national de minimis standard. For purposes... definition of “client” provided by section 275.203(b)(3)-1 without giving regard to paragraph (b)(6) of that...

  1. 17 CFR 275.203-1 - Application for investment adviser registration.

    Science.gov (United States)

    2010-04-01

    ... must file electronically with the Investment Adviser Registration Depository (IARD), unless you have... you have paid the filing fee. [65 FR 57448, Sept. 22, 2000; 65 FR 81737, Dec. 27, 2000; 68 FR 42248... EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203-1...

  2. Experimental study on inhibitory effects of histone deacetylase inhibitor MS-275 and TSA on bladder cancer cells.

    Science.gov (United States)

    Qu, Wei; Kang, Yin-Dong; Zhou, Mei-Sheng; Fu, Li-Li; Hua, Zhen-Hao; Wang, Li-Ming

    2010-01-01

    To investigate the inhibitory effect of histone deacetylase (HDAC) inhibitors (MS-275 and TSA) on T24 human bladder cancer cells in vitro, and explore the possible mechanism. The MTT assay was employed to evaluate the inhibitory effect of MS-275 and TSA on T24 cell growth. FCM was used to analyze the variation of T24 cell cycle distribution and the apoptotic ratio after T24 cells were treated with MS-275 and TSA. Histone acetylation level was detected by Western blot. mRNA expression of p21 WAF1/CIP1, cyclin A, and cyclin E was measured by FQ-PCR. Dynamic changes of Bcl-2 and bax expression were detected by FCM. MS-275 and TSA inhibited T24 cell growth in a concentration and time-dependent manner. Treatment with 4 μmol/l MS-275 or 0.4 μmol/l TSA blocked cell cycling in the G0/G1 phase and induced a significant increase in cell apoptosis. MS-275 and TSA significantly increased the level of histone acetylation, induced p21CIP1WAF1 mRNA expression, and inhibited cyclin A mRNA expression, though no significant effect was observed on cyclin E. Bcl-2 expression was down-regulated, while bax expression was up-regulated. HDAC inhibitors can block bladder cancer cell cycle in vitro and induce apoptosis. The molecular mechanism may be associated with increased level of histone acetylation, down-regulation of p21WAF1/CIP1 expression, up-regulation of cyclin A expression, and dynamic change of bcl-2 and bax expression. Copyright © 2010 Elsevier Inc. All rights reserved.

  3. 17 CFR 275.206(4)-4 - Financial and disciplinary information that investment advisers must disclose to clients.

    Science.gov (United States)

    2010-04-01

    ... information that investment advisers must disclose to clients. 275.206(4)-4 Section 275.206(4)-4 Commodity and... disclose to clients. (a) It shall constitute a fraudulent, deceptive, or manipulative act, practice, or... fail to disclose to any client or prospective client all material facts with respect to: (1) A...

  4. Peramivir analogues bearing hydrophilic side chains exhibit higher activities against H275Y mutant than wild-type influenza virus.

    Science.gov (United States)

    Chiu, Din-Chi; Lin, Tzu-Chen; Huang, Wen-I; Cheng, Ting-Jen; Tsai, Keng-Chang; Fang, Jim-Min

    2017-11-29

    Peramivir is an effective anti-influenza drug in the clinical treatment of influenza, but its efficacy toward the H275Y mutant is reduced. The previously reported cocrystal structures of inhibitors in the mutant neuraminidase (NA) suggest that the hydrophobic side chain should be at the origin of reduced binding affinity. In contrast, zanamivir having a hydrophilic glycerol side chain still possesses high affinity toward the H275Y NA. We thus designed five peramivir analogues (5-9) carrying hydrophilic glycol or glycerol side chains, and evaluated their roles in anti-influenza activity, especially for the H275Y mutant. The synthetic sequence involves a key step of (3 + 2) cycloaddition reactions between alkenes and nitrile oxides to construct the scaffold of peramivir carrying the desired hydrophilic side chains and other appropriate functional groups. The molecular docking experiments reveal that the hydrophilic side chain can provide extra hydrogen bonding with the translocated Glu-276 residue in the H275Y NA active site. Thus, the H275Y mutant may be even more sensitive than wild-type virus toward the peramivir analogues bearing hydrophilic side chains. Notably, the peramivir analogue bearing a glycerol side chain inhibits the H275Y mutant with an IC 50 value of 35 nM, which is better than the WSN virus by 9 fold.

  5. Crystallographic and magnetic properties of (Nd,Dy)3Fe27.5(Ti,Mo)1.5 compounds

    International Nuclear Information System (INIS)

    Han, S.B.; Liu, X.F.; Lv, J.Y.; Peng, J.; Hao, Y.M.; Li, X.J.; Chen, D.F.; Xue, Y.J.; Li, J.H.; Hu, Z.B.

    2006-01-01

    A systematic study of the formation, structure and magnetic properties of (Nd,Dy) 3 Fe 27.5 (Ti,Mo) 1.5 compounds has been performed. Rietveld analyses of the X-ray patterns of the samples indicate that the concentrations of Ti and Mo affect the formation and structural properties slightly, whereas different rare-earth (Nd and Dy) contents influence them significantly. It is found that high Dy contents make it difficult to form the 3:29-type structures. The Curie temperatures of Nd 2.1 Dy 0.9 Fe 27.5 Ti 1.5- x Mo x decrease monotonically as more Ti was replaced by Mo but their saturation magnetizations remain almost unchanged; in contrast, for Nd 3- y Dy y Fe 27.5 TiMo 0.5 , their saturation magnetizations decrease monotonically with increasing Dy contents while their Curie temperatures are constant

  6. 7 CFR 275.18 - Project area/management unit corrective action plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Project area/management unit corrective action plan... SYSTEM Corrective Action § 275.18 Project area/management unit corrective action plan. (a) The State agency shall ensure that corrective action plans are prepared at the project area/management unit level...

  7. Anti-leukemia activity of MS-275 histone deacetylase inhibitor implicates 4-1BBL/4-1BB immunomodulatory functions.

    Directory of Open Access Journals (Sweden)

    Bérengère Vire

    Full Text Available Histone deacetylase inhibitors (HDACi have demonstrated promising therapeutic potential in clinical trials for hematological malignancies. HDACi, such as SAHA/Vorinostat, Trichostatin A, and MS-275 were found to induce apoptosis of leukemic blasts through activation of the death receptor pathway and transcriptional induction of the Tumor Necrosis Factor (TNF-related pro-apoptotic family members, TRAIL and FasL. The impact of HDACi on TNF-related costimulatory molecules such as 4-1BB ligand (4-1BBL/TNFSF9 is however not known. Following exposure to SAHA/Vorinostat, Trichostatin A, and MS-275, transcript levels were determined by real time PCR in Jurkat, Raji and U937 cells. Treatment with HDACi up-regulated TNFSF9 gene expression in the three leukemia cell lines, yet to different extend and with distinct kinetics, which did not require de novo protein synthesis and was not associated with DNAse I hypersensitive chromatin remodeling. Transcriptional activity of TNFSF9 promoter-luciferase constructs was induced up to 12 fold by HDACi, and implication of Sp1/Sp3 transcription factors binding to functional GC-box elements was evidenced by reporter gene assays, site-directed mutagenesis, and electrophoretic mobility shift assays. Functionality of modulated target genes was assessed in allogeneic mixed leukocyte reaction experiments. MS-275- and to a lesser extent Trichostatin A- and SAHA-treated Raji cells significantly up regulated T lymphocytes proliferation which was reduced by about 50% by a 4-1BB blocking recombinant protein, while MS-275- but neither Trichostatin A- nor SAHA-treated cells up-regulated IFNgamma secretion by T lymphocytes. Our results identify 4-1BBL/4-1BB as a downstream target of HDACi, especially of MS-275 anti-leukemia action in vitro. Thus, HDACi such as MS-275 displaying dual TNF-dependent proapoptotic and costimulatory activities might be favored for inclusion in HDACi-based anti-cancer therapeutic strategies.

  8. Analysis of 275 Planned and 10 Unplanned Home Births

    OpenAIRE

    Schneider, Gerd; Soderstrom, Bobbi

    1987-01-01

    The purpose of this study is to describe the outcome in one family practice of planned home births attended by a physician and an experienced birth assistant in a self-selected, but subsequently screened, population over an 11-year period. All but 26 primigravidas were screened out, as were multiple pregnancies and malpresentations. Study parameters included characteristics of the population and maternal and neonatal outcomes. Of 275 intended home confinements, nine were screened out for medi...

  9. Removal of sulfamethoxazole, ibuprofen and nitrobenzene by UV and UV/chlorine processes: A comparative evaluation of 275 nm LED-UV and 254 nm LP-UV.

    Science.gov (United States)

    Kwon, Minhwan; Yoon, Yeojoon; Kim, Seonbaek; Jung, Youmi; Hwang, Tae-Mun; Kang, Joon-Wun

    2018-05-15

    The aim of this study is to evaluate the micropollutant removal capacity of a 275 nm light-emitting diode (LED)-UV/chlorine system. The sulfamethoxazole, ibuprofen, and nitrobenzene removal efficiencies of this system were compared with those of a conventional 254 nm low-pressure (LP)-UV system as a function of the UV dose. In a direct photolysis system, the photon reactivity of sulfamethoxazole is higher than that of nitrobenzene and ibuprofen at both wavelengths. The molar absorption coefficients and quantum yields of each micropollutant were as follows: sulfamethoxazole (ε SMX, 275 nm protonated  = 17,527 M -1  cm -1 , Φ SMX, 275 nm protonated  = 0.239, ε SMX, 275 nm deprotonated  = 8430 M -1  cm -1 , and Φ SMX, 275 nm deprotonated  = 0.026), nitrobenzene (ε NB, 275 nm  = 7176 M -1  cm -1 and Φ NB, 275 nm  = 0.057), and ibuprofen (ε NB, 275 nm  = 200 M -1  cm -1 and Φ IBF, 275 nm  = 0.067). The photon reactivity of chlorine species, i.e., HOCl and OCl-, were determined at 275 nm (ε HOCl, 275 nm  = 28 M -1  cm -1 , Φ HOCl, 275 nm  = 1.97, ε OCl-, 275 nm  = 245 M -1  cm -1 , and Φ OCl-, 275 nm  = 0.8), which indicate that the decomposition rate of OCl - is higher and that of HOCl is lower by 275 nm photolysis than that by 254 nm photolysis (ε HOCl, 254 nm  = 60 M -1  cm -1 , Φ HOCl, 254 nm  = 1.46, ε OCl-, 254 nm  = 58 M -1  cm -1 , and Φ OCl-, 254 nm  = 1.11). In the UV/chlorine system, the removal rates of ibuprofen and nitrobenzene were increased by the formation of OH and reactive chlorine species. The 275-nm LED-UV/chlorine system has higher radical yields at pH 7 and 8 than the 254 nm LP-UV/chlorine system. Copyright © 2018 Elsevier B.V. All rights reserved.

  10. Amino acids 16-275 of minute virus of mice NS1 include a domain that specifically binds (ACCA)2-3-containing DNA.

    Science.gov (United States)

    Mouw, M; Pintel, D J

    1998-11-10

    GST-NS1 purified from Escherichia coli and insect cells binds double-strand DNA in an (ACCA)2-3-dependent fashion under similar ionic conditions, independent of the presence of anti-NS1 antisera or exogenously supplied ATP and interacts with single-strand DNA and RNA in a sequence-independent manner. An amino-terminal domain (amino acids 1-275) of NS1 [GST-NS1(1-275)], representing 41% of the full-length NS1 molecule, includes a domain that binds double-strand DNA in a sequence-specific manner at levels comparable to full-length GST-NS1, as well as single-strand DNA and RNA in a sequence-independent manner. The deletion of 15 additional amino-terminal amino acids yielded a molecule [GST-NS1(1-275)] that maintained (ACCA)2-3-specific double-strand DNA binding; however, this molecule was more sensitive to increasing ionic conditions than full-length GST-NS1 and GST-NS1(1-275) and could not be demonstrated to bind single-strand nucleic acids. A quantitative filter binding assay showed that E. coli- and baculovirus-expressed GST-NS1 and E. coli GST-NS1(1-275) specifically bound double-strand DNA with similar equilibrium kinetics [as measured by their apparent equilibrium DNA binding constants (KD)], whereas GST-NS1(16-275) bound 4- to 8-fold less well. Copyright 1998 Academic Press.

  11. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels

    2016-01-01

    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... by performing calculations in per-thread registers. Using Bohrium, we automatically fuse, JIT-compile, and execute NumPy array operations on GPGPUs without modification to the user programs. We present performance evaluations of three benchmarks, all of which show dramatic reductions in memory use from...

  12. 49 CFR 40.275 - What is the effect of procedural problems that are not sufficient to cancel an alcohol test?

    Science.gov (United States)

    2010-10-01

    ... not sufficient to cancel an alcohol test? 40.275 Section 40.275 Transportation Office of the Secretary... cancel an alcohol test? (a) As an STT, BAT, employer, or a service agent administering the testing... cancelled based on a mistake in the process that does not have a significant adverse effect on the right of...

  13. Functional role of proteolytic cleavage at arginine-275 of human tissue plasminogen activator as assessed by site-directed mutagenesis

    International Nuclear Information System (INIS)

    Tate, K.M.; Higgins, D.L.; Holmes, W.E.; Winkler, M.E.; Heyneker, H.L.; Vehar, G.A.

    1987-01-01

    Activation of the zymogen form of a serine protease is associated with a conformational change that follows proteolysis at a specific site. Tissue-type plasminogen activator (t-PA) is homologous to mammalian serine proteases and contains an apparent activation cleavage site at arginine-275. To clarify the functional consequences of cleavage at arginine-275 of t-PA, site-specific mutagenesis was performed to convert arginine-275 to a glutamic acid. The mutant enzyme (designated Arg-275 → Glu t-PA) could be converted to the two-chain form by Staphylococcus aureus V8 protease but not by plasmin. The one-chain form was 8 times less active against the tripeptide substrate H-D-isoleucyl-L-prolyl-L-arginine-rho-nitroanilide (S-2288), and the ability of the enzyme to activate plasminogen in the absence of fibrinogen was reduced 20-50 times compared to the two-chain form. In contrast, one-chain Arg-275 → Glu t-PA has equal activity to the two-chain form when assayed in the presence of physiological levels of fibrinogen and plasminogen. Fibrin bound significantly more of the one-chain form of t-PA than the two-chain form for both the wild-type and mutated enzymes. One- and two-chain forms of the wild-type and mutated plasminogen activators slowly formed complexes with plasma protease inhibitors, although the one-chain forms showed decreased complex formation with → 2 -macroglobulin. The one-chain form of t-PA therefore is fully functional under physiologic conditions and has a increased fibrin binding compared to the two-chain form

  14. Detection of drugs in 275 alcohol-positive blood samples of Korean drivers.

    Science.gov (United States)

    Kim, Eunmi; Choe, Sanggil; Lee, Juseon; Jang, Moonhee; Choi, Hyeyoung; Chung, Heesun

    2016-08-01

    Since driving under the influence of drugs (DUID) is as dangerous as drink-driving, many countries regulate DUID by law. However, laws against the use of drugs while driving are not yet established in Korea. In order to investigate the type and frequency of drugs used by drivers in Korea, we analyzed controlled and non-controlled drugs in alcohol-positive blood samples. Total 275 blood samples were taken from Korean drivers, which were positive in roadside alcohol testing. The following analyses were performed: blood alcohol concentrations by GC; screening for controlled drugs by immunoassay and confirmation for positive samples by GC-MS. For the detection of DUID related drugs in blood samples, a total of 49 drugs were selected and were examined by GC-MS. For a rapid detection of these drugs, an automated identification software called "DrugMan" was used. Concentrations of alcohol in 275 blood samples ranged from 0.011 to 0.249% (average 0.119%). Six specimens showed positive results by immunoassay: one methamphetamine and five benzodiazepines I. By GC-MS confirmation, only benzodiazepines in four cases were identified, while methamphetamine and benzodiazepine in two cases were not detected from the presumptive positive blood samples. Using DrugMan, four drugs were detected; chlorpheniramine (5)*, diazepam (4), dextromethorphan (1) and doxylamine (1). In addition, ibuprofen (1), lidocaine (1) and topiramate (1) were also detected as general drugs in blood samples ('*' indicates frequency). The frequency of drug abuse by Korean drivers was relatively low and a total 14 cases were positive in 275 blood samples with a ratio of 5%. However it is necessary to analyze more samples including alcohol negative blood, and to expand the range of drug lists to get the detailed information. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  15. Effects of electromagnetic field of 33 and 275 kV influences on ...

    African Journals Online (AJOL)

    The effects of electromagnetic fields (EMF) from 33 and 275 kV high voltage transmission line on biochemical and antioxidant system changes in mustard leaf (Brassica chinensis) were investigated under field condition. Mustard leaves were exposed to EMF from power lines at distances of 0, 3, 6, 9, 10, 12, 15, 18, 20, 21, ...

  16. 20 CFR 404.275 - How is an automatic cost-of-living increase calculated?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How is an automatic cost-of-living increase..., SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.275 How is an automatic cost-of-living increase calculated? (a) Increase based on the CPI. We...

  17. 275 C Downhole Switched-Mode Power Supply

    Energy Technology Data Exchange (ETDEWEB)

    Chris Hutchens; Vijay Madhuravasal

    2008-08-31

    A vee-square (V2) control based controller IC is developed for a switch mode power supply capable of operating at extreme temperature/harsh environment conditions. A buck type regulator with silicon carbide power junction field effect transistors (JFET) as power devices is used to analyze the performance of controller. Special emphases are made on the analog sub-blocks--voltage reference, operational transconductance amplifier and comparator as individual building blocks. Transformer coupled gate drives and high temperature operable magnetic cores and capacitors are identified and tested for use in the design. Conventional ceramic chip packaging of ICs combined with lead carrier type mounting of passive filter components is introduced for hybrid packaging of the complete product. The developed SMPS is anticipated to support the operation of down-hole microcontrollers and other electronics devices that require low/medium power filtered dc inputs over an operating temperature of 275 C.

  18. Inelastic scattering of 275 keV neutrons by silver

    International Nuclear Information System (INIS)

    Litvinsky, L.L.; Zhigalov, Ya.A.; Krivenko, V.G.; Purtov, O.A.; Sabbagh, S.

    1997-01-01

    Neutron total, elastic and inelastic scattering cross-scattering of Ag at the E n = 275 KeV neutron energy were measured by using the filtered neutron beam of the WWR-M reactor in Kiev. The d-neutron strength function S n2 of Ag was determined from the analysis of all available data in the E n ≤ keV energy region on neutron inelastic scattering cross-sections with excitation of the first isomeric levels I π m = 7/2 + , E m ∼ 90 keV of 107,109 Ag: S n2 = (1.03 ± 0.19) · 10 -4 . (author). 10 refs, 3 figs

  19. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  20. Synthesis and characterization of Ti-27.5Nb alloy made by CLAD® additive manufacturing process for biomedical applications.

    Science.gov (United States)

    Fischer, M; Laheurte, P; Acquier, P; Joguet, D; Peltier, L; Petithory, T; Anselme, K; Mille, P

    2017-06-01

    Biocompatible beta-titanium alloys such as Ti-27.5(at.%)Nb are good candidates for implantology and arthroplasty applications as their particular mechanical properties, including low Young's modulus, could significantly reduce the stress-shielding phenomenon usually occurring after surgery. The CLAD® process is a powder blown additive manufacturing process that allows the manufacture of patient specific (i.e. custom) implants. Thus, the use of Ti-27.5(at.%)Nb alloy formed by CLAD® process for biomedical applications as a mean to increase cytocompatibility and mechanical biocompatibility was investigated in this study. The microstructural properties of the CLAD-deposited alloy were studied with optical microscopy and electron back-scattered diffraction (EBSD) analysis. The conservation of the mechanical properties of the Ti-27.5Nb material after the transformation steps (ingot-powder atomisation-CLAD) were verified with tensile tests and appear to remain close to those of reference material. Cytocompatibility of the material and subsequent cell viability tests showed that no cytotoxic elements are released in the medium and that viable cells proliferated well. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Discovery of γ-ray Emission from the Strongly Lobe-dominated Quasar 3C 275.1

    Science.gov (United States)

    Liao, Neng-Hui; Xin, Yu-Liang; Li, Shang; Jiang, Wei; Liang, Yun-Feng; Li, Xiang; Zhang, Peng-Fei; Chen, Liang; Bai, Jin-Ming; Fan, Yi-Zhong

    2015-07-01

    We systematically analyze the 6 year Fermi/Large Area Telescope (LAT) data on lobe-dominated quasars (LDQs) in the complete LDQ sample from the Revised third Cambridge Catalogue of Radio Sources (3CRR) survey and report the discovery of high-energy γ-ray emission from 3C 275.1. The γ-ray emission of 3C 207 is confirmed and significant variability of the light curve is identified. We do not find statistically significant γ-ray emission from other LDQs. 3C 275.1 is the known γ-ray quasar with the lowest core dominance parameter (i.e., R = 0.11). We also show that both the northern radio hotspot and parsec jet models can reasonably reproduce the γ-ray data. The parsec jet model, however, is favored by the potential γ-ray variability on a timescale of months. We suggest that some dimmer γ-ray LDQs will be detected in the future and LDQs could contribute non-ignorably to the extragalactic γ-ray background.

  2. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ..., financial statements, and internal audit working papers relating to the business of such investment adviser... pursuant to § 275.204A-1 that is in effect, or at any time within the past five years was in effect; (ii) A... currently, or within the past five years was, a supervised person of the investment adviser. (13)(i) A...

  3. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...

  4. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  5. Permeabilization of Saccharomyces fragilis IZ 275 cells with ethanol to obtain a biocatalyst with lactose hydrolysis capacity

    Directory of Open Access Journals (Sweden)

    Luiz Rodrigo Ito Morioka

    2016-10-01

    Full Text Available The permeabilization was used to transform microorganisms in cell biocatalysts with high enzymatic activity. The Saccharomyces fragilis IZ 275 yeast cells were permeabilized with ethanol, as permeabilizing agent. To optimize the permeabilization conditions were used the design of Box-Behnken 15 trials (3 central points. The independent variables and their levels were ethanol (29, 32 and 35%, temperature (15, 20 and 25°C and time (15, 20 and 25 min. The answer (Y function has beta-galactosidase activity (U mg-1. The optimum conditions for obtaining a high enzymatic activity were observed in 35% ethanol concentration, temperature 15ºC and 20 min. treatment time. The maximum activity of the enzyme beta-galactosidase obtained was 10.59 U mg-1. The permeabilization of the S. fragilis IZ 275 cells was efficient.

  6. Analysis of 275 planned and 10 unplanned home births.

    Science.gov (United States)

    Schneider, G; Soderstrom, B

    1987-05-01

    The purpose of this study is to describe the outcome in one family practice of planned home births attended by a physician and an experienced birth assistant in a self-selected, but subsequently screened, population over an 11-year period. All but 26 primigravidas were screened out, as were multiple pregnancies and malpresentations. Study parameters included characteristics of the population and maternal and neonatal outcomes. Of 275 intended home confinements, nine were screened out for medical reasons before labour, five in very early labour, and three for failure to progress. Of the 273 who delivered at home, including 10 unplanned births, two were transferred to hospital for postpartum hemorrhage. One neonate was hospitalized for complications. The results of this study, as well as a review of the relevant literature, illustrate that, for a selected population, home birth is a reasonable alternative to hospital.

  7. Synthesis and characterization of Ti-27.5Nb alloy made by CLAD® additive manufacturing process for biomedical applications

    International Nuclear Information System (INIS)

    Fischer, M.; Laheurte, P.; Acquier, P.; Joguet, D.; Peltier, L.; Petithory, T.; Anselme, K.; Mille, P.

    2017-01-01

    Biocompatible beta-titanium alloys such as Ti-27.5(at.%)Nb are good candidates for implantology and arthroplasty applications as their particular mechanical properties, including low Young's modulus, could significantly reduce the stress-shielding phenomenon usually occurring after surgery. The CLAD® process is a powder blown additive manufacturing process that allows the manufacture of patient specific (i.e. custom) implants. Thus, the use of Ti-27.5(at.%)Nb alloy formed by CLAD® process for biomedical applications as a mean to increase cytocompatibility and mechanical biocompatibility was investigated in this study. The microstructural properties of the CLAD-deposited alloy were studied with optical microscopy and electron back-scattered diffraction (EBSD) analysis. The conservation of the mechanical properties of the Ti-27.5Nb material after the transformation steps (ingot-powder atomisation-CLAD) were verified with tensile tests and appear to remain close to those of reference material. Cytocompatibility of the material and subsequent cell viability tests showed that no cytotoxic elements are released in the medium and that viable cells proliferated well. - Highlights: • Biomimetic implants can be provided from additive manufacturing with beta-titanium alloys. • We studied the properties of a Ti-Nb alloy elaborated with a laser deposition process. • TiNb alloy processed by LMD consists of only beta phase due to rapid cooling. • No preferential crystallographic texture is observed with EBSD analyses. • TiNb samples showed a combination of high strength and low Young's modulus.

  8. Synthesis and characterization of Ti-27.5Nb alloy made by CLAD® additive manufacturing process for biomedical applications

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, M. [LEM3, Université de Lorraine, Ile du Saulcy, 57045 Metz (France); Laheurte, P., E-mail: pascal.laheurte@univ-lorraine.fr [LEM3, Université de Lorraine, Ile du Saulcy, 57045 Metz (France); Acquier, P. [IREPA Laser, Institut Carnot Mica, Parc d' Innovation, 67400 Illkirch (France); Joguet, D. [LERMPS, Université de Technologie de Belfort Montbéliard, Sevenans, 90010 Belfort (France); Peltier, L. [LEM3, Ecole Nationale Supérieure d' Arts et Métiers, 57078 Metz (France); Petithory, T.; Anselme, K. [IS2M, CNRS UMR7361, Université de Haute-Alsace, 68057 Mulhouse (France); Mille, P. [LGECO Institut National des Sciences Appliquées, 67000 Strasbourg (France)

    2017-06-01

    Biocompatible beta-titanium alloys such as Ti-27.5(at.%)Nb are good candidates for implantology and arthroplasty applications as their particular mechanical properties, including low Young's modulus, could significantly reduce the stress-shielding phenomenon usually occurring after surgery. The CLAD® process is a powder blown additive manufacturing process that allows the manufacture of patient specific (i.e. custom) implants. Thus, the use of Ti-27.5(at.%)Nb alloy formed by CLAD® process for biomedical applications as a mean to increase cytocompatibility and mechanical biocompatibility was investigated in this study. The microstructural properties of the CLAD-deposited alloy were studied with optical microscopy and electron back-scattered diffraction (EBSD) analysis. The conservation of the mechanical properties of the Ti-27.5Nb material after the transformation steps (ingot-powder atomisation-CLAD) were verified with tensile tests and appear to remain close to those of reference material. Cytocompatibility of the material and subsequent cell viability tests showed that no cytotoxic elements are released in the medium and that viable cells proliferated well. - Highlights: • Biomimetic implants can be provided from additive manufacturing with beta-titanium alloys. • We studied the properties of a Ti-Nb alloy elaborated with a laser deposition process. • TiNb alloy processed by LMD consists of only beta phase due to rapid cooling. • No preferential crystallographic texture is observed with EBSD analyses. • TiNb samples showed a combination of high strength and low Young's modulus.

  9. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... Definition of “client” of an investment adviser. Preliminary Note to § 275.203(b)(3)-1. This section is a... single client for purposes of section 203(b)(3) of the Act. Under paragraph (b)(6) of this section, the... be a single client for purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)): (1) A...

  10. GCK-MODY diabetes as a protein misfolding disease: the mutation R275C promotes protein misfolding, self-association and cellular degradation.

    Science.gov (United States)

    Negahdar, Maria; Aukrust, Ingvild; Molnes, Janne; Solheim, Marie H; Johansson, Bente B; Sagen, Jørn V; Dahl-Jørgensen, Knut; Kulkarni, Rohit N; Søvik, Oddmund; Flatmark, Torgeir; Njølstad, Pål R; Bjørkhaug, Lise

    2014-01-25

    GCK-MODY, dominantly inherited mild hyperglycemia, is associated with more than 600 mutations in the glucokinase gene. Different molecular mechanisms have been shown to explain GCK-MODY. Here, we report a Pakistani family harboring the glucokinase mutation c.823C>T (p.R275C). The recombinant and in cellulo expressed mutant pancreatic enzyme revealed slightly increased enzyme activity (kcat) and normal affinity for α-D-glucose, and resistance to limited proteolysis by trypsin comparable with wild-type. When stably expressed in HEK293 cells and MIN6 β-cells (at different levels), the mutant protein appeared misfolded and unstable with a propensity to form dimers and aggregates. Its degradation rate was increased, involving the lysosomal and proteasomal quality control systems. On mutation, a hydrogen bond between the R275 side-chain and the carbonyl oxygen of D267 is broken, destabilizing the F260-L271 loop structure and the protein. This promotes the formation of dimers/aggregates and suggests that an increased cellular degradation is the molecular mechanism by which R275C causes GCK-MODY. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  11. 42 CFR 137.275 - May Self-Governance Tribes include IHS construction programs in a construction project agreement...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false May Self-Governance Tribes include IHS construction... OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Purpose and Scope § 137.275 May Self-Governance Tribes include IHS construction programs in a construction project agreement or in a funding...

  12. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  13. Formation of quasicrystals in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass

    DEFF Research Database (Denmark)

    Wanderka, N.; Macht, M. P.; Siedel, M.

    2000-01-01

    The formation of the quasicrystalline phase is observed as a first step of crystallization during isothermal annealing of the Zr46.7Ti8.3Cu7.5Ni10Be27.5 bulk glass. The structure of the quasicrystals and the sequence of phase formation have been investigated by x-ray powder diffraction and transm......The formation of the quasicrystalline phase is observed as a first step of crystallization during isothermal annealing of the Zr46.7Ti8.3Cu7.5Ni10Be27.5 bulk glass. The structure of the quasicrystals and the sequence of phase formation have been investigated by x-ray powder diffraction...... min) at high temperatures above 683 K. (C) 2000 American Institute of Physics....

  14. 41 CFR 102-75.275 - Who determines whether the proposed disposal would create or maintain a situation inconsistent...

    Science.gov (United States)

    2010-07-01

    ... the proposed disposal would create or maintain a situation inconsistent with antitrust laws? 102-75... Real Property Disposal Applicability of Antitrust Laws § 102-75.275 Who determines whether the proposed disposal would create or maintain a situation inconsistent with antitrust laws? The Attorney General...

  15. Production of polyclonal antiserum specific to the 27.5 kDa envelope protein of white spot syndrome virus

    NARCIS (Netherlands)

    You, Z.O.; Nadala, E.C.B.; Yang, J.S.; Hulten, van M.C.W.; Loh, P.C.

    2002-01-01

    A truncated version of the white spot syndrome virus (WSSV) 27.5 kDa envelope protein was expressed as a histidine tag fusion protein in Escherichia coli. The bacterial expression system allowed the production of up to 10 mg of purified recombinant protein per liter of bacterial culture. Antiserum

  16. Detection of an apparent, distant cluster of galaxies associated with the radio-tail QSO 3C 275.1

    International Nuclear Information System (INIS)

    Hintzen, P.; Boeshaar, G.O.; Scott, J.S.

    1981-01-01

    Based on the suggestion that QSOs with distorted radio structures are likely to be members of clusters of galaxies (Hintzen and Scott), we have obtained deep direct observations of the fields containing 3C 270.1 and 3C 275.1, the most reliably substantiated cases of wide-angle radio tails associated with QSOs. Our 75'' square field centered on 3C 275.1 (z = 0.557) contains over three-dozen objects, many of which are nonstellar, between m/sub R/ = 19.8 and m/sub R/ = 23.5. The quasar itself lies at the center of an illiptical nebulosity. The size of this nebulosity and the magnitude distribution of the surrounding objects are consistent with the interpretation that the QSO is the nucleus of a giant elliptical galaxy which is a member of a cluster of galaxies at zapprox.0.55. Our observations of 3C 270.1 (z = 1.519) show no definitive evidence of an associated cluster of galaxies, which is consistent with the cosmological interpretation of QSO redshifts

  17. Improved detection of genetic markers of antimicrobial resistance by hybridization probe-based melting curve analysis using primers to mask proximal mutations: examples include the influenza H275Y substitution.

    Science.gov (United States)

    Whiley, David M; Jacob, Kevin; Nakos, Jennifer; Bletchly, Cheryl; Nimmo, Graeme R; Nissen, Michael D; Sloots, Theo P

    2012-06-01

    Numerous real-time PCR assays have been described for detection of the influenza A H275Y alteration. However, the performance of these methods can be undermined by sequence variation in the regions flanking the codon of interest. This is a problem encountered more broadly in microbial diagnostics. In this study, we developed a modification of hybridization probe-based melting curve analysis, whereby primers are used to mask proximal mutations in the sequence targets of hybridization probes, so as to limit the potential for sequence variation to interfere with typing. The approach was applied to the H275Y alteration of the influenza A (H1N1) 2009 strain, as well as a Neisseria gonorrhoeae mutation associated with antimicrobial resistance. Assay performances were assessed using influenza A and N. gonorrhoeae strains characterized by DNA sequencing. The modified hybridization probe-based approach proved successful in limiting the effects of proximal mutations, with the results of melting curve analyses being 100% consistent with the results of DNA sequencing for all influenza A and N. gonorrhoeae strains tested. Notably, these included influenza A and N. gonorrhoeae strains exhibiting additional mutations in hybridization probe targets. Of particular interest was that the H275Y assay correctly typed influenza A strains harbouring a T822C nucleotide substitution, previously shown to interfere with H275Y typing methods. Overall our modified hybridization probe-based approach provides a simple means of circumventing problems caused by sequence variation, and offers improved detection of the influenza A H275Y alteration and potentially other resistance mechanisms.

  18. The Histone Deacetylase Inhibitors MS-275 and SAHA Suppress the p38 Mitogen-Activated Protein Kinase Signaling Pathway and Chemotaxis in Rheumatoid Arthritic Synovial Fibroblastic E11 Cells

    Directory of Open Access Journals (Sweden)

    Hai-Shu Lin

    2013-11-01

    Full Text Available MS-275 (entinostat and SAHA (vorinostat, two histone deacetylase (HDAC inhibitors currently in oncological trials, have displayed potent anti-rheumatic activities in rodent models of rheumatoid arthritis (RA. To further elucidate their anti-inflammatory mechanisms, the impact of MS-275 and SAHA on the p38 mitogen-activated protein kinase (MAPK signaling pathway and chemotaxis was assessed in human rheumatoid arthritic synovial fibroblastic E11 cells. MS-275 and SAHA significantly suppressed the expression of p38α  MAPK, but induced the expression of MAPK phosphatase-1 (MKP-1, an endogenous suppressor of p38α  in E11 cells. At the same time, the association between p38α and MKP-1 was up-regulated and consequently, the activation (phosphorylation of p38α  was inhibited. Moreover, MS-275 and SAHA suppressed granulocyte chemotactic protein-2 (GCP-2, monocyte chemotactic protein-2 (MCP-2 and macrophage migration inhibitory factor (MIF in E11 cells in a concentration-dependent manner. Subsequently, E11-driven migration of THP-1 and U937 monocytes was inhibited. In summary, suppression of the p38 MAPK signaling pathway and chemotaxis appear to be important anti-rheumatic mechanisms of action of these HDAC inhibitors.

  19. THE RATIONALE FOR THE USE OF TWO-PHASE SWITCHES FOR THREE-PHASE CONNECTIONS OF DISTRIBUTIVE DEVICE 27.5 KV

    Directory of Open Access Journals (Sweden)

    Yu. Ya. Sheika

    2008-12-01

    Full Text Available On the basis of materials of scientists of Moscow and Petersburg State Universities of C Ways and NIIEFAENERGO Ltd.» the author of this article with additions has considered a practical possibility of us bipolar switches on three-phase connections of distributive device 27,5 кV.

  20. Generation of 275.4-nm UV output from a large-frame argon-ion laser for fluorescence detection in capillary electrophoresis.

    NARCIS (Netherlands)

    Kok, S.J.; de Ridder, T.; Brinkman, U.A.T.; Velthorst, N.H.; Gooijer, C.; Hoornweg, G.Ph.

    1998-01-01

    A standard, relatively old, large-frame argon-ion laser, which is available in many laboratories, was modified to produce output in the deep- UV (275-306 nm) region by installing a set of inexpensive, commercially available laser mirrors. The deep-UV output is generally applicable as excitation

  1. 25 CFR 1000.275 - Is it necessary for a self-governance AFA to include any clauses about FTCA coverage?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Is it necessary for a self-governance AFA to include any... AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Federal Tort Claims § 1000.275 Is it necessary for a self-governance AFA to include any clauses about FTCA coverage? No, clauses about FTCA coverage...

  2. East Weddell Sea echinoids from the JR275 expedition

    Directory of Open Access Journals (Sweden)

    Thomas Saucède

    2015-05-01

    Full Text Available Information regarding the echinoids in this dataset is based on the Agassiz Trawl (AGT and epibenthic sledge (EBS samples collected during the British Antarctic Survey cruise JR275 on the RRS James Clark Ross in the austral summer 2012. A total of 56 (1 at the South Orkneys and 55 in the Eastern Weddell Sea Agassiz Trawl and 18 (2 at the South Orkneys and 16 in the Eastern Weddell Sea epibenthic sledge deployments were performed at depths ranging from ~280 to ~2060 m. This presents a unique collection for the Antarctic benthic biodiversity assessment of an important group of benthic invertebrates. In total 487 specimens belonging to six families, 15 genera, and 22 morphospecies were collected. The species richness per station varied between one and six. Total species richness represents 27% of the 82 echinoid species ever recorded in the Southern Ocean (David et al. 2005b, Pierrat et al. 2012, Saucède et al. 2014. The Cidaridae (sub-family Ctenocidarinae and Schizasteridae are the two most speciose families in the dataset. They comprise seven and nine species respectively. This is illustrative of the overall pattern of echinoid diversity in the Southern Ocean where 65% of Antarctic species belong to the families Schizasteridae and Cidaridae (Pierrat et al. 2012.

  3. Pressure effect of glass transition temperature in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk metallic glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Roseker, W.; Sikorski, M.

    2004-01-01

    Pressure effects on glass transition temperature and supercooled liquid region of a Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass have been investigated by performing in situ high-temperature and high-pressure x-ray powder diffraction measurements using synchrotron radiation. The glass transition was det...... range of 0-2.2 GPa. This method opens a possibility to study the pressure effect of glass transition process in glassy systems under high pressures (>1 GPa). (C) 2004 American Institute of Physics.......Pressure effects on glass transition temperature and supercooled liquid region of a Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass have been investigated by performing in situ high-temperature and high-pressure x-ray powder diffraction measurements using synchrotron radiation. The glass transition...... was detected from the change of the slope of peak position as a function of temperature. It is found that the glass transition temperature increases with pressure by 4.4 K/GPa for the Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass, and the supercooled liquid range decreases with pressure by 2.9 K/GPa in a pressure...

  4. Composite augmentation phalloplasty: personal experience after 275 patients

    Directory of Open Access Journals (Sweden)

    Juan Monreal

    2015-03-01

    Full Text Available Aim: To report the author's experience in augmentation phalloplasty by studying a retrospective series of patients who underwent fat grafting for girth enhancement or a composite technique based on suspensory ligament release plus fat grafting performed simultaneously. Methods: The author analyzed retrospectively the outcomes of 275 augmentation phalloplasty procedures performed in 259 patients until November 2013. Of these, 127 correspond to girth augmentation with fat grafting and 148 to composite augmentation phalloplasty (girth augmentation with fat grafting and length improvement by suspensory ligament release. In 16 patients girth and length enhancement were performed in two separate procedures. Results: Of this 259 patients, 87 underwent postoperative follow-up for at least 12 months and 160 patients underwent follow-up for at least 6 months. The average increase in circumference at 6 months was 1.7 cm (1.57 cm at 12 months and the average increase in length of 3.2 cm (3.1 cm at 12 months. Twenty-two patients showed minor complications that were treated without sequelae and without influencing the final result. Conclusion: By judicious use of currently available techniques, it is possible to achieve stable increases in penis size. The use of composite techniques provides better final results than the use of individual techniques performed alone due to the increase of the actual volume of the penis. An adequate informed consent is essential in all patients due to the unrealistic expectations expressed by the majority of them.

  5. Peripheral collisions in the reaction 40Ar + 93Nb at 27.5 MeV/nucleon

    International Nuclear Information System (INIS)

    Pastel, R.

    1987-09-01

    This thesis describes an experimental study of the reaction 40 Ar + 93 Nb at 27.5 MeV/nucleon carried out at the GANIL accelerator. Reaction products were detected in a large position sensitive localization ionization chamber. The experimental data were used to obtain information concerning the reaction mechanism especially for peripheral collisions. A model using the properties of random works were applied successfully to the interpretation of the data. The importance of the deflection produced by the ion-ion potential as well as of the emission of alpha particles in the reaction is stressed [fr

  6. Blockade of the ERK pathway enhances the therapeutic efficacy of the histone deacetylase inhibitor MS-275 in human tumor xenograft models

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, Toshiaki; Ozaki, Kei-ichi; Fujio, Kohsuke; Kajikawa, Shu-hei [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Uesato, Shin-ichi [Department of Biotechnology, Faculty of Engineering, Kansai University, Osaka 564-8680 (Japan); Watanabe, Kazushi [Proubase Technology Inc., Kanagawa 211-0063 (Japan); Tanimura, Susumu [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Koji, Takehiko [Department of Histology and Cell Biology, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8523 (Japan); Kohno, Michiaki, E-mail: kohnom@nagasaki-u.ac.jp [Laboratory of Cell Regulation, Department of Pharmaceutical Sciences, Graduate School of Biomedical Sciences, Nagasaki University, Nagasaki 852-8521 (Japan); Proubase Technology Inc., Kanagawa 211-0063 (Japan); Kyoto University Graduate School of Pharmaceutical Sciences, Kyoto 606-8501 (Japan)

    2013-04-19

    Highlights: •Blockade of the ERK pathway enhances the anticancer efficacy of HDAC inhibitors. •MEK inhibitors sensitize human tumor xenografts to HDAC inhibitor cytotoxicity. •Such the enhanced efficacy is achieved by a transient blockade of the ERK pathway. •This drug combination provides a promising therapeutic strategy for cancer patients. -- Abstract: The ERK pathway is up-regulated in various human cancers and represents a prime target for mechanism-based approaches to cancer treatment. Specific blockade of the ERK pathway alone induces mostly cytostatic rather than pro-apoptotic effects, however, resulting in a limited therapeutic efficacy of the ERK kinase (MEK) inhibitors. We previously showed that MEK inhibitors markedly enhance the ability of histone deacetylase (HDAC) inhibitors to induce apoptosis in tumor cells with constitutive ERK pathway activation in vitro. To evaluate the therapeutic efficacy of such drug combinations, we administered the MEK inhibitor PD184352 or AZD6244 together with the HDAC inhibitor MS-275 in nude mice harboring HT-29 or H1650 xenografts. Co-administration of the MEK inhibitor markedly sensitized the human xenografts to MS-275 cytotoxicity. A dose of MS-275 that alone showed only moderate cytotoxicity thus suppressed the growth of tumor xenografts almost completely as well as induced a marked reduction in tumor cellularity when administered with PD184352 or AZD6244. The combination of the two types of inhibitor also induced marked oxidative stress, which appeared to result in DNA damage and massive cell death, specifically in the tumor xenografts. The enhanced therapeutic efficacy of the drug combination was achieved by a relatively transient blockade of the ERK pathway. Administration of both MEK and HDAC inhibitors represents a promising chemotherapeutic strategy with improved safety for cancer patients.

  7. 17 CFR 275.205-2 - Definition of “specified period” over which the asset value of the company or fund under...

    Science.gov (United States)

    2010-04-01

    ... periodâ over which the asset value of the company or fund under management is averaged. 275.205-2 Section... value of the company or fund under management is averaged. (a) For purposes of this rule: (1) Fulcrum fee shall mean the fee which is paid or earned when the investment company's performance is equivalent...

  8. Antiproliferative effects of TSA, PXD‑101 and MS‑275 in A2780 and MCF7 cells: Acetylated histone H4 and acetylated tubulin as markers for HDACi potency and selectivity.

    Science.gov (United States)

    Androutsopoulos, Vasilis P; Spandidos, Demetrios A

    2017-12-01

    Inhibition of histone deacetylase enzymes (HDACs) has been well documented as an attractive target for the development of chemotherapeutic drugs. The present study investigated the effects of two prototype hydroxamic acid HDAC inhibitors, namely Trichostatin A (TSA) and Belinostat (PXD‑101) and the benzamide Entinostat (MS‑275) in A2780 ovarian carcinoma and MCF7 breast adenocarcinoma cells. The three HDACi inhibited the proliferation of A2780 and MCF7 cells at comparable levels, below the µM range. Enzyme inhibition assays in a cell‑free system showed that TSA was the most potent inhibitor of total HDAC enzyme activity followed by PXD‑101 and MS‑275. Incubation of A2780 and MCF7 cells with the hydroxamates TSA and PXD‑101 for 24 h resulted in a dramatic increase of acetylated tubulin induction (up to 30‑fold for TSA). In contrast to acetylated tubulin, western blot analysis and flow cytometry indicated that the induction of acetylated histone H4 was considerably smaller. The benzamide MS‑275 exhibited nearly a 2‑fold induction of acetylated histone H4 and an even smaller induction of acetylated tubulin in A2780 and MCF7 cells. Taken together, these data suggest that although the three HDACi were equipotent in inhibiting proliferation of MCF7 and A2780 cells, only the benzamide MS‑275 did not induce acetylated tubulin expression, a marker of class IIb HDACs.

  9. The Sr2.75Ce0.25Co2O7-δ oxide, n=2 member of the Ruddlesden-Popper series: Structural and magnetic evolution depending on oxygen stoichiometry

    International Nuclear Information System (INIS)

    Demont, A.; Hebert, S.; Pelloquin, D.; Maignan, A.

    2008-01-01

    The second member of the Ruddlesden-Popper series, n=2 in Sr n+1 Co n O 3n+1 , has been stabilized by substituting cerium for strontium leading to the pure compound Sr 2.75 Ce 0.25 Co 2 O 7-δ . The oxygen vacancies of this phase can be partially filled by a post-annealing oxidizing treatment with δ decreasing from 1.1 to 0.3 for the as-prepared and oxidized phases, respectively. As the samples are oxidized from δ∼1.1 to 0.3, the a and b unit cell parameters decrease from 3.836 to 3.815 A and from 20.453 to 20.047 A, respectively. Despite the average value of the cobalt valence state, V Co ∼+3.5, obtained in the oxidized Sr 2.75 Ce +4 0.25 Co 2 O 6.7 phase, a clear ferromagnetic state wit T C =175 K and M S =0.8 μB/Co is reached. - Graphical abstract: Temperature dependence of the magnetic susceptibility of as-prepared and PO 2 annealing Sr 2.75 Ce 0.25 Co 2 O 7-δ RP2-type structures

  10. Measurements of the Weak UV Absorptions of Isoprene and Acetone at 261–275 nm Using Cavity Ringdown Spectroscopy for Evaluation of a Potential Portable Ringdown Breath Analyzer

    Science.gov (United States)

    Sahay, Peeyush; Scherrer, Susan T.; Wang, Chuji

    2013-01-01

    The weak absorption spectra of isoprene and acetone have been measured in the wavelength range of 261–275 nm using cavity ringdown spectroscopy. The measured absorption cross-sections of isoprene in the wavelength region of 261–266 nm range from 3.65 × 10−21 cm2·molecule−1 at 261 nm to 1.42 × 10−21 cm2·molecule−1 at 266 nm; these numbers are in good agreement with the values reported in the literature. In the longer wavelength range of 270–275 nm, however, where attractive applications using a single wavelength compact diode laser operating at 274 nm is located, isoprene has been reported in the literature to have no absorption (too weak to be detected). Small absorption cross-sections of isoprene in this longer wavelength region are measured using cavity ringdown spectroscopy for the first time in this work, i.e., 6.20 × 10−23 cm2·molecule−1 at 275 nm. With the same experimental system, wavelength-dependent absorption cross-sections of acetone have also been measured. Theoretical detection limits of isoprene and comparisons of absorbance of isoprene, acetone, and healthy breath gas in this wavelength region are also discussed. PMID:23803787

  11. TU-D-201-02: Medical Physics Practices for Plan and Chart Review: Results of AAPM Task Group 275 Survey

    Energy Technology Data Exchange (ETDEWEB)

    Fong de los Santos, L [Mayo Clinic, Rochester, MN (United States); Dong, L [Scripps Proton Therapy Center, San Diego, CA (United States); Greener, A [VA Medical Center, East Orange, NJ (United States); Johnson, J [UT MD Anderson Cancer Center, Houston, TX (United States); Johnson, P [University of Miami, Miami, FL (United States); Kim, G [University of California, San Diego, La Jolla, CA (United States); Mechalakos, J; Yorke, E [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Napolitano, B [Massachusetts General Hospital, Boston, MA (United States); Parker, S [Novant Health, Winston Salem, NC (United States); Schofield, D [Saint Vincent Hospital, Acton, MA (United States); Wells, M [Piedmont Hospital, Atlanta, GA (United States); Ford, E [Mayo Clinic, Rochester, MN (United States); Scripps Proton Therapy Center, San Diego, CA (United States)

    2016-06-15

    Purpose: AAPM Task Group (TG) 275 is charged with developing riskbased guidelines for plan and chart review clinical processes. As part of this work an AAPM-wide survey was conducted to gauge current practices. Methods: The survey consisted of 103 multiple-choice questions covering the following review processes for external beam including protons: 1) Initial Plan Check, 2) On-Treatment and 3) End-of-Treatment Chart Check. The survey was designed and validated by TG members with the goal of providing an efficient and easy response process. The survey, developed and deployed with the support of AAPM headquarters, was released to all AAPM members who have self-reported as working in the radiation oncology field and it was kept open for 7 weeks. Results: There are an estimated 4700 eligible participants. At the time of writing, 962 completed surveys have been collected with an average completion time of 24 minutes. Participants are mainly from community hospitals (40%), academicaffiliated hospitals (31%) and free-standing clinics (18%). Among many other metrics covered on the survey, results so far indicate that manual review is an important component on the plan and chart review process (>90%) and that written procedures and checklists are widely used (>60%). However, the details of what is reviewed or checked are fairly heterogeneous among the sampled medical physics community. Conclusion: The data gathered from the survey gauging current practices will be used by TG 275 to develop benchmarks and recommendations for the type and extent of checks to perform effective physics plan and chart review processes.

  12. Combining high productivity with high performance on commodity hardware

    DEFF Research Database (Denmark)

    Skovhede, Kenneth

    -like compiler for translating CIL bytecode on the CELL-BE. I then introduce a bytecode converter that transforms simple loops in Java bytecode to GPGPU capable code. I then introduce the numeric library for the Common Intermediate Language, NumCIL. I can then utilizing the vector programming model from Num......CIL and map this to the Bohrium framework. The result is a complete system that gives the user a choice of high-level languages with no explicit parallelism, yet seamlessly performs efficient execution on a number of hardware setups....

  13. 275 Candidates and 149 Validated Planets Orbiting Bright Stars in K2 Campaigns 0–10

    DEFF Research Database (Denmark)

    Mayo, Andrew W.; Vanderburg, Andrew; Latham, David W.

    2018-01-01

    Since 2014, NASA’s K2 mission has observed large portions of the ecliptic plane in search of transiting planets and has detected hundreds of planet candidates. With observations planned until at least early 2018, K2 will continue to identify more planet candidates. We present here 275 planet...... candidates observed during Campaigns 0–10 of the K2 mission that are orbiting stars brighter than 13 mag (in Kepler band) and for which we have obtained high-resolution spectra ( R = 44,000). These candidates are analyzed using the vespa package in order to calculate their false-positive probabilities (FPP......). We find that 149 candidates are validated with an FPP lower than 0.1%, 39 of which were previously only candidates and 56 of which were previously undetected. The processes of data reduction, candidate identification, and statistical validation are described, and the demographics of the candidates...

  14. Antigenic and genetic comparison of foot-and-mouth disease virus serotype O Indian vaccine strain, O/IND/R2/75 against currently circulating viruses.

    Science.gov (United States)

    Mahapatra, Mana; Yuvaraj, S; Madhanmohan, M; Subramaniam, S; Pattnaik, B; Paton, D J; Srinivasan, V A; Parida, Satya

    2015-01-29

    Foot-and-mouth disease (FMD) virus serotype O is the most common cause of FMD outbreaks in India and three of the six lineages that have been described are most frequently detected, namely Ind2001, PanAsia and PanAsia 2. We report the full capsid sequence of 21 serotype O viruses isolated from India between 2002 and 2012. All these viruses belong to the Middle East-South Asia (ME-SA) topotype. The serological cross-reactivity of a bovine post-vaccination serum pool raised against the current Indian vaccine strain, O/IND/R2/75,was tested by virus neutralisation test with the 23 Indian field isolates, revealing a good match between the vaccine and the field isolates. The cross reactivity of the O/IND/R2/75 vaccine with 19 field isolates from other countries (mainly from Asia and Africa) revealed a good match to 79% of the viruses indicating that the vaccine strain is broadly cross-reactive and could be used to control FMD in other countries. Comparison of the capsid sequences of the serologically non-matching isolates with the vaccine strain sequence identified substitutions in neutralising antigenic sites 1 and 2, which could explain the observed serological differences. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  18. Pressure effect on crystallization kinetics in Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Gerward, Leif; Xu, Y.S.

    2002-01-01

    Crystallization kinetics of a Zr46.8Ti8.2Cu7.5Ni10Be27.5 bulk glass in the supercooled liquid region have been investigated by performing in situ high-temperature and high-pressure x-ray diffraction measurements using synchrotron radiation. A pressure-time-temperature-transformation diagram......, describing the onset of crystallization as a function of time during isothermal annealing under pressure, is presented. Different pressure dependences of crystallization kinetics in the temperature range for the glass have been observed and further be explained by a model of competing processes...

  19. Dissolved organic matter fluorescence at wavelength 275/342 nm as a key indicator for detection of point-source contamination in a large Chinese drinking water lake.

    Science.gov (United States)

    Zhou, Yongqiang; Jeppesen, Erik; Zhang, Yunlin; Shi, Kun; Liu, Xiaohan; Zhu, Guangwei

    2016-02-01

    Surface drinking water sources have been threatened globally and there have been few attempts to detect point-source contamination in these waters using chromophoric dissolved organic matter (CDOM) fluorescence. To determine the optimal wavelength derived from CDOM fluorescence as an indicator of point-source contamination in drinking waters, a combination of field campaigns in Lake Qiandao and a laboratory wastewater addition experiment was used. Parallel factor (PARAFAC) analysis identified six components, including three humic-like, two tryptophan-like, and one tyrosine-like component. All metrics showed strong correlation with wastewater addition (r(2) > 0.90, p CDOM fluorescence at 275/342 nm was the most responsive wavelength to the point-source contamination in the lake. Our results suggest that pollutants in Lake Qiandao had the highest concentrations in the river mouths of upstream inflow tributaries and the single wavelength at 275/342 nm may be adapted for online or in situ fluorescence measurements as an early warning of contamination events. This study demonstrates the potential utility of CDOM fluorescence to monitor water quality in surface drinking water sources. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1984-02-01

    Supplement 17 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports the status of certain items that had not been resolved at the time of publication of the Safety Evaluation Report and the previous supplements

  1. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 27 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for a license to operate Diablo Canyon Nuclear Power Plant, Unit 1 (Docket No. 50-275), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement addresses the revisions to the license conditions and to the Technical Specifications as they relate to Amendment 10 to Diablo Canyon, Unit 1 Facility Operating License, DPR-76

  2. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1984-06-01

    Supplement 23 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement addresses the applicant's requests for approval of 22 deviations from the requirements of Section III.G of Appendix R of Title 10 of the Code of Federal Regulations Part 50

  3. Theoretical and Experimental Analysis of Low-Drag Supersonic Inlets Having a Circular Cross Section and a Central Body at Mach Numbers 3.30, 2.75, and 2.45

    Science.gov (United States)

    Ferri, Antonio; Nucci, Louis M

    1954-01-01

    Contains theoretical and experimental analysis of circular inlets having a central body at Mach numbers of 3.30, 2.75, and 2.45. The inlets have been designed in order to have low drag and high pressure recovery. The pressure recoveries obtained are of the same order of magnitude as those previously obtained by inlets having very large external drag.

  4. Continuously tunable cw lasing near 2.75 μm in diode-pumped Er3+ : SrF2 and Er3+ : CaF2 crystals

    International Nuclear Information System (INIS)

    Basiev, Tasoltan T; Orlovskii, Yu V; Polyachenkova, M V; Fedorov, Pavel P; Kuznetsov, S V; Konyushkin, V A; Osiko, Vyacheslav V; Alimov, Olimkhon K; Dergachev, Alexey Yu

    2006-01-01

    CW lasing is obtained in Er 3+ (5%) : CaF 2 and Er 3+ (5%) : SrF 2 crystals near 2.75 μm with 0.4 and 2 W of output powers, respectively, upon transverse diode laser pumping into the upper 4 I 11/2 laser level of erbium ions at 980 nm. Continuous tuning of the laser wavelength between 2720 and 2760 nm is realised in the Er 3+ : SrF 2 crystal. (special issue devoted to the 90th anniversary of a.m. prokhorov)

  5. Rotator cuff tears: assessment with MR arthrography in 275 patients with arthroscopic correlation

    International Nuclear Information System (INIS)

    Waldt, S.; Bruegel, M.; Mueller, D.; Holzapfel, K.; Rummeny, E.J.; Woertler, K.; Imhoff, A.B.

    2007-01-01

    We assessed the diagnostic performance of magnetic resonance (MR) arthrography in the diagnosis of articular-sided partial-thickness and full-thickness rotator cuff tears in a large symptomatic population. MR arthrograms obtained in 275 patients including a study group of 139 patients with rotator cuff tears proved by arthroscopy and a control group of 136 patients with arthroscopically intact rotator cuff tendons were reviewed in random order. MR imaging was performed on a 1.0 T system (Magnetom Expert, Siemens). MR arthrograms were analyzed by two radiologists in consensus for articular-sided partial-thickness and full-thickness tears of the supraspinatus, infraspinatus, and subscapularis tendons. At arthroscopy, 197 rotator cuff tears were diagnosed, including 105 partial-thickness (93 supraspinatus, nine infraspinatus, three subscapularis) and 92 full-thickness (43 supraspinatus, 20 infraspinatus, 29 subscapularis) tendon tears. For full-thickness tears, sensitivity, specificity, and accuracy were 96%, 99%, and 98%, respectively, and for partial tears 80%, 97%, and 95%, respectively. False negative and positive assessments in the diagnosis of articular-sided partial-thickness tears were predominantly [78% (35/45)] observed with small articular-sided (Ellman grade1) tendon tears. MR arthrography is highly accurate in the diagnosis of full-thickness rotator cuff tears and is accurate in the diagnosis of articular-sided partial-thickness tears. Limitations in the diagnosis of partial-thickness tears are mainly restricted to small articular-sided tears (Ellman grade 1) due to difficulties in differentiation between fiber tearing, tendinitis, synovitic changes, and superficial fraying at tendon margins. (orig.)

  6. Rotator cuff tears: assessment with MR arthrography in 275 patients with arthroscopic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Waldt, S.; Bruegel, M.; Mueller, D.; Holzapfel, K.; Rummeny, E.J.; Woertler, K. [Technische Universitaet Muenchen, Department of Radiology, Munich (Germany); Imhoff, A.B. [Technische Universitaet Muenchen, Department of Sports Orthopedics, Munich (Germany)

    2007-02-15

    We assessed the diagnostic performance of magnetic resonance (MR) arthrography in the diagnosis of articular-sided partial-thickness and full-thickness rotator cuff tears in a large symptomatic population. MR arthrograms obtained in 275 patients including a study group of 139 patients with rotator cuff tears proved by arthroscopy and a control group of 136 patients with arthroscopically intact rotator cuff tendons were reviewed in random order. MR imaging was performed on a 1.0 T system (Magnetom Expert, Siemens). MR arthrograms were analyzed by two radiologists in consensus for articular-sided partial-thickness and full-thickness tears of the supraspinatus, infraspinatus, and subscapularis tendons. At arthroscopy, 197 rotator cuff tears were diagnosed, including 105 partial-thickness (93 supraspinatus, nine infraspinatus, three subscapularis) and 92 full-thickness (43 supraspinatus, 20 infraspinatus, 29 subscapularis) tendon tears. For full-thickness tears, sensitivity, specificity, and accuracy were 96%, 99%, and 98%, respectively, and for partial tears 80%, 97%, and 95%, respectively. False negative and positive assessments in the diagnosis of articular-sided partial-thickness tears were predominantly [78% (35/45)] observed with small articular-sided (Ellman grade1) tendon tears. MR arthrography is highly accurate in the diagnosis of full-thickness rotator cuff tears and is accurate in the diagnosis of articular-sided partial-thickness tears. Limitations in the diagnosis of partial-thickness tears are mainly restricted to small articular-sided tears (Ellman grade 1) due to difficulties in differentiation between fiber tearing, tendinitis, synovitic changes, and superficial fraying at tendon margins. (orig.)

  7. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1991-06-01

    Supplement 34 to the Safety Evaluation Report for the application by Pacific Gas and Electric Company (PG ampersand E) for licenses to operate Diablo Canyon Nuclear Power Plant, Unit Nos. 1 and 2 (Docket Nos. 50-275 and 50-323, respectively) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement documents the NRC staff review of the Long-Term Seismic Program conducted by PG ampersand E in response to License Condition 2.C.(7) of Facility Operating License DPR-80, the Diablo Canyon Unit 1 operating license. 111 refs., 20 figs., 31 tabs

  8. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 28

    International Nuclear Information System (INIS)

    1985-04-01

    Supplement 28 to the Safety Evaluation Report for the Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of those allegations or concerns that have been identified to the NRC as of March 1, 1985

  9. Safety-evaluation report related to the operation of Diablo Canyon Nuclear Power Plants, Units 1 and 2. Docket Nos. 50-275 and 50-323. Supplement No. 18

    International Nuclear Information System (INIS)

    1983-08-01

    Supplement 18 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter to the licensee

  10. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 25

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 25 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323) has been prepared by the Office of Nuclear Reactor Regulation (NRR) of the US Nuclear Regulatory Commission. This supplement reports on the staff's inspection and evaluation efforts on the matter of piping and piping supports as related to the seven technical license conditions in an Order Modifying License issued by NRR on April 18, 1984

  11. PTF13efv—AN OUTBURST 500 DAYS PRIOR TO THE SNHUNT 275 EXPLOSION AND ITS RADIATIVE EFFICIENCY

    Energy Technology Data Exchange (ETDEWEB)

    Ofek, E. O.; Strotjohann, N.-L.; Rubin, A.; Gal-Yam, A.; Yaron, O. [Benoziyo Center for Astrophysics and the Helen Kimmel Center for Planetary Science, Weizmann Institute of Science, 76100 Rehovot (Israel); Cenko, S. B. [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD, 20771 (United States); Shaviv, N. J. [Racah Institute of Physics, The Hebrew University, 91904 Jerusalem (Israel); Duggan, G.; Kulkarni, S. R.; Cao, Y. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Sullivan, M. [School of Physics and Astronomy, University of Southampton, Southampton SO17 1BJ (United Kingdom); Nugent, P. E. [Computational Cosmology Center, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Kasliwal, M. M. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena CA 91101 (United States); Sollerman, J.; Fransson, C. [Department of Astronomy, The Oskar Klein Centre, Stockholm University, AlbaNova University Centre, SE-106 91 Stockholm (Sweden); Filippenko, A. V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Perley, D. A. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); Laher, R. [Spitzer Science Center, MS 314-6, California Institute of Technology, Pasadena, CA 91125 (United States)

    2016-06-10

    The progenitors of some supernovae (SNe) exhibit outbursts with super-Eddington luminosities prior to their final explosions. This behavior is common among SNe IIn, but the driving mechanisms of these precursors are not yet well-understood. SNHunt 275 was announced as a possible new SN during 2015 May. Here we report on pre-explosion observations of the location of this event by the Palomar Transient Factory (PTF) and report the detection of a precursor about 500 days prior to the 2015 May activity (PTF 13efv). The observed velocities in the 2015 transient and its 2013 precursor absorption spectra are low (1000–2000 km s{sup −1}), so it is not clear yet if the recent activity indeed marks the final disruption of the progenitor. Regardless of the nature of this event, we use the PTF photometric and spectral observations, as well as Swift -UVOT observations, to constrain the efficiency of the radiated energy relative to the total kinetic energy of the precursor. We find that, using an order-of-magnitude estimate and under the assumption of spherical symmetry, the ratio of the radiated energy to the kinetic energy is in the range of 4 × 10{sup −2} to 3.4 × 10{sup 3}.

  12. Donor Outcomes in Living Donor Liver Transplantation-Analysis of 275 Donors From a Single Centre in India.

    Science.gov (United States)

    Narasimhan, Gomathy; Safwan, Mohamed; Kota, Venugopal; Reddy, Mettu S; Bharathan, Anand; Dabora, Abderrhaim; Kaliamoorthy, Ilankumaran; Kanagavelu, Rathnavel G; Srinivasan, Vijaya; Rela, Mohamed

    2016-06-01

    Live donor liver transplantation is the predominant form of liver transplantation in India and in most Asian countries. Donor outcome reports are an important source of information to be shared with prospective donors at the time of informed consent. This is the first donor outcome series from India. Analysis of donor characteristics and morbidity of 275 live donors from a single large volume center is documented. Two hundred seventy-five patients donated from November 2009 to October 2014, 144 were women and 131 were men, 180 donated to adults and 95 donated to children. Right lobe donors were majority at 62.2% followed by left lateral segment 28%. Two thirds of the live donors did not have any morbidity; 114 complications were encountered in 85 patients. The complications were graded as per Clavien 5 tier grading and major morbidity (grade III b, grade IV grade V) was 4.36%. Postoperative biliary complication was seen in 3 donors. This large single-center study is the first donor outcome report from India, and the results are comparable to other published donor series. Documentation and regular audit of donor outcomes is important to help improve the safety of donor hepatectomy and to provide a database for informed consent of prospective donors.

  13. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 26

    International Nuclear Information System (INIS)

    1984-07-01

    Supplement 26 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Units 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection and evaluation of those allegations or concerns that have been identified to the NRC as of July 8, 1984. The report specifically addresses those allegations which the staff determined must be satisfactorily resolved prior to full power operation of Diablo Canyon Unit 1

  14. Rapid detection of the H275Y oseltamivir resistance mutation in influenza A/H1N1 2009 by single base pair RT-PCR and high-resolution melting.

    Directory of Open Access Journals (Sweden)

    Steven Y C Tong

    Full Text Available We aimed to design a real-time reverse-transcriptase-PCR (rRT-PCR, high-resolution melting (HRM assay to detect the H275Y mutation that confers oseltamivir resistance in influenza A/H1N1 2009 viruses.A novel strategy of amplifying a single base pair, the relevant SNP at position 823 of the neuraminidase gene, was chosen to maintain specificity of the assay. Wildtype and mutant virus were differentiated when using known reference samples of cell-cultured virus. However, when dilutions of these reference samples were assayed, amplification of non-specific primer-dimer was evident and affected the overall melting temperature (T(m of the amplified products. Due to primer-dimer appearance at >30 cycles we found that if the cycle threshold (C(T for a dilution was >30, the HRM assay did not consistently discriminate mutant from wildtype. Where the C(T was 32.98 would have an H275Y assay C(T>30. Analysis of the TaqMan C(T values for 609 consecutive clinical samples predicted that 207 (34% of the samples would result in an HRM assay C(T>30 and therefore not be amenable to the HRM assay.The use of single base pair PCR and HRM can be useful for specifically interrogating SNPs. When applied to H1N1 09, the constraints this placed on primer design resulted in amplification of primer-dimer products. The impact primer-dimer had on HRM curves was adjusted for by plotting T(m against C(T. Although less sensitive than TaqMan assays, the HRM assay can rapidly, and at low cost, screen samples with moderate viral concentrations.

  15. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323)

    International Nuclear Information System (INIS)

    1983-12-01

    Supplement 20 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plant, Unit 1 and Unit 2 (Docket Nos. 50-275 and 50-323), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. This supplement reports on the verification effort for Diablo Canyon Unit 1 that was performed between November 1981 and the present in response to Commission Order CLI-81-30 and an NRC letter of November 19, 1981 to the licensee. Specifically, Supplement 20 addresses those issues and other matters identified in Supplements 18 and 19 that must be resolved prior to Unit 1 achieving criticality and operating at power levels up to 5% of rated full power. This SER Supplement applies only to Diablo Canyon Unit 1

  16. Effects of Lowering Dialysate Calcium Concentration on Mineral and Bone Disorders in Chronic Hemodialysis Patients: Conversion from 3.0 mEq/L to 2.75 mEq/L.

    Science.gov (United States)

    Yamada, Shunsuke; Ueki, Kenji; Tokumoto, Masanori; Suehiro, Takaichi; Kimura, Hiroshi; Taniguchi, Masatomo; Fujimi, Satoru; Kitazono, Takanari; Tsuruya, Kazuhiko

    2016-02-01

    Selection of a lower dialysate calcium concentration (DCa) can reduce calcium burden and prevent vascular calcification in hemodialysis patients. However, decreased DCa can worsen mineral and bone disorders. This 1-year retrospective observational study evaluated 121 hemodialysis patients at Fukuoka Renal Clinic who underwent conversion of DCa from 3.0 mEq/L to 2.75 mEq/L. The primary outcomes were changes in serum levels of calcium, phosphate, and parathyroid hormone (PTH). The effects of baseline serum calcium and PTH levels on changes in biochemical parameters were also determined. One year after DCa conversion, mean serum calcium level decreased, while serum phosphate, alkaline phosphatase, and PTH concentrations increased. The rate of achievement of target PTH was higher in patients with lower serum PTH level at baseline, while patients with higher baseline serum PTH level tended to exceed the upper limit of the PTH target range. Patients with higher baseline serum calcium concentration showed a greater decrease in serum calcium level and a greater increase in serum PTH level at 1 year. Patients with a lower baseline serum PTH level can benefit from optimal PTH control following conversion of DCa from 3.0 mEq/L to 2.75 mEq/L. However, secondary hyperparathyroidism may be exacerbated in some patients with higher baseline serum calcium (Ca) and PTH levels. These results indicate that an individualized approach can maximize the benefits of Ca unloading after conversion to lower DCa. © 2015 International Society for Apheresis, Japanese Society for Apheresis, and Japanese Society for Dialysis Therapy.

  17. N33*++ isobar production and isospin 2 ππ interaction studied in the reaction π- p → p π+π-π- at 2.75 GeV/c

    International Nuclear Information System (INIS)

    Alitti, J.

    1967-01-01

    A study of the reaction π - p → p π + π - π - at 2.75 GeV/c was carried out in an 81 cm liquid hydrogen bubble chamber at the CERN proton synchrotron. One observes that the abundant N 33 *++ (1236 MeV) isobar production occurs predominantly backwards in the center of mass of the reaction. This feature suggests a peripheral production mechanism with π exchange. The validity of this hypothesis, which allows the study of the π - π - interaction within the frame of the Chew and Low model, is verified. Among other results one finds for the isospin-2 state the values of the elastic ππ cross section and of the S and D wave phase shifts. (author) [fr

  18. The Sloan Digital Sky Survey COADD: 275 deg2 of deep Sloan Digital Sky Survey imaging on stripe 82

    International Nuclear Information System (INIS)

    Annis, James; Soares-Santos, Marcelle; Dodelson, Scott; Hao, Jiangang; Jester, Sebastian; Johnston, David E.; Kubo, Jeffrey M.; Lampeitl, Hubert; Lin, Huan; Miknaitis, Gajus; Yanny, Brian; Strauss, Michael A.; Gunn, James E.; Lupton, Robert H.; Becker, Andrew C.; Ivezić, Željko; Fan, Xiaohui; Jiang, Linhua; Seo, Hee-Jong; Simet, Melanie

    2014-01-01

    We present details of the construction and characterization of the coaddition of the Sloan Digital Sky Survey (SDSS) Stripe 82 ugriz imaging data. This survey consists of 275 deg 2 of repeated scanning by the SDSS camera over –50° ≤ α ≤ 60° and –1.°25 ≤ δ ≤ +1.°25 centered on the Celestial Equator. Each piece of sky has ∼20 runs contributing and thus reaches ∼2 mag fainter than the SDSS single pass data, i.e., to r ∼ 23.5 for galaxies. We discuss the image processing of the coaddition, the modeling of the point-spread function (PSF), the calibration, and the production of standard SDSS catalogs. The data have an r-band median seeing of 1.''1 and are calibrated to ≤1%. Star color-color, number counts, and PSF size versus modeled size plots show that the modeling of the PSF is good enough for precision five-band photometry. Structure in the PSF model versus magnitude plot indicates minor PSF modeling errors, leading to misclassification of stars as galaxies, as verified using VVDS spectroscopy. There are a variety of uses for this wide-angle deep imaging data, including galactic structure, photometric redshift computation, cluster finding and cross wavelength measurements, weak lensing cluster mass calibrations, and cosmic shear measurements.

  19. Safety Evaluation Report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Supplement No. 33

    International Nuclear Information System (INIS)

    1986-05-01

    Supplement 33 to the Safety Evaluation Report for the Pacific Gas and Electric Company's Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323) has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. The supplement reports on the status of the staff's investigation, inspection, and evaluation of allegations and concerns that have been identified to the NRC through March 1986. The report includes a complete listing of all allegations and concerns, indicating the status of their resolution. The NRC staff concludes that the technical issues raised in the allegations with regard to the design, construction, and safe operation of Diablo Canyon Units 1 and 2 have been satisfactorily resolved and no further action is required

  20. Safety evaluation report related to the operation of Diablo Canyon Nuclear Power Plant, Units 1 and 2 (Docket Nos. 50-275 and 50-323). Suppl. 22

    International Nuclear Information System (INIS)

    1984-03-01

    Supplement 22 to the Safety Evaluation Report for Pacific Gas and Electric Company's application for licenses to operate Diablo Canyon Nuclear Power Plants, Unit 1 and 2 (Docket Nos. 50-275 and 50-323), has been prepared jointly by the Office of Nuclear Reactor Regulation and the Region V Office of the US Nuclear Regulatory Commission. This supplement provides the criteria that were used by the staff to determine which of the allegations that have been evaluated and must be resolved prior to Unit 1 achieving criticality and operating at power level up to 5 percent of rated power (i.e., low power operation). The supplement also reports on the status of the staff's investigation, inspection and evaluation of 219 allegations or concerns that have been identified to the NRC as of March 9, 1984, excluding those recently received under 10 CFR 2.206 petitions

  1. Volumetric and viscometric study of aqueous binary mixtures of some glycol ethers at T = (275.15 and 283.15) K

    International Nuclear Information System (INIS)

    Dhondge, Sudhakar S.; Pandhurnekar, Chandrashekhar P.; Sheikh, Shaziya; Deshmukh, Dinesh W.

    2011-01-01

    Graphical abstract: Highlights: → Study of aqueous solutions of glycol ethers at low temperatures is presented. → Glycol ethers are industrially important liquids. → Reduction in the volume was observed upon addition of all glycol ethers to water. → Glycol ethers act as structure makers in aqueous medium. - Abstract: The experimental data for the density (ρ) and viscosity (η) are reported for aqueous binary mixtures of different glycol ethers, namely ethylene glycol monomethyl ether (EGMME), ethylene glycol monoethyl ether (EGMEE), diethylene glycol monomethyl ether (DEGMME), and diethylene glycol monoethyl ether (DEGMEE), at different temperatures (T = 275.15 K and 283.15 K) within the concentration range 0 mol . kg -1 to 0.1 mol . kg -1 . The values of density (ρ) and viscosity (η) of the solutions were used to compute different derived parameters, such as apparent molar volume (φ V ) of the solute, excess molar volume (V E ) of the solution, viscosity B and D coefficients of solution and temperature coefficient of viscosity B-coefficient (dB/dT) of solution. The limiting apparent molar volume of the solutes (φ V 0 ) have been obtained for aqueous binary mixtures of these glycol ethers by smooth extrapolation of φ V -m curves to zero concentration. By using the values of φ V 0 , the limiting excess partial molar volumes (V-bar 2 0E ) have also been calculated. The results are interpreted in term of various interactions such as solute-solvent interactions and hydrogen bonding.

  2. N{sub 33}{sup *++} isobar production and isospin 2 {pi}{pi} interaction studied in the reaction {pi}{sup -} p {yields} p {pi}{sup +}{pi}{sup -}{pi}{sup -} at 2.75 GeV/c; Production de l'isobare N{sub 33}{sup *++} et interaction {pi}{pi} dans l'etat d'isospin I = 2, etudiees dans la reaction {pi}{sup -} p {yields} p {pi}{sup +}{pi}{sup -}{pi}{sup -} a 2.75 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Alitti, J [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)

    1967-07-01

    A study of the reaction {pi}{sup -} p {yields} p {pi}{sup +}{pi}{sup -}{pi}{sup -} at 2.75 GeV/c was carried out in an 81 cm liquid hydrogen bubble chamber at the CERN proton synchrotron. One observes that the abundant N{sub 33}{sup *++} (1236 MeV) isobar production occurs predominantly backwards in the center of mass of the reaction. This feature suggests a peripheral production mechanism with {pi} exchange. The validity of this hypothesis, which allows the study of the {pi}{sup -}{pi}{sup -} interaction within the frame of the Chew and Low model, is verified. Among other results one finds for the isospin-2 state the values of the elastic {pi}{pi} cross section and of the S and D wave phase shifts. (author) [French] Etude de la reaction {pi}{sup -} p {yields} p {pi}{sup +}{pi}{sup -}{pi}{sup -} a 2.75 GeV/c, effectuee a l'aide de la chambre a bulles a hydrogene liquide de 81 cm de Saclay exposee aupres du synchrotron a protons du CERN. On observe une abondante production de l'isobare N{sub 33}{sup *++} a 1236 MeV, lequel est emis de preference vers l'arriere dans le centre de masse de la reaction. Ceci suggere un mecanisme de production peripherique avec echange d'un {pi}. Cette hypothese dont on a mis a l'epreuve la validite permet l'etude de l'interaction {pi}{sup -}{pi}{sup -} dans le cadre du modele de Chew et Low. Entre autres resultats, on donne, pour l'etat d'isospin I = 2, les valeurs de la section efficace de diffusion elastique {pi}{pi} et les dephasages des ondes S et D. (auteur)

  3. High temperature aqueous potassium and sodium phosphate solutions: two-liquid-phase boundaries and critical phenomena, 275-4000C; potential applications for steam generators

    International Nuclear Information System (INIS)

    Marshall, W.L.

    1981-12-01

    Two-liquid-phase boundaries at temperatures between 275 and 400 0 C were determined for potassium phosphate and sodium phosphate aqueous solutions for compositions from 0 to 60 wt % dissolved salt. The stoichiometric mole ratios, K/PO 4 or Na/PO 4 , were varied from 1.00 to 2.12 and from 1.00 to 2.16 for the potassium and sodium systems, respectively. Liquid-vapor critical temperatures were also determined for most of the dilute liquid phases that formed. The minimum temperatures (below which a single solution existed) of two-liquid-phase formation were 360 0 C for the potassium system and 279 0 C for the sodium system at mole ratios of 2.00 and 2.16, respectively. For the sodium system at mole ratios greater than 2.16, solids crystallized at lower temperatures as expected from earlier studies. In contrast, potassium solutions that were explored at mole ratios from 2.12 to 3.16 and at temperatures below 360 0 C did not produce solid phases nor liquid-liquid immiscibilities. Aside from the generally unusual observations of two immiscible liquids in an aqueous inorganic salt system, the results could possibly be applied to the use of phosphate additives in steam power generators. 16 refs

  4. The kinetic glass transition of the Zr46.75Ti8.25Cu7.5Ni10Be27.5 bulk metallic glass former-supercooled liquids on a long time scale

    International Nuclear Information System (INIS)

    Busch, R.; Johnson, W.L.

    1998-01-01

    Viscosity and enthalpy relaxation from the amorphous state into the supercooled liquid state was investigated in the bulk metallic glass forming Zr 46.75 Ti 8.25 Cu 7.5 Ni 10 Be 27.5 alloy below the calorimetric glass transition. At different temperatures, the viscosities relax into states that obey the same Vogel endash Fulcher endash Tammann relation as the data obtained at higher temperatures in the supercooled liquid. Enthalpy recovery experiments after relaxation in the same temperature range show that the enthalpy of the material reaches values that also corresponds to the supercooled liquid state. The glass relaxes into a metastable supercooled liquid state, if it is observed on a long time scale. Equilibration is possible far below the calorimetric glass transition and very likely even below the isentropic temperature. copyright 1998 American Institute of Physics

  5. Exploiting MISR products at the full spatial resolution (275m) to document changes in land properties in and around the Kruger National Park, South Africa

    Science.gov (United States)

    Verstraete, M. M.; Hunt, L. A.; Pinty, B.; Clerici, M.; Scholes, R. J.

    2009-12-01

    The MISR instrument on NASA's Terra platform has been acquiring data globally and continuously for almost 10 years. A wide range of atmospheric and land products are operationally generated at the LaRC ASDC, at spatial resolutions of 1.1 km or coarser. Yet, the intrinsic spatial resolution of that sensor is 275m and 12 out of the 36 spectro-directional data channels are transmitted to the ground segment at that resolution. Recent algorithmic developments have permitted us to reconstruct reasonable estimates of the other 24 channels and to account for atmospheric effects at the full original spatial resolution. Spectro-directional reflectances have been processed to characterize the anisotropy of observed land surfaces and then optimally estimate various geophysical properties of the environment such as the fluxes of radiation in and out of plant canopies, the albedo, FAPAR, etc. These detailed products allow us to investigate ecological and environmental changes in much greater spatial and thematic detail than was previously possible. The paper outlines the various methodological steps implemented and exhibits concrete results for a region of moderate size (280 by 380 km) in South Africa. Practical downstream applications of this approach include monitoring desertification and biomass burning, documenting urbanization or characterizing the phenology of vegetation.

  6. Re-Design Pompa Sentrifugal Double Admission dengan Fluida Kerja Semi Lean Benfield Solution (K2CO3 pada Kapasitas 700 m3/h dan Head 275.8 m, (STUDI KASUS : PT. PETROKIMIA GRESIK

    Directory of Open Access Journals (Sweden)

    Fathur Rahim

    2013-09-01

    Full Text Available Penggunaan pompa sentrifugal dalam dunia industri, khususnya di PT. Petrokimia Gresik memiliki peran yang sangat penting, terutama untuk memindahkan fluida kerja dari satu tempat ke tempat lain. PT. Petrokima Gresik dalam menggunakan jenis pompa untuk mengalirkan semi lean benfield solution ( yang berfungsi sebagai absorber dalam proses pembuatan amoniak. Seiring berjalannya waktu, kapasitas pompa sentrifugal double admission yang semula 582,3ingin ditingkatkan menjadi 700 Oleh karena itu, dilakukan perancangan ulang pompa sentrifugal double admission untuk fluida kerja semi lean benfield solution ( .Setelah itu dilakukan perancangan ulang pompa dengan data yang telah diolah meliputi perancangan poros, impeller dengan bentuk sudu double curvature, volute, pasak dan bearing. Dari perancangan ulang, didapatkan desain pompa sentrifugal double admission untuk fluida kerja semi lean benfield solution ( yang sesuai dengan kapasitas 700pada head 275,8 m serta daya BHP sebesar 886 Kwatt dengan effisiensi 74%.

  7. Road dust and its effect on human health: a literature review

    Science.gov (United States)

    2018-01-01

    The purpose of this study was to determine the effects of road dust on human health. A PubMed search was used to extract references that included the words “road dust” and “health” or “fugitive dust” and “health” in the title or abstract. A total of 46 references were extracted and selected for review after the primary screening of 949 articles. The respiratory system was found to be the most affected system in the human body. Lead, platinum-group elements (platinum, rhodium, and bohrium), aluminum, zinc, vanadium, and polycyclic aromatic hydrocarbons were the components of road dust that were most frequently referenced in the articles reviewed. Road dust was found to have harmful effects on the human body, especially on the respiratory system. To determine the complex mechanism of action of various components of road dust on the human body and the results thereof, the authors recommend a further meta-analysis and extensive risk-assessment research into the health impacts of dust exposure. PMID:29642653

  8. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  9. Two-liquid-phase boundaries and critical phenomena at 275 to 4000C for high-temperature aqueous potassium phosphate and sodium phosphate solutions. Potential applications for steam generators

    International Nuclear Information System (INIS)

    Marshall, W.L.

    1982-01-01

    Two-liquid-phase boundaries at temperatures between 275 and 400 0 C were determined for potassium phosphate and sodium phosphate aqueous solutions for compositions from 0 to 60 wt % dissolved salt. The stoichiometric mole ratios, K/PO 4 or Na/PO 4 , were varied from 1.00 to 2.12 and from 1.00 to 2.16 for the potassium and sodium systems, respectively. Liquid-vapor critical temperatures were also determined for most of the dilute liquid phases that formed. The minimum temperatures (below which a single solution existed) of two-liquid-phase formation were 360 0 C for the potassium system and 279 0 C for the sodium system at mole ratios of 2.00 and 2.16, respectively. For the sodium system at mole ratios greater than 2.16, solids crystallized at lower temperatures as expected from earlier studies. In contrast, potassium solutions that were explored at mole ratios from 2.12 to 3.16 and at temperatures below 360 0 C did not produce solid phases or liquid-liquid immisibilities. Aside from the generally unusual observations of two immiscible liquids in an aqueous inorganic salt system, the results could possibly be applied to the use of phosphate additives in steam power generators

  10. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.

    2001-01-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  11. 49 CFR 27.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    .... Facility means all or any portion of buildings, structures, vehicles, equipment, roads, walks, parking lots... Administration, Federal Railroad Administration, National Highway Traffic Safety Administration, Federal Transit... college, university, or other postsecondary institution, or a public system of higher education; or (ii) A...

  12. 7 CFR 275.11 - Sampling.

    Science.gov (United States)

    2010-01-01

    ... situation. Whatever the design, it must conform to commonly acceptable statistical theory and application... this section. (3) Unwanted cases. A frame may include cases for which information is not desired (e.g... household which was denied, but subsequently certified within the normal 30 day processing standard, using...

  13. 32 CFR 275.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... maintained in the name of that person. (c) Financial Institution (for intelligence activity purposes only. (1... metals, stones, or jewels. (15) A pawnbroker. (16) A loan or finance company. (17) A travel agency. (18) A licensed sender of money or any other person who engages as a business in the transmission of...

  14. Thermal stability of carbonyl radicals. Part II. Reactions of methylglyoxyl and methylglyoxylperoxy radicals at 1 bar in the temperature range 275-311 K.

    Science.gov (United States)

    Jagiella, Stefan; Zabel, Friedhelm

    2008-04-07

    Reactions of methylglyoxyl and methylglyoxylperoxy radicals were investigated at a total pressure of 1 bar in oxygen. Methylglyoxyl radicals were generated by stationary photolysis of Br2-CH3C(O)C(O)H-NO2-O2-N2 mixtures at wavelengths > or =480 nm and of Cl2-CH3C(O)C(O)H-NO2-O2-N2 mixtures in the wavelength range 315-460 nm. In the bromine system, rate constant ratios for the reactions CH3C(O)CO --> CH3CO + CO (kdis) and CH3C(O)CO + O2 --> CH3C(O)C(O)O2 (kO2) were measured as a function of temperature in the range 275-311 K. Assuming the constant value kO2 = 5.1 x 10(-12) cm3 molecule(-1) s(-1) for our reaction conditions, kdis = 1.2 x 10(10.0+/-0.7) x exp(-11.7 +/- 3.8 kJ mol(-1)/RT) s(-1) (2sigma errors) was obtained for ptot = 1 bar (M = O2), in good agreement with the kinetic parameters calculated by Méreau et al. [R. Méreau, M.-T. Rayez, J.-C. Rayez, F. Caralp and R. Lesclaux, Phys. Chem. Chem. Phys., 2001, 3, 4712]. CH3C(O)C(O)O2 radicals oxidise NO2, forming NO3, CH3CO and CO2. This experimental result is supported by DFT and ab initio calculations. Possible mechanisms for the observed formation of several % of ketene and bromoacetyl peroxynitrate are discussed. Use of Cl rather than Br atoms to abstract the aldehydic H atom from methylglyoxal leads to chemically activated CH3C(O)CO radicals, thus substantially increasing the fraction of CH3C(O)CO radicals that decompose rather than add O2.

  15. Druggists and pharmacists as gatekeepers: sales routines and compliance with sales protocols for over-the-counter naproxen 275 mg medicines in the Netherlands.

    Science.gov (United States)

    van Hoof, Joris J; Cents, Michel H G; Megens, Nicole M J; van der Tang, Sijbrand J

    2014-09-01

    Since for the sales of over-the-counter (OTC) medicines, prescribing physicians are not involved, and written instructions on/in the medicine boxes are inefficient, druggists and pharmacists are important gatekeepers in preventing customers' accidents. In this study we investigated the sales routines, and compliance with sales protocols, in order to evaluate that gatekeeper's function. By means of the mystery shopping method, 228 pharmacies and drugstores in The Netherlands were visited and a naproxen 275mg medium-risk medicine was requested for a (fictitious) patient who was suffering from severe back pains. According to the sales protocols the vendors should never sell the requested medicine, because the mystery shoppers only gave an answer to one of the four mandatory sales protocol questions. Furthermore, the requested medicine is not the right or best choice for back pains. Four different scenarios were used in a 2×2 design (8-year-old patient vs. 25-year-old patient, and 1 box with 12 pills vs. 3 boxes with 12 pills). Of the drugstores and pharmacies only 16.7% complied with the sales protocols and did not sell the specific (or comparable) medicine, after asking all four mandatory questions (or already after one, two or three questions). Most vendors (83.3%) did not comply and sold the requested medicine, a comparable medicine, or even a more risky medicine after no question at all (or after asking some or even all four questions). Although both score low, pharmacists show better compliance (23.9%) than druggists (10.1%). When it comes to OTC medicines, druggists and pharmacists largely commit sloppy sales. The expected gatekeeping function of pharmacists and druggists is very limited, and customers might be in danger of inappropriate medicine selection, quantity and usage. We call for thorough evaluation of the over-the-counter system, improvement of the educational programs for medicine providers, and national campaigns to inform the public. Copyright

  16. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  17. Physical activity, body mass index and heart rate variability-based stress and recovery in 16 275 Finnish employees: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Tiina Föhr

    2016-08-01

    Full Text Available Abstract Background Physical inactivity, overweight, and work-related stress are major concerns today. Psychological stress causes physiological responses such as reduced heart rate variability (HRV, owing to attenuated parasympathetic and/or increased sympathetic activity in cardiac autonomic control. This study’s purpose was to investigate the relationships between physical activity (PA, body mass index (BMI, and HRV-based stress and recovery on workdays, among Finnish employees. Methods The participants in this cross-sectional study were 16 275 individuals (6863 men and 9412 women; age 18–65 years; BMI 18.5–40.0 kg/m2. Assessments of stress, recovery and PA were based on HRV data from beat-to-beat R-R interval recording (mainly over 3 days. The validated HRV-derived variables took into account the dynamics and individuality of HRV. Stress percentage (the proportion of stress reactions, workday and working hours, and stress balance (ratio between recovery and stress reactions, sleep describe the amount of physiological stress and recovery, respectively. Variables describing the intensity (i.e. magnitude of recognized reactions of physiological stress and recovery were stress index (workday and recovery index (sleep, respectively. Moderate to vigorous PA was measured and participants divided into the following groups, based on calculated weekly PA: inactive (0 min, low (0 300 min. BMI was calculated from self-reported weight and height. Linear models were employed in the main analyses. Results High PA was associated with lower stress percentages (during workdays and working hours and stress balance. Higher BMI was associated with higher stress index, and lower stress balance and recovery index. These results were similar for men and women (P < 0.001 for all. Conclusion Independent of age and sex, high PA was associated with a lower amount of stress on workdays. Additionally, lower BMI was associated with better recovery during

  18. 7 CFR 275.9 - Review process.

    Science.gov (United States)

    2010-01-01

    ... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM PERFORMANCE REPORTING SYSTEM Management Evaluation (ME..., reporting points, and data management units selected for review and the techniques used to select them; (iv.... Bias can be introduced through leading questions, incomplete reviews, incorrect sampling techniques...

  19. Reference: 275 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available |Bhatt Anuj M|Chelysheva Liudmila|Diallo Stéphanie|Gendrot Ghislaine|Grelon Mathilde|Horlow Christine|Mercie...r Raphaël|Márquez-Lema Angustias|Mézard Christine|Rocques Nathalie|Vezon Daniel|Vrielynck Nathalie

  20. 7 CFR 275.4 - Record retention.

    Science.gov (United States)

    2010-01-01

    ... materials supporting the review decision; sample lists; sampling frames; tabulation sheets; and reports of... Stamps and Medicaid Quality Control Reviews, FNS-380-1, Integrated Review Schedule, FNS-245, Negative...

  1. 48 CFR 211.275-2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... that— (1) Contain items in any of the following classes of supply, as defined in DoD 4140.1-R, DoD Supply Chain Materiel Management Regulation, AP1.1.11: (i) Subclass of Class I—Packaged operational... administrative and housekeeping supplies and equipment. (iii) Class IIIP—Packaged petroleum, lubricants, oils...

  2. Publications | Page 275 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    New... HIV/AIDS and food insecurity: Double jeopardy. In 1989, while working at the Food and Agriculture Organization of the United Nations, Stuart Gillespie spent six months examining the connection between HIV/AIDS and food security. It quickly became clear to him that the epidemic's... CASE STUDY: Team players.

  3. Solid-state synthesis in the system Na0.8NbyW1-yO3 with 0≤y≤0.4: A new phase, Na0.5NbO2.75, with perovskite-type structure

    International Nuclear Information System (INIS)

    Debnath, Tapas; Ruescher, Claus H.; Gesing, Thorsten M.; Koepke, Juergen; Hussain, Altaf

    2008-01-01

    Series of compounds in the system Na x Nb y W 1-y O 3 were prepared according to the appropriate molar ratio of Na 2 WO 4 , WO 3 , WO 2 and Nb 2 O 5 with x=0.80 and 0.0≤y≤0.4 at 600 deg. C in evacuated silica glass tubes. These compounds were investigated by X-ray powder diffraction, optical microscopy, microprobe analysis, Raman and optical microspectroscopy. A y-dependent separation into three distinct coloured crystallites with cubic perovskite-type structures is observed: (i) red-orange crystallites with composition Na x WO 3 with slightly decreasing x (i.e. 0.8-0.72) with increasing nominal y, (ii) bluish solid solution of composition Na x Nb y W 1-y O 3 and (iii) white crystallites of a new phase having defect perovskite-type structure with composition Na 0.5 NbO 2.75 . - Graphical abstract: Optical micrograph of a polished sample of nominal composition Na 0.8 Nb 0.4 W 0.6 O 3 showing a mixture of three different coloured crystals: red, light blue and white. The scale bar is 30 μm

  4. CONDIÇÕES HIGIÊNICAS DE FATIADORES DE FRIOS AVALIADAS POR ATP-BIOLUMINESCÊNCIA E CONTAGEM MICROBIANA: SUGESTÃO DE HIGIENIZAÇÃO CONFORME RDC 275 DA ANVISA

    Directory of Open Access Journals (Sweden)

    A. C. S. PIRES

    2009-01-01

    Full Text Available

    As superfícies de fatiadores de frios de sete estabelecimentos comerciais foram consideradas em condições higiênicas insatisfatórias tanto pela análise microbiológica convencional quanto pela técnica do ATP-bioluminescência, de acordo com as recomendações propostas pelas entidades científicas e pesquisas relacionadas, uma vez que não existem padrões estabelecidos pela legislação. As contagens microbianas alcançaram valores elevados, atingindo médias de 3,87 log UFC.cm-2, 1,89 log UFC.cm-2 e 0,86 log UFC.cm-2 , para mesófilos aeróbios, coliformes totais e Staphylococcus coagulase positiva, respectivamente. As contagens de fungos filamentosos e leveduras variaram de 1,58 a 3,88 log UFC.cm-2 e a maioria das contagens de Staphylococcus spp. variou de 2,88 a 3,80 log UFC.cm-2. Constatou-se uma elevada contagem de Staphylococcus spp., que pode ser originária de manipuladores com hábitos higiênicos inadequados, ou dos próprios alimentos fatiados, particularmente no caso de queijos. Uma sugestão de procedimento operacional padronizado (POP para os fatiadores com base na RDC 275/2002 da ANVISA foi disponibilizada aos responsáveis pela higienização dos estabelecimentos comerciais. No POP, foram enfatizados os produtos químicos e as ajudas de limpeza; freqüência e descrição completa do procedimento que inclui concentração, pH, tempo e temperatura de contato. Além do monitoramento do procedimento, medidas de correção e riscos de uma higienização incorreta foram apontados.

  5. 7 CFR 275.19 - Monitoring and evaluation.

    Science.gov (United States)

    2010-01-01

    ... Project Area/Management Unit Corrective Action Plan is implemented and achieves the anticipated results... data available through program management tools and other sources. (c) In instances where the State agency and/or the project area/management unit determines that the proposed corrective action is not...

  6. 275---11 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    11 Des 2009 ... Narrative therapy is suggested as a means of grief counselling, as it makes use of the story analogy, which supports the notion of an open end to the ... narrative approach to grief will generate the consolation needed by the grief-stricken on their ...... International Journal of Practical Theology 8(2), 1–14.

  7. 7 CFR 275.2 - State agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... knowledge of either the household or the decision under review. Where there is prior knowledge, the reviewer must disqualify her/himself. Prior knowledge is defined as having: (1) Taken any part in the decision...

  8. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... The stimulatory effect of the aqueous extract of G. lucidum, a basidiomycetes class fungus ... activity of GL extract was observed through the inhibition of ...... ides and its effect on antioxidant enzymes and immunity activities in.

  9. 25 CFR 275.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM... utilizing the services of Bureau employees. These regulations are not intended to prevent an Indian tribe or... Service Commission regulations must be adhered to. ...

  10. 25 CFR 275.3 - Methods for staffing.

    Science.gov (United States)

    2010-04-01

    ... provided by the Area Personnel Office in complying with Civil Service instructions (Federal Personnel... coverage for any of the following Federal benefits: (i) Compensation for work injuries. (ii) Retirement... designated by the tribal governing body, is responsible for the planning, coordination, and completion of the...

  11. 49 CFR 234.275 - Processor-based systems.

    Science.gov (United States)

    2010-10-01

    ...) Applicable definitions. The definitions in § 236.903 of this chapter shall apply to this section, where applicable. (b) Use of performance standard authorized or required. (1) In lieu of compliance with the... are satisfied using alternative means. Deviation from those particular requirements is authorized if...

  12. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    Eichler, R.; Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A.; Gaeggeler, H.W.

    1999-01-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO 3 , HReO 4 ) ΔH ads (ReO 3 ) = -190 ± 10 kJ/mol; ΔS ads (ReO 3 ) = -179±30 J/mol K; ΔH ads (HReO 4 ) = -77 ± 5 kJ/mol; ΔS ads (HReO 4 ) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176 Re, 152-155 Er, 151-154 Ho, 218 Po, and 214 Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  13. The effect of transport density and gender on stress indicators and carcass and meat quality in pigs

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.

    2015-07-01

    A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)

  14. Alfvén wave filamentation and dispersive phase mixing in a high-density channel: Landau fluid and hybrid simulations

    Czech Academy of Sciences Publication Activity Database

    Borgogno, D.; Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2009-01-01

    Roč. 16, č. 2 (2009), s. 275-285 ISSN 1023-5809 R&D Projects: GA AV ČR IAA300420702 Institutional research plan: CEZ:AV0Z30420517; CEZ:AV0Z10030501 Keywords : Alfven wave * phase mixing * filamentation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.152, year: 2009 http://www.nonlin-processes-geophys.net/16/275/2009/npg-16-275-2009.pdf

  15. Involvement of Heme Oxygenase-1 Induction in the Cytoprotective and Immunomodulatory Activities of Viola patrinii in Murine Hippocampal and Microglia Cells

    Directory of Open Access Journals (Sweden)

    Bin Li

    2012-01-01

    Full Text Available A number of diseases that lead to injury of the central nervous system are caused by oxidative stress and inflammation in the brain. In this study, NNMBS275, consisting of the ethanol extract of Viola patrinii, showed potent antioxidative and anti-inflammatory activity in murine hippocampal HT22 cells and BV2 microglia. NNMBS275 increased cellular resistance to oxidative injury caused by glutamate-induced neurotoxicity and reactive oxygen species generation in HT22 cells. In addition, the anti-inflammatory effects of NNMBS275 were demonstrated by the suppression of proinflammatory mediators, including proinflammatory enzymes (inducible nitric oxide synthase and cyclooxygenase-2 and cytokines (tumor necrosis factor-α and interleukin-1β. Furthermore, we found that the neuroprotective and anti-inflammatory effects of NNMBS275 were linked to the upregulation of nuclear transcription factor-E2-related factor 2-dependent expression of heme oxygenase-1 in HT22 and BV2 cells. These results suggest that NNMBS275 possesses therapeutic potential against neurodegenerative diseases that are induced by oxidative stress and neuroinflammation.

  16. Smaller incision size leads to higher predictability in microcoaxial cataract surgery.

    Science.gov (United States)

    Klamann, Matthias K J; Gonnermann, Johannes; Maier, Anna-Karina B; Torun, Necip; Bertelmann, Eckart

    2013-01-01

    The aim of the study was to compare the clinical outcomes of a 1.8 mm, 2.2 mm, and 2.75 mm microcoaxial cataract surgery system. METHODS. In this retrospective study, 129 eyes of 129 patients were included. Patients underwent phacoemulsification using a Stellaris system or an Infiniti system. The incision size was 1.8 mm, 2.2 mm, or 2.75 mm, respectively. Subjects were examined before surgery and 4 weeks after. The surgically induced astigmatism (SIA) was examined. The SIA in the 1.8 mm group was statistically lower compared to the 2.2 mm group (p=0.046) and the 2.75 mm group (p=0.017). There was no significant difference between the 2.2 mm group and the 2.75 mm group. With the use of appropriate support systems, 1.8 mm incisions appear to result in less SIA than 2.2 mm and 2.75 mm incisions. Advantages may arise from this, especially in the implantation of aspheric, toric, or multifocal lenses.

  17. Translations on Narcotics and Dangerous Drugs No. 275.

    Science.gov (United States)

    1976-12-09

    8217Vast’ Drug Network (HERALD, 25 Nov 76) l7 CHILE Marihuana Grower, Trafficker Arrested (LA TERCERA DE LA HORA, 10 Nov 76) 18 COLOMBIA...17 CHILE MARIHUANA. GROWER, TRAFFICKER ARRESTED Santiago LA TERCERA DE IA HORA in Spanish 10 Nov 76 p 27 [Text] Between 250,000 and 300,000...mountainous Aguas Negras region in the jurisdiction of Solano, where seven per- sons were arrested and a very complete laboratory was seized, together

  18. 7 CFR 275.21 - Quality control review reports.

    Science.gov (United States)

    2010-01-01

    ... terminals, the State agency shall submit the results of each QC review in a format specified by FNS. Upon... in the individual case records, or legible copies of that material, as well as legible hard copies of... selection and completion on the Form FNS-248, Status of Sample Selection and Completion or other format...

  19. 275 THE AETIOLOGY AND POSSmLE PREVENTION OF ...

    African Journals Online (AJOL)

    1971-03-13

    Mar 13, 1971 ... sex hormones, vitamin D3 and cortisone, suggests that future research ... Nevertheless, the importance of these various characteristics and, in fact, ..... As in idiopathic hypercalcaemia, high doses of vitamin D can also cause ...

  20. 40 CFR 180.275 - Chlorothalonil; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ....5 Cherry, tart 0.5 Cocoa bean, dried bean 0.05 Coffee, bean, green 0.20 Corn, sweet, kernel plus cob... Pea, edible podded 5 Peach 0.5 Peanut 0.3 Pistachio 0.2 Plum 0.2 Plum, prune 0.2 Potato 0.1 Rhubarb 4...

  1. 7 CFR 275.12 - Review of active cases.

    Science.gov (United States)

    2010-01-01

    .... (1) Personal interviews. Personal interviews shall be conducted in a manner that respects the rights, privacy, and dignity of the participants. Prior to conducting the personal interview, the reviewer shall... quality control, and that a personal face-to-face interview will be conducted in the future. The method of...

  2. Dicty_cDB: VHI275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTAATCCTATTTGGTGTTCGTACCAATAACCAXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *gvcnns...GP*kpdygi*sylvfvpit--- Translated Amino Acid sequence (All Frames) Frame A: *gvcnnspakwtspeng*r*qwmvdaqslkev

  3. Surgical Results of Laparoscopic Loop Duodenojejunal Bypass with Sleeve Gastrectomy (LDJB-SG in Obese Asians (BMI ≥ 27.5 kg/m2 with Type 2 Diabetes Mellitus (T2DM: A New Promising Bariatric and Metabolic Surgery

    Directory of Open Access Journals (Sweden)

    Voraboot Taweerutchana, M.D. F.R.C.S.T.

    2018-03-01

    Full Text Available Objective: To demonstrate surgical outcomes, safety and complications in obese Asians (BMI > 27.5 kg/m2 who underwent LDJB-SG in our center. Methods: We retrospectively reviewed ninety-one patients who underwent LDJB-SG from October 2011 to March 2014. One-year surgical outcomes regarding the efficacy of weight loss, safety as well as complications of this procedure were demonstrated. Remission of T2DM and co-morbidities resolution after one year were also analyzed. Results: The median duration of T2DM was 60 months and the median operative time was 140 min. Interestingly, the mean/median preoperative BMI, HbA1C and FPG levels dropped significantly from 30.7 kg/m2 , 8.9%, and 139.0 mg% to 23.7 kg/m2 , 6.2%, and 95.0 mg% respectively at 1 year after operation (p<0.001. Furthermore, 61.5% of patients who had completed 1 year follow-up showed complete diabetic remission and 92.3% experienced glycemic control (HbA1c<7% without any medication. The postoperative complications were intra-abdominal bleeding (4.4%, leakage (1.1%, stricture (3.3% and port site hernia (2.2%. Conclusion: LDJB-SG is a safe and feasible bariatric and metabolic surgery, which has demonstrated excellent outcomes in terms of weight reduction, co-morbidities resolution as well as glycemic control in short-term follow-up.

  4. Why can’t a woman bid more like a man?

    Czech Academy of Sciences Publication Activity Database

    Chen, Y.; Katuščák, Peter; Ozdenoren, E.

    -, č. 275 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : auction * gender * menstrual cycle * estrogen Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp275.pdf

  5. Mutually consistent thermodynamic potentials for fluid water, ice and seawater: a new standard for oceanography

    Czech Academy of Sciences Publication Activity Database

    Feistel, R.; Wright, D.G.; Miyagawa, K.; Harvey, A.H.; Hrubý, Jan; Jackett, D.R.; McDougall, T.J.; Wagner, W.

    2008-01-01

    Roč. 4, č. 4 (2008), s. 275-291 ISSN 1812-0784 Institutional research plan: CEZ:AV0Z20760514 Keywords : seawater * equation of state * metastable states Subject RIV: BJ - Thermodynamics www.ocean-sci.net/4/275/2008

  6. Seasonal variation in the flux of planktic foraminifera: Sediment trap results from the Bay of Bengal, Northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Guptha, M.V; Curry; Ittekkot, V; Muralinath, A.S.

    stream_size 15 stream_content_type text/plain stream_name J_Foramin_Res_27_5.pdf.txt stream_source_info J_Foramin_Res_27_5.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  7. 40th Annual Armament Systems: Guns-Ammunition-Rockets-Missiles Conference and Exhibition

    Science.gov (United States)

    2005-04-28

    PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S

  8. 2005 40th Annual Armament Systems Guns - Ammunition - Rockets - Missiles Conference and Exhibition. Volume 1: Tuesday

    Science.gov (United States)

    2005-04-28

    PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S

  9. 2005 40th Annual Armament Systems: Guns - Ammunition - Rockets - Missiles Conference and Exhibition. Volume 3: Wednesday

    Science.gov (United States)

    2005-04-28

    PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S

  10. Genetic and bibliographic information: KRT5 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available nd Neonatal Diseases and Abnormalities (C16) > Congenital Abnormalities (C16.131) > Skin Abnormalities (C16....ases, Inborn (C16.320) > Skin Diseases, Genetic (C16.320.850) > Epidermolysis Bullosa (C16.320.850.275) > Ep...idermolysis Bullosa Simplex (C16.320.850.275.180) Skin and Connective Tissue Diseases (C17) > Skin Diseases (C17.800) > Skin....493) > Epidermolysis Bullosa Simplex (C17.800.804.493.180) Skin and Connective Tissue Diseases (C17) > Skin Diseases (C17.800) > Ski...rmolysis Bullosa Simplex (C17.800.827.275.180) Skin and Connective Tissue Diseases (C17) > Skin

  11. Absorption properties of chromophoric dissolved organic matter (CDOM) in the East China Sea and the waters off eastern Taiwan

    Science.gov (United States)

    Zhou, Fengxia; Gao, Xuelu; Song, Jinming; Chen, Chen-Tung Arthur; Yuan, Huamao; Xing, Qianguo

    2018-05-01

    The absorption properties of chromophoric dissolved organic matter (CDOM) in the East China Sea (ECS) and the waters off eastern Taiwan (WET) were studied during May 2014. CDOM absorption coefficient (a280) and spectral slope (S275-295) revealed considerable spatial variations. In the ECS, the values of a280 and S275-295 presented a reverse distribution pattern. In the WET, a280 values were generally low while S275-295 values were generally high. Vertical distributions of a280 and S275-295 also varied in different regions. Terrestrial input, phytoplankton production, sediment release or photobleaching may be responsible for the dynamics of CDOM. Relationships among CDOM related parameters could partly support this conclusion. a280 were also used to trace different water masses and the result showed that the influence of Changjiang Diluted Water could reach the outer shelf of the northern ECS, and that the Kuroshio Current had a strong influence on the middle shelf of the southern ECS.

  12. Long-term mequindox treatment induced endocrine and reproductive toxicity via oxidative stress in male Wistar rats

    International Nuclear Information System (INIS)

    Ihsan, Awais; Wang Xu; Liu Zhaoying; Wang Yulian; Huang Xianju; Liu Yu; Yu Huan; Zhang Hongfei; Li Tingting; Yang Chunhui; Yuan Zonghui

    2011-01-01

    Mequindox (MEQ) is a synthetic antimicrobial chemical of quinoxaline 1, 4-dioxide group. This study was designed to investigate the hypothesis that MEQ exerts testicular toxicity by causing oxidative stress and steroidal gene expression profiles and determine mechanism of MEQ testicular toxicity. In this study, adult male Wistar rats were fed with MEQ for 180 days at five different doses as 0, 25, 55, 110 and 275 mg/kg, respectively. In comparison to control, superoxide dismutase (SOD), reduced glutathione (GSH) and 8-hydroxydeoxyguanosine (8-OHdG) levels were elevated at 110 and 275 mg/kg MEQ, whereas the malondialdehyde (MDA) level was slightly increase at only 275 mg/kg. Furthermore, in LC/MS-IT-TOF analysis, one metabolite 2-isoethanol 4-desoxymequindox (M11) was found in the testis. There was significant decrease in body weight, testicular weight and testosterone at 275 mg/kg, serum follicular stimulating hormone (FSH) at 110 and 275 mg/kg, while lutinizing hormone (LH) levels were elevated at 110 mg/kg. Moreover, histopathology of testis exhibited germ cell depletion, contraction of seminiferous tubules and disorganization of the tubular contents of testis. Compared with control, mRNA expression of StAR, P450scc and 17β-HSD in testis was significantly decreased after exposure of 275 mg/kg MEQ while AR and 3β-HSD mRNA expression were significantly elevated at the 110 mg/kg MEQ group. Taken together, our findings provide the first and direct evidence in vivo for the formation of free radicals during the MEQ metabolism through N → O group reduction, which may have implications to understand the possible mechanism of male infertility related to quinoxaline derivatives.

  13. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Southern... outlined in the SOCAL Range Complex Stranding Communication Plan, the Navy must notify NMFS immediately (or...

  14. 36 CFR 223.275 - Establishment of a pilot program.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Establishment of a pilot... Establishment of a pilot program. This subpart governs the Forest Service's pilot program for the disposal of... of Title III of H.R. 3423)), as amended in 2004 by Section 335 of Public Law 108-108. The pilot...

  15. 40 CFR 1065.275 - N2O measurement devices.

    Science.gov (United States)

    2010-07-01

    ... measurement devices. (a) General component requirements. We recommend that you use an analyzer that meets the... functions of other gaseous measurements and the engine's known or assumed fuel properties. The target value... gaseous measurements. The target value for any compensation algorithm is 0.0% (that is, no bias high and...

  16. 38 CFR 3.275 - Criteria for evaluating net worth.

    Science.gov (United States)

    2010-07-01

    ... such as to provide for education or training beyond age 23. (Authority: 38 U.S.C. 501) (f) Agent Orange... payment made from the Agent Orange Settlement Fund or any other fund established pursuant to the settlement in the In re Agent Orange product liability litigation, M.D.L. No. 381 (E.D.N.Y.). (January 1...

  17. All projects related to | Page 275 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-01

    A two-year grant will support research, analysis, and dialogue by Canadian civil society organizations to enhance their effectiveness. Start Date: January 1, 2012. End Date: January 1, 2014. Topic: SUSTAINABLE DEVELOPMENT, Poverty alleviation, Capacity building, HUMAN RIGHTS, POLICY MAKING, SOCIAL JUSTICE.

  18. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    Energy Technology Data Exchange (ETDEWEB)

    Kodera, Ryo, E-mail: kodera@cc.okayama-u.ac.jp [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Shikata, Kenichi [Center for Innovative Clinical Medicine, Okayama University Hospital, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Usui, Hitomi Kataoka [Department of Primary Care and Medical Education, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan); Makino, Hirofumi [Department of Medicine and Clinical Science, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, 2-5-1 Shikata-cho, Kita-ku, Okayama 700-8558 (Japan)

    2014-01-17

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose.

  19. Dipeptidyl peptidase-4 inhibitor ameliorates early renal injury through its anti-inflammatory action in a rat model of type 1 diabetes

    International Nuclear Information System (INIS)

    Kodera, Ryo; Shikata, Kenichi; Takatsuka, Tetsuharu; Oda, Kaori; Miyamoto, Satoshi; Kajitani, Nobuo; Hirota, Daisho; Ono, Tetsuichiro; Usui, Hitomi Kataoka; Makino, Hirofumi

    2014-01-01

    Highlights: •DPP-4 inhibitor decreased urinary albumin excretion in a rat of type 1 diabetes. •DPP-4 inhibitor ameliorated histlogical changes of diabetic nephropathy. •DPP-4 inhibitor has reno-protective effects through anti-inflammatory action. •DPP-4 inhibitor is beneficial on diabetic nephropathy besides lowering blood glucose. -- Abstract: Introduction: Dipeptidyl peptidase-4 (DPP-4) inhibitors are incretin-based drugs in patients with type 2 diabetes. In our previous study, we showed that glucagon-like peptide-1 (GLP-1) receptor agonist has reno-protective effects through anti-inflammatory action. The mechanism of action of DPP-4 inhibitor is different from that of GLP-1 receptor agonists. It is not obvious whether DPP-4 inhibitor prevents the exacerbation of diabetic nephropathy through anti-inflammatory effects besides lowering blood glucose or not. The purpose of this study is to clarify the reno-protective effects of DPP-4 inhibitor through anti-inflammatory actions in the early diabetic nephropathy. Materials and methods: Five-week-old male Sprague–Dawley (SD) rats were divided into three groups; non-diabetes, diabetes and diabetes treated with DPP-4 inhibitor (PKF275-055; 3 mg/kg/day). PKF275-055 was administered orally for 8 weeks. Results: PKF275-055 increased the serum active GLP-1 concentration and the production of urinary cyclic AMP. PKF275-055 decreased urinary albumin excretion and ameliorated histological change of diabetic nephropathy. Macrophage infiltration was inhibited, and inflammatory molecules were down-regulated by PKF275-055 in the glomeruli. In addition, nuclear factor-κB (NF-κB) activity was suppressed in the kidney. Conclusions: These results indicate that DPP-4 inhibitor, PKF275-055, have reno-protective effects through anti-inflammatory action in the early stage of diabetic nephropathy. The endogenous biological active GLP-1 might be beneficial on diabetic nephropathy besides lowering blood glucose

  20. Radiation dose reduction in soft tissue neck CT using adaptive statistical iterative reconstruction (ASIR)

    Energy Technology Data Exchange (ETDEWEB)

    Vachha, Behroze, E-mail: bvachha@partners.org [Neuroradiology Division, Massachusetts General Hospital, Harvard Medical School, 55 Fruit Street, Boston, MA 02114 (United States); Brodoefel, Harald; Wilcox, Carol; Hackney, David B.; Moonis, Gul [Department of Radiology, Beth Israel Deaconess Medical Center, Harvard Medical School, 330 Brookline Avenue, Boston, MA 02215 (United States)

    2013-12-01

    Purpose: To compare objective and subjective image quality in neck CT images acquired at different tube current–time products (275 mA s and 340 mA s) and reconstructed with filtered-back-projection (FBP) and adaptive statistical iterative reconstruction (ASIR). Materials and methods: HIPAA-compliant study with IRB approval and waiver of informed consent. 66 consecutive patients were randomly assigned to undergo contrast-enhanced neck CT at a standard tube-current–time-product (340 mA s; n = 33) or reduced tube-current–time-product (275 mA s, n = 33). Data sets were reconstructed with FBP and 2 levels (30%, 40%) of ASIR-FBP blending at 340 mA s and 275 mA s. Two neuroradiologists assessed subjective image quality in a blinded and randomized manner. Volume CT dose index (CTDIvol), dose-length-product (DLP), effective dose, and objective image noise were recorded. Signal-to-noise ratio (SNR) was computed as mean attenuation in a region of interest in the sternocleidomastoid muscle divided by image noise. Results: Compared with FBP, ASIR resulted in a reduction of image noise at both 340 mA s and 275 mA s. Reduction of tube current from 340 mA s to 275 mA s resulted in an increase in mean objective image noise (p = 0.02) and a decrease in SNR (p = 0.03) when images were reconstructed with FBP. However, when the 275 mA s images were reconstructed using ASIR, the mean objective image noise and SNR were similar to those of the standard 340 mA s CT images reconstructed with FBP (p > 0.05). Subjective image noise was ranked by both raters as either average or less-than-average irrespective of the tube current and iterative reconstruction technique. Conclusion: Adapting ASIR into neck CT protocols reduced effective dose by 17% without compromising image quality.

  1. Radiation dose reduction in soft tissue neck CT using adaptive statistical iterative reconstruction (ASIR)

    International Nuclear Information System (INIS)

    Vachha, Behroze; Brodoefel, Harald; Wilcox, Carol; Hackney, David B.; Moonis, Gul

    2013-01-01

    Purpose: To compare objective and subjective image quality in neck CT images acquired at different tube current–time products (275 mA s and 340 mA s) and reconstructed with filtered-back-projection (FBP) and adaptive statistical iterative reconstruction (ASIR). Materials and methods: HIPAA-compliant study with IRB approval and waiver of informed consent. 66 consecutive patients were randomly assigned to undergo contrast-enhanced neck CT at a standard tube-current–time-product (340 mA s; n = 33) or reduced tube-current–time-product (275 mA s, n = 33). Data sets were reconstructed with FBP and 2 levels (30%, 40%) of ASIR-FBP blending at 340 mA s and 275 mA s. Two neuroradiologists assessed subjective image quality in a blinded and randomized manner. Volume CT dose index (CTDIvol), dose-length-product (DLP), effective dose, and objective image noise were recorded. Signal-to-noise ratio (SNR) was computed as mean attenuation in a region of interest in the sternocleidomastoid muscle divided by image noise. Results: Compared with FBP, ASIR resulted in a reduction of image noise at both 340 mA s and 275 mA s. Reduction of tube current from 340 mA s to 275 mA s resulted in an increase in mean objective image noise (p = 0.02) and a decrease in SNR (p = 0.03) when images were reconstructed with FBP. However, when the 275 mA s images were reconstructed using ASIR, the mean objective image noise and SNR were similar to those of the standard 340 mA s CT images reconstructed with FBP (p > 0.05). Subjective image noise was ranked by both raters as either average or less-than-average irrespective of the tube current and iterative reconstruction technique. Conclusion: Adapting ASIR into neck CT protocols reduced effective dose by 17% without compromising image quality

  2. Radiation dose reduction in soft tissue neck CT using adaptive statistical iterative reconstruction (ASIR).

    Science.gov (United States)

    Vachha, Behroze; Brodoefel, Harald; Wilcox, Carol; Hackney, David B; Moonis, Gul

    2013-12-01

    To compare objective and subjective image quality in neck CT images acquired at different tube current-time products (275 mAs and 340 mAs) and reconstructed with filtered-back-projection (FBP) and adaptive statistical iterative reconstruction (ASIR). HIPAA-compliant study with IRB approval and waiver of informed consent. 66 consecutive patients were randomly assigned to undergo contrast-enhanced neck CT at a standard tube-current-time-product (340 mAs; n = 33) or reduced tube-current-time-product (275 mAs, n = 33). Data sets were reconstructed with FBP and 2 levels (30%, 40%) of ASIR-FBP blending at 340 mAs and 275 mAs. Two neuroradiologists assessed subjective image quality in a blinded and randomized manner. Volume CT dose index (CTDIvol), dose-length-product (DLP), effective dose, and objective image noise were recorded. Signal-to-noise ratio (SNR) was computed as mean attenuation in a region of interest in the sternocleidomastoid muscle divided by image noise. Compared with FBP, ASIR resulted in a reduction of image noise at both 340 mAs and 275 mAs. Reduction of tube current from 340 mAs to 275 mAs resulted in an increase in mean objective image noise (p=0.02) and a decrease in SNR (p = 0.03) when images were reconstructed with FBP. However, when the 275 mAs images were reconstructed using ASIR, the mean objective image noise and SNR were similar to those of the standard 340 mAs CT images reconstructed with FBP (p>0.05). Subjective image noise was ranked by both raters as either average or less-than-average irrespective of the tube current and iterative reconstruction technique. Adapting ASIR into neck CT protocols reduced effective dose by 17% without compromising image quality. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  3. HDAC I inhibition in the dorsal and ventral hippocampus differentially modulates predator-odor fear learning and generalization.

    Science.gov (United States)

    Yuan, Robin K; Hebert, Jenna C; Thomas, Arthur S; Wann, Ellen G; Muzzio, Isabel A

    2015-01-01

    Although predator odors are ethologically relevant stimuli for rodents, the molecular pathways and contribution of some brain regions involved in predator odor conditioning remain elusive. Inhibition of histone deacetylases (HDACs) in the dorsal hippocampus has been shown to enhance shock-induced contextual fear learning, but it is unknown if HDACs have differential effects along the dorso-ventral hippocampal axis during predator odor fear learning. We injected MS-275, a class I HDAC inhibitor, bilaterally in the dorsal or ventral hippocampus of mice and found that it had no effects on innate anxiety in either region. We then assessed the effects of MS-275 at different stages of fear learning along the longitudinal hippocampal axis. Animals were injected with MS-275 or vehicle after context pre-exposure (pre-conditioning injections), when a representation of the context is first formed, or after exposure to coyote urine (post-conditioning injections), when the context becomes associated with predator odor. When MS-275 was administered after context pre-exposure, dorsally injected animals showed enhanced fear in the training context but were able to discriminate it from a neutral environment. Conversely, ventrally injected animals did not display enhanced learning in the training context but generalized the fear response to a neutral context. However, when MS-275 was administered after conditioning, there were no differences between the MS-275 and vehicle control groups in either the dorsal or ventral hippocampus. Surprisingly, all groups displayed generalization to a neutral context, suggesting that predator odor exposure followed by a mild stressor such as restraint leads to fear generalization. These results may elucidate distinct functions of the dorsal and ventral hippocampus in predator odor-induced fear conditioning as well as some of the molecular mechanisms underlying fear generalization.

  4. 75 FR 33421 - Supplemental Nutrition Assistance Program: Quality Control Provisions of Title IV of Public Law...

    Science.gov (United States)

    2010-06-11

    ... most recent approval of OMB Number 0584- 0034, the form FNS-247 (Statistical Summary of Sample... change paragraph (a) of 7 CFR 275.1 into a general introductory paragraph, and to remove 7 CFR 275.23(d... paragraphs (b)(1) and (2), changing paragraph (a) into a general introductory paragraph, and removing 7 CFR...

  5. 7 CFR 3.91 - Adjusted civil monetary penalties.

    Science.gov (United States)

    2010-01-01

    ... articles not for monetary gain), $275,000 in the case of any other person for each violation, and $550,000... violation of the AHPA by an individual moving regulated articles not for monetary gain, $275,000 in the case... and a maximum of $550. (3) Food and Nutrition Service. (i) Civil penalty for hardship fine in lieu of...

  6. Microbial UV fluence-response assessment using a novel UV-LED collimated beam system.

    Science.gov (United States)

    Bowker, Colleen; Sain, Amanda; Shatalov, Max; Ducoste, Joel

    2011-02-01

    A research study has been performed to determine the ultraviolet (UV) fluence-response of several target non-pathogenic microorganisms to UV light emitting diodes (UV-LEDs) by performing collimated beam tests. UV-LEDs do not contain toxic mercury, offer design flexibility due to their small size, and have a longer operational life than mercury lamps. Comsol Multiphysics was utilized to create an optimal UV-LED collimated beam design based on number and spacing of UV-LEDs and distance of the sample from the light source while minimizing the overall cost. The optimized UV-LED collimated beam apparatus and a low-pressure mercury lamp collimated beam apparatus were used to determine the UV fluence-response of three surrogate microorganisms (Escherichia coli, MS-2, T7) to 255 nm UV-LEDs, 275 nm UV-LEDs, and 254 nm low-pressure mercury lamps. Irradiation by low-pressure mercury lamps produced greater E. coli and MS-2 inactivation than 255 nm and 275 nm UV-LEDs and similar T7 inactivation to irradiation by 275 nm UV-LEDs. The 275 nm UV-LEDs produced more efficient T7 and E. coli inactivation than 255 nm UV-LEDs while both 255 nm and 275 nm UV-LEDs produced comparable microbial inactivation for MS-2. Differences may have been caused by a departure from the time-dose reciprocity law due to microbial repair mechanisms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  7. Rapport de frais de 2017-2018 pour Uri Rosenthal | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Accueil · À propos du CRDI · Obligation de rendre compte · Transparence · Déplacements et accueil. Rapport de frais de 2017-2018 pour Uri Rosenthal. Total des frais de déplacement : CAD$7,275.54. Réunion du Conseil des gouverneurs. 19 juin 2017 au 21 juin 2017. CAD$7,275.54. Ce que nous faisons · Financement ...

  8. Wind Generated Ocean Waves

    DEFF Research Database (Denmark)

    Frigaard, Peter

    2001-01-01

    Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)......Book review: I. R. Young, Elsevier Ocean Engineering Series, Vol 2. Elsevier Science, Oxford, UK, 1999, 306 pages, hardbound, ISBN 0-08-043317-0, Dfl. 275,00 (US$ 139.50)...

  9. 2005 40th Annual Armament Systems: Guns - Ammunition - Rockets - Missiles Conference and Exhibition. Volume 2: Wednesday

    Science.gov (United States)

    2005-04-28

    PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S...Company Lead: Larry Bradford Atlantic Research Propellant Mixing/Loading, Nozzle Manufacturing, Corporation Motor Static Testing Company Lead: Steve

  10. Radio observations of the peripheral region of the Coma cluster near Coma A

    International Nuclear Information System (INIS)

    Giovannini, G.

    1986-01-01

    VLA and WSRT observations are reported for the extended radio source 1253+275 on the periphery of the Coma cluster and for two active Coma radio galaxies within 20 arcmin of 1253+275. The data are presented in contour maps and characterized in detail. Source 1253+275 is shown to be a relic radio galaxy with physical conditions similar to those seen in the external regions (30-50 kpc from the cores) of the two active sources (NGC 4789 and NGC 4827). It is suggested that these regions survived for long periods (400 Myr) after the last acceleration of the radiating electrons because transverse expansion was inhibited by the local intergalactic medium, which has a density comparable to that in other rich clusters of galaxies. 7 references

  11. Deposition temperature effect on electrical properties and interface of high-k ZrO{sub 2} capacitor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Joo-Hyung; Ignatova, Velislava A [Fraunhofer Institute, Center of Nanoelectronic Technologies (CNT), Koenigsbruecker Str., 01099 Dresden (Germany); Heitmann, Johannes; Oberbeck, Lars [Qimonda Dresden GmbH and Co. OHG, Koenigsbruecker Str. 180, 01099 Dresden (Germany)], E-mail: joo-hyung.kim@inha.ac.kr

    2008-09-07

    The electrical characteristics, i.e. leakage current and capacitance, of ZrO{sub 2} based metal-insulator-metal structures, grown at 225, 250 and 275 deg, C by atomic layer deposition, were studied. The lowest leakage current was obtained at 250 deg. C deposition temperature, while the highest dielectric constant (k {approx} 43) was measured for the samples grown at 275 {sup 0}C, most probably due to the formation of tetragonal/cubic phases in the ZrO{sub 2} layer. We have shown that the main leakage current of these ZrO{sub 2} capacitors is governed by the Poole-Frenkel conduction mechanism. It was observed by x-ray photoelectron spectroscopy depth profiling that at 275 {sup 0}C deposition temperature the oxygen content at and beyond the ZrO{sub 2}/TiN interface is higher than at lower deposition temperatures, most probably due to oxygen inter-diffusion towards the electrode layer, forming a mixed TiN-TiO{sub x}N{sub y} interface layer. At and above 275 deg. C the ZrO{sub 2} layer changes its structure and becomes crystalline as proven by XRD analysis. (fast track communication)

  12. Tunable zinc interstitial related defects in ZnMgO and ZnCdO films

    International Nuclear Information System (INIS)

    Li, Wanjun; Qin, Guoping; Fang, Liang; Ye, Lijuan; Wu, Fang; Ruan, Haibo; Zhang, Hong; Kong, Chunyang; Zhang, Ping

    2015-01-01

    We report tunable band gap of ZnO thin films grown on quartz substrates by radio frequency magnetron sputtering. The zinc interstitial (Zn i ) defects in ZnO films were investigated by X-ray diffraction, Raman scattering, Auger spectra, first-principle calculations, and Hall measurement. Undoped ZnO film exhibits an anomalous Raman mode at 275 cm −1 . We first report that 275 cm −1 mode also can be observed in ZnO films alloyed with Mg and Cd, whose Raman intensities, interestingly, decrease and increase with increasing Mg and Cd alloying content, respectively. Combined with the previous investigations, it is deduced that 275 cm −1 mode is attributed to Zn i related defects, which is demonstrated by our further experiment and theoretical calculation. Consequently, the concentration of Zn i related defects in ZnO can be tuned by alloying Mg and Cd impurity, which gives rise to different conductivity in ZnO films. These investigations help to further understand the controversial origin of the additional Raman mode at 275 cm −1 and also the natural n-type conductivity in ZnO

  13. Tunable zinc interstitial related defects in ZnMgO and ZnCdO films

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wanjun; Qin, Guoping [State Key Laboratory of Mechanical Transmission, College of Physics, Chongqing University, Chongqing 401331 (China); Key Laboratory of Optoelectronic Functional Materials of Chongqing, College of Physics and Electronic Engineering, Chongqing Normal University, Chongqing, Chongqing 401331 (China); Fang, Liang, E-mail: lfang@cqu.edu.cn, E-mail: kchy@163.com; Ye, Lijuan; Wu, Fang [State Key Laboratory of Mechanical Transmission, College of Physics, Chongqing University, Chongqing 401331 (China); Ruan, Haibo [Research Center for Materials Interdisciplinary Sciences, Chongqing University of Arts and Sciences, Chongqing 402160 (China); Zhang, Hong; Kong, Chunyang, E-mail: lfang@cqu.edu.cn, E-mail: kchy@163.com; Zhang, Ping [Key Laboratory of Optoelectronic Functional Materials of Chongqing, College of Physics and Electronic Engineering, Chongqing Normal University, Chongqing, Chongqing 401331 (China)

    2015-04-14

    We report tunable band gap of ZnO thin films grown on quartz substrates by radio frequency magnetron sputtering. The zinc interstitial (Zn{sub i}) defects in ZnO films were investigated by X-ray diffraction, Raman scattering, Auger spectra, first-principle calculations, and Hall measurement. Undoped ZnO film exhibits an anomalous Raman mode at 275 cm{sup −1}. We first report that 275 cm{sup −1} mode also can be observed in ZnO films alloyed with Mg and Cd, whose Raman intensities, interestingly, decrease and increase with increasing Mg and Cd alloying content, respectively. Combined with the previous investigations, it is deduced that 275 cm{sup −1} mode is attributed to Zn{sub i} related defects, which is demonstrated by our further experiment and theoretical calculation. Consequently, the concentration of Zn{sub i} related defects in ZnO can be tuned by alloying Mg and Cd impurity, which gives rise to different conductivity in ZnO films. These investigations help to further understand the controversial origin of the additional Raman mode at 275 cm{sup −1} and also the natural n-type conductivity in ZnO.

  14. 275 Proverbial Space and the Dialectics of Place and Displacement ...

    African Journals Online (AJOL)

    User

    2012-01-24

    . The current paper examines Adeniran's attempt at creating a large ... father's reasoning for sending her to relatives on their return to Nigeria is ― ... past, in memories of childhood, which is the only basis for a perdu, the home.

  15. People and things. CERN Courier, Jun 1987, v. 27(5)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-06-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events:; An International Conference on the Physics and Astrophysics of Quark-Gluon Plasma will be held from 8-12 February 1988 at the Tata Institute for Fundamental Research, Bombay, India. This year the Joliot-Curie School of Nuclear Physics, arranged jointly by the French National Institute of Nuclear and Particle Physics (IN2P3) and the Institute for Fundamental Research of the French Atomic Energy Commission, will be held at Maubuisson, Gironde (France) from 14-18 September. The Europhysics Conference on Control Systems for Experimental Physics, sponsored by the European Physics Society (EPS) and CERN, and organized by the EPS Inter divisional Group on Experimental Physics Control Systems, will be held in Villars-sur-Ollon, Switzerland, from 28 September to 2 October.

  16. 40 CFR 80.275 - How are allotments generated and used?

    Science.gov (United States)

    2010-07-01

    ...) During 2003 only, any domestic or foreign refiner who produces gasoline from crude oil may have the... credits under paragraph (a)(2) of this section. (2) If the average sulfur content of the gasoline produced... importers. (i) If the average sulfur content of the gasoline produced at a refinery is less than or equal to...

  17. People and things. CERN Courier, Jun 1987, v. 27(5)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events:; An International Conference on the Physics and Astrophysics of Quark-Gluon Plasma will be held from 8-12 February 1988 at the Tata Institute for Fundamental Research, Bombay, India. This year the Joliot-Curie School of Nuclear Physics, arranged jointly by the French National Institute of Nuclear and Particle Physics (IN2P3) and the Institute for Fundamental Research of the French Atomic Energy Commission, will be held at Maubuisson, Gironde (France) from 14-18 September. The Europhysics Conference on Control Systems for Experimental Physics, sponsored by the European Physics Society (EPS) and CERN, and organized by the EPS Inter divisional Group on Experimental Physics Control Systems, will be held in Villars-sur-Ollon, Switzerland, from 28 September to 2 October

  18. 78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes

    Science.gov (United States)

    2013-01-03

    ... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa... requested using the procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace...

  19. IAEA Newsbriefs. V. 12, no. 2(75). Apr-May 1997

    International Nuclear Information System (INIS)

    1997-01-01

    This issue gives brief information on the following topics: IAEA safeguards inspectorate granted broader rights, Conferences on nuclear liability, waste safety in early September, States set nuclear safety review meeting, Statements of IAEA Director General, Namibia joins anti-trafficking programme, Symposium on desalination in Republic of Korea, Energy issues on agenda of nuclear fuel cycle symposium in June, IAEA seminars and symposia this autumn, Recent IAEA publications, Atoms for animal health and productivity, Studying the past to learn about the future, Nuclear power status around the world, and other short information

  20. 7 CFR 275.23 - Determination of State agency program performance.

    Science.gov (United States)

    2010-01-01

    ... the strike (i.e., the issues surrounding the strike); (iii) The date(s) after the occurrence when..., in accordance with section 602 of the Hunger Prevention Act of 1988, which amended section 13(a)(1...

  1. 17 CFR 275.202(a)(11)-1 - Certain broker-dealers.

    Science.gov (United States)

    2010-04-01

    ... connection with providing financial planning services and: (i) Holds itself out generally to the public as a financial planner or as providing financial planning services; (ii) Delivers to the customer a financial... connection with financial planning services; or (3) Exercises investment discretion, as that term is defined...

  2. PM Raman fiber laser at 1679 nm

    DEFF Research Database (Denmark)

    Svane, Ask Sebastian; Rottwitt, Karsten

    2012-01-01

    We demonstrate a PM Raman fiber laser emitting light at 1679 nm. The laser has an slope efficiency of 67 % and an output power of more than 275mWwith a 27 pm linewidth.......We demonstrate a PM Raman fiber laser emitting light at 1679 nm. The laser has an slope efficiency of 67 % and an output power of more than 275mWwith a 27 pm linewidth....

  3. Autonomous and Connected Vehicles: A Law Enforcement Primer

    Science.gov (United States)

    2015-12-01

    parallel or back-in parking in Toyota Prius vehicles is one example currently marketed and in operation in the United States.275 Testing is on-going...ownership in a connected environment.276 275 “All-New Third Generation Toyota Prius Raises the Bar for...design-patterns-and- operational-concepts-tasks-28-42-115/. Toyota . “All-New Third Generation Toyota Prius Raises the Bar for Hybrid Vehicles— Again

  4. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  5. [Analysis of the mineral elements of Lactuca sativa under the condition of different spectral components].

    Science.gov (United States)

    Chen, Xiao-Li; Guo, Wen-Zhong; Xue, Xu-Zhang; Wang, Li-Chun; Li, Liang; Chen, Fei

    2013-08-01

    Mineral elements absorption and content of Lactuca sativa under different spectral component conditions were studied by ICP-AES technology. The results showed that: (1) For Lactuca sativa, the average proportion for Ca : Mg : K : Na : P was 5.5 : 2.5 : 2.3 : 1.5 : 1.0, the average proportion for Fe : Mn : Zn : Cu : B was 25.9 : 5.9 : 2.8 : 1.1 : 1.0; (2) The absorptions for K, P, Ca, Mg and B are the largest under the LED treatment R/B = 1 : 2.75, red light from fluorescent lamps and LED can both promote the absorptions of Fe and Cu; (3)The LED treatments exhibiting relatively higher content of mineral elements are R/B = 1 : 2.75 and R/W = 1 : 1 while higher dry matter accumulations are R/B = 1 : 2.75 and B/W = 1 : 1.

  6. High pressure-temperature electrical conductivity of magnesiowustite as a function of iron oxide concentration

    Science.gov (United States)

    Li, Xiaoyuan; Jeanloz, Raymond

    1990-01-01

    The electrical conductivity of (Mg, Fe)O magnesiowustite containing 9 and 27.5 mol pct FeO has been measured at simultaneously high pressures (30-32 GPa) and temperatures using a diamond anvil cell heated with a continuous wave Nd:YAG laser and an external resistance heater. The conductivity depends strongly on the FeO concentration at both ambient and high pressures. At the pressures and temperatures of about 30 GPa and 2000 K, conditions expected in the lower mantle, the magnesiowustite containing 27.5 percent FeO is 3 orders of magnitude more conductive than that containing 9 percent FeO. The activation energy of magnesiowustite decreases with increasing iron concentration from 0.38 (+ or - 0.09) eV at 9 percent FeO to 0.29 (+ or - 0.05) eV at 27.5 percent FeO.

  7. Study of {upsilon} family resonances in ultrarelativistic heavy ions collisions within the frame of the Alice experiment at CERN-LHC; Etude des resonances de la famille du {upsilon} dans les collisions d'ions lourds ultra-relativistes a 2.75 TeV/ nucleon et par faisceau sur l'experience Alice du LHC

    Energy Technology Data Exchange (ETDEWEB)

    Dumonteil, E

    2004-09-01

    Quantum Chromodynamics foresees, at high temperature and/or high energy density, a phase transition between hadronic matter and a phase where quarks and gluons are no more confined in the nucleons: the Quark Gluon Plasma (QGP). During the past fifteen years, a large experimental program has taken place at CERN and at BNL, to identify the QGP. ALICE is the LHC experiment dedicated to the study of the plasma via ultrarelativistic heavy ion collisions at 2.75 TeV/nucleon per beam. The measure of Upsilon's resonances suppression, a powerful signature of a deconfined medium, with the ALICE dimuon spectrometer, is the main topic of this thesis. The first part of the work aims at studying the multi-wires pad chambers of the dimuon arm, used to track the muons from resonances decays. The second part presents an in-beam alignment algorithm able to calculate the positions of the different chambers with a very good accuracy. Finally, the last part proposes a study to lead with the ALICE muon spectrometer, involving the measure of Upsilon and Upsilon's production ratio as a function of the transverse momentum. It has been showed that this study should allow to evidence the QGP and to extract some of its properties. (author)

  8. Monolithic all-PM femtosecond Yb-doped fiber laser using photonic bandgap fibers

    DEFF Research Database (Denmark)

    Liu, Xiaomin; Lægsgaard, Jesper; Turchinovich, Dmitry

    2009-01-01

    We present a monolithic Yb fiber laser, dispersion managed by an all-solid photonic bandgap fiber, and pulse compressed in a hollow-core photonic crystal fiber. The laser delivers 9 nJ, 275-fs long pulses at 1035 nm.......We present a monolithic Yb fiber laser, dispersion managed by an all-solid photonic bandgap fiber, and pulse compressed in a hollow-core photonic crystal fiber. The laser delivers 9 nJ, 275-fs long pulses at 1035 nm....

  9. Content and Composition of Branched-Chain Fatty Acids in Bovine Milk Are Affected by Lactation Stage and Breed of Dairy Cow.

    Science.gov (United States)

    Bainbridge, Melissa L; Cersosimo, Laura M; Wright, André-Denis G; Kraft, Jana

    2016-01-01

    Dairy products contain bioactive fatty acids (FA) and are a unique dietary source of an emerging class of bioactive FA, branched-chain fatty acids (BCFA). The objective of this study was to compare the content and profile of bioactive FA in milk, with emphasis on BCFA, among Holstein (HO), Jersey (JE), and first generation HO x JE crossbreeds (CB) across a lactation to better understand the impact of these factors on FA of interest to human health. Twenty-two primiparous cows (n = 7 HO, n = 7 CB, n = 8 JE) were followed across a lactation. All cows were fed a consistent total mixed ration (TMR) at a 70:30 forage to concentrate ratio. Time points were defined as 5 days in milk (DIM), 95 DIM, 185 DIM, and 275 DIM. HO and CB had a higher content of n-3 FA at 5 DIM than JE and a lower n-6:n-3 ratio. Time point had an effect on the n-6:n-3 ratio, with the lowest value observed at 5 DIM and the highest at 185 DIM. The content of vaccenic acid was highest at 5 DIM, yet rumenic acid was unaffected by time point or breed. Total odd and BCFA (OBCFA) were higher in JE than HO and CB at 185 and 275 DIM. Breed affected the content of individual BCFA. The content of iso-14:0 and iso-16:0 in milk was higher in JE than HO and CB from 95 to 275 DIM. Total OBCFA were affected by time point, with the highest content in milk at 275 DIM. In conclusion, HO and CB exhibited a higher content of several bioactive FA in milk than JE. Across a lactation the greatest content of bioactive FA in milk occurred at 5 DIM and OBCFA were highest at 275 DIM.

  10. Assessing the in vitro fitness of an oseltamivir-resistant seasonal A/H1N1 influenza strain using a mathematical model.

    Directory of Open Access Journals (Sweden)

    Benjamin P Holder

    2011-03-01

    Full Text Available In 2007, the A/Brisbane/59/2007 (H1N1 seasonal influenza virus strain acquired the oseltamivir-resistance mutation H275Y in its neuraminidase (NA gene. Although previous studies had demonstrated that this mutation impaired the replication capacity of the influenza virus in vitro and in vivo, the A/Brisbane/59/2007 H275Y oseltamivir-resistant mutant completely out-competed the wild-type (WT strain and was, in the 2008-2009 influenza season, the primary A/H1N1 circulating strain. Using a combination of plaque and viral yield assays, and a simple mathematical model, approximate values were extracted for two basic viral kinetics parameters of the in vitro infection. In the ST6GalI-MDCK cell line, the latent infection period (i.e., the time for a newly infected cell to start releasing virions was found to be 1-3 h for the WT strain and more than 7 h for the H275Y mutant. The infecting time (i.e., the time for a single infectious cell to cause the infection of another one was between 30 and 80 min for the WT, and less than 5 min for the H275Y mutant. Single-cycle viral yield experiments have provided qualitative confirmation of these findings. These results, though preliminary, suggest that the increased fitness success of the A/Brisbane/59/2007 H275Y mutant may be due to increased infectivity compensating for an impaired or delayed viral release, and are consistent with recent evidence for the mechanistic origins of fitness reduction and recovery in NA expression. The method applied here can reconcile seemingly contradictory results from the plaque and yield assays as two complementary views of replication kinetics, with both required to fully capture a strain's fitness.

  11. Spectrum of benign breast diseases

    International Nuclear Information System (INIS)

    Khanzada, T.W.; Samad, A.; Sushel, C.

    2009-01-01

    Objective: To determine the frequencies of various benign breast diseases (BBD) in female patients in three private hospitals of Hyderabad. Methodology: This is a prospective cohort study of all female patients visiting the surgical clinic with breast problems. This study was conducted at Isra University Hospital Hyderabad and two other private hospitals of Hyderabad over a period of about three years starting from March 2004 to February 2007. All female patients visiting the surgical clinic with breast problems were included in the study. Patients with obvious clinical features of malignancy or those who on work up were diagnosed as carcinoma were excluded from the study. Results: A total of 275 patients were included in the study. About 44% (120/275) patients belonged to third decade of life (age between: 21-30 years) followed by 33% from forth decade (age between: 31- 40 years). Fibroadenoma was the most common benign breast disease, seen in 27% (75/275) of patients, followed by fibrocystic disease seen in about 21% (57/275) patients. Conclusion: Benign Breast Diseases (BBD) are common problems in females of reproductive age. Fibroadenoma is the commonest of all benign breast disease in our set up mostly seen in second and third decade of life. Fibrocystic disease of the breast is the next common BBD whose incidence increases with increasing age. (author)

  12. A systematic examination of the relationship between CDOM and DOC for various inland waters across China

    OpenAIRE

    Song, Kaishan; Zhao, Ying; Wen, Zhidan; Ma, Jianhang; Shao, Tiantian; Fang, Chong; Shang, Yingxin

    2016-01-01

    Chromophoric dissolved organic matter (CDOM) plays a vital role in aquatic ecosystems. Strong relationship has been proven between CDOM and dissolved organic carbon (DOC), which set the basis for remote estimation of DOC with remote sensing data. An algorithm has been developed to retrieve DOC via CDOM absorption at 275 and 295 nm with coastal waters. However, the relationship between DOC and aCDOM(275) and aCDOM(295) for different types of inland waters are still not clear. Further, i...

  13. Development of depressive symptoms and depression during organizational change--a two-year follow-up study of civil servants

    DEFF Research Database (Denmark)

    Netterstrøm, Bo; Blønd, Morten; Nielsen, Martin

    2010-01-01

    On 1 January 2007, Denmark went through a major reorganization, where most of its 275 municipalities and 14 counties merged into larger units. Our study aimed to examine the development of depressive symptoms and incident depression among employees affected by this organizational change.......On 1 January 2007, Denmark went through a major reorganization, where most of its 275 municipalities and 14 counties merged into larger units. Our study aimed to examine the development of depressive symptoms and incident depression among employees affected by this organizational change....

  14. ASP53, a thermostable protein from Acacia erioloba seeds that protects target proteins against thermal denaturation

    CSIR Research Space (South Africa)

    Mtwisha, L

    2007-02-01

    Full Text Available ) and the Typha pollen D7 protein was found to stabilise sugar glasses in an in vitro system (Wolkers et al. 2001). The cupin family of proteins comprises a wide variety of proteins from both prokaryotes and eukaryotes and includes the seed storage proteins...–268. Garay-Arroyo A, Colmenero-Flores JM, Garciarrubio A, Covarrubias AA (2000) Highly hydrophilic proteins in prokaryotes and eukaryotes are common during conditions of water deficit. Journal of Biological Chemistry 275, 5668–5674. doi: 10.1074/jbc.275...

  15. Pengaruh Pemakaian Alat Pelindung Diri (Apd) terhadap Infeksi Cacing pada Pekerja Pengangkut Sampah di Dinas Kebersihan Pertamanan dan Pemakaman Kota Jambi

    OpenAIRE

    Martini, Martini; Darnas, Yessy

    2015-01-01

    Jambi city was categorized as a municipality (population 100,000 s / d 500,000), with an estimated waste generation of 2.75 liters / person / day. Based on the data of population, estimated waste generation is 470 902 inhabitants Jambi City x 2.75 liters / person / day = 1,294,981 liters / day equivalent to 1,295 m3 (equivalent to 518 tons / day).Jambi City Regional Regulation No.05 of 2007, has established a local work unit which services the cleanliness of parks and cemeteries. Among other ...

  16. : tous les projets | Page 275 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HIV, AIDS, PROPHYLAXIS, VACCINES, VACCINATION, Immunization, MEDICAL RESEARCH. Région: North of Sahara, South of Sahara, Namibia. Programme: Santé des mères et des enfants. Financement total : CA$ 1,677,537.00. Renforcement des capacités en vue d'essais en matière de prévention du VIH/sida ...

  17. 17 CFR 275.206(4)-3 - Cash payments for client solicitations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Cash payments for client... for client solicitations. (a) It shall be unlawful for any investment adviser required to be... client at the time of the solicitation or referral; or (iii) Other than a solicitor specified in...

  18. Effects of electromagnetic field of 33 and 275 kv influences on ...

    African Journals Online (AJOL)

    user

    2012-08-16

    Aug 16, 2012 ... vacant land beneath high voltage transmission lines to grow leaf ... Studies on suitability of vegetables beneath power lines ... analysis. Electromagnetic field strength measurement. Electric field (kV/m) and magnetic field (mT) reading were taken at ..... faint extra band at Rf 0.09 in lanes 4 (30 m), 5 (40 m), 6.

  19. Sud du Sahara | Page 275 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Animal products – particularly offal –, green vegetables and orange fruits and vegetables are the best sources of vitamin A. As a result, Tanzanians are severely deficient in this essential ... The Cultivate Africa's Future (CultiAF) Fund runs eight projects that are supporting the development and testing of 24 innovations.

  20. Shock wave treatment in medicine; J. Biosci. 30 269–275

    Indian Academy of Sciences (India)

    Unknown

    269. Keywords. Acoustical energy; electromagnetic field; piezoelectric effect; shock wave ... life without being noticed. The sound of ... A typical pressure profile of a shock wave in the focus of an ... shock waves create low side effects on the way through muscles, fat- ... luation of the ESWT for orthopedic diseases many clini-.

  1. MicroSISAK for the chemistry of the heaviest elements

    International Nuclear Information System (INIS)

    Hild, Daniel

    2012-01-01

    This thesis describes experiments with an apparatus called MicroSISAK which is able to perform liquid-liquid-extraction on a microliter-scale. Two immiscible liquids are mixed in a microstructured mixer unit and separated again via a Teflon membrane. In the first experiments, different extraction systems were explored for elements of the groups 4 and 7 of the periodic table. Their results were compared with those from batch experiments. The initial achieved extraction yields were insufficient for the envisaged experiments, for which reason different modifications were arranged to obtain improvements. With the aid of a heating element, which was connected to the MicroSISAK apparatus, one was able to rise the temperature for the extraction inside. This led to the expected increasing of the extraction yield. Furthermore the MikroSISAK apparatus was modified by the Institut fuer Mikrotechnik Mainz, which had developed and constructed this apparatus. The contact time of the two phases between the mixer and the separation unit was extended. This also led to an increased yield. Now the performance appeared to be sufficient to connect the apparatus to the TRIGAreactor Mainz to perform online-experiments. Fission products (technetium) produced in a nuclear reaction were guided to the MicroSISAK apparatus to separate them and to detect their decay in a γ-ray detector. Apart from the successful separations, the experiments also proved the functionality of a new degasser system and that an adequate detection system can be coupled to MicroSISAK. With this, the prerequisites for the vision of an application of MicroSISAK are realised: The investigation of the chemical properties of short-lived superheavy elements (SHE) at a heavy-ion accelerator. It is obvious to plan such an experiment for the heavy homolog of technetium, element 107, bohrium.

  2. PRODUCTION AND POSTHARVEST QUALITY OF IRRIGATED PASSION FRUIT AFTER N-K FERTILIZATION

    Directory of Open Access Journals (Sweden)

    DANIEL GONÇALVES DIAS

    2017-08-01

    Full Text Available ABSTRACT Studies with nitrogen and potassium in yellow passion fruit cultivars with high yield potential are scarce in semiarid regions. The aim of this study was to evaluate the influence the N and K doses on productivity and fruit quality of different passion fruit cultivars in irrigated conditions in the northern of Minas Gerais state. The study was installed at experimental farm located in Janaúba-MG. This area was located at 15º 47’ S and 43º 18’ W, 516 m above sea level. The experiment was in completely randomized block with four replications, arranged in 4 x 6 factorial design consisting of four Passion Fruit cultivars (BRS Sol do Cerrado, BRS Ouro Vermelho, BRS Gigante Amarelo, IAC 275 and six N and K doses, which corresponded to 0-0, 50-125, 100-250, 150-375, 200 -500 and 250-625 kg ha-1 yr-1 of N and K2O, respectively. BRS Gigante Amarelo and BRS Sol do Cerrado cultivars showed higher productivity. Total fruit yield and average fruit weight were higher for BRS Sol do Cerrado and IAC 275, BRS Gigante Amarelo and BRS Ouro Vermelho cultivars, respectively. IAC 275 showed the highest pulp yield and along with BRS Sol do Cerrado, showed the higher soluble solids/titratable acidity ratio. BRS Sol do Cerrado, BRS Gigante Amarelo and IAC 275 cultivars showed higher pulp productivity, indicating that they are more promising for passion fruit juice industry.

  3. Heat load and deuterium plasma effects on SPS and WSP tungsten

    Czech Academy of Sciences Publication Activity Database

    Vilémová, Monika; Matějíček, Jiří; Nevrlá, Barbara; Chernyshova, M.; Gasior, P.; Kowalska-Strzeciwilk, E.; Jäger, Aleš

    2015-01-01

    Roč. 60, č. 2 (2015), s. 275-283 ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA ČR(CZ) GA14-12837S Institutional support: RVO:61389021 ; RVO:68378271 Keywords : Tungsten * fusion * heat loading * irradiation * bubbles * surface damage Subject RIV: JJ - Other Materials; JJ - Other Materials (FZU-D) Impact factor: 0.546, year: 2015 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p275f.pdf

  4. Metabolic and Lifestyle Predictors of Ischemic Heart Disease and All-Cause Mortality Among Normal Weight, Overweight, and Obese Men: A 16-Year Follow-up in the Copenhagen Male Study

    DEFF Research Database (Denmark)

    Suadicani, P.; Hein, H.O.; Eyben, F.E. von

    2009-01-01

    . Potential risk factors: These were blood pressure, diabetes, fasting serum triglycerides (TGs) and high-density lipoprotein cholesterol (HDL-C), low-density lipoprotein cholesterol (LDL-C), glucosuria, cancer, body mass index (BMI), alcohol, tobacco, leisure-time physical activity, social class, and age...... diabetes/glucosuria were the strongest risk factors of ACM among men with a BMI = 27.5 as well as men with a BMI > 27.5. Conclusion: The importance of risk factors for IHD mortality, in particular serum TG and serum HDL-C, depends on BMI Udgivelsesdato: 2009/4...

  5. Combustion Characteristics of Torrefied Wood Samples of Pinus Carrebea and Leucaena Leucocephala Grown in Nigeria

    Directory of Open Access Journals (Sweden)

    Francis Akinyele FARUWA

    2016-12-01

    Full Text Available Torrefaction of selected wood samples of Pinus Carrebea and Leucaena Leucocephala were carried out at temperatures ranging from 200 to 300°C to improve the energy parameters of biomass and to determine the effect of torrefication temperature on the physical and combustion properties of wood selected from Pinus carrebea and Leuceanea leucocephala grown in Nigeria. In this process the biomass hemicellulose is degraded, maintaining its cellulose and lignin content. The samples were dried and heated to 225, 250, 275, and 300°C. Then the torrefied mass was subjected to basic property testing on proximate analysis and heating value was calculated in order to understand the differences between raw material and its torrefied products. Specifically, the wood blocks changed from light brown to black, stemming from the partial carbonization at the wood surface. When the temperature is 225°C, the color of the wood is between dark brown and once the torrefaction temperatures are 250 and 275°C, the colors of the wood become dark and darker respectively. The results of the proximate analysis also showed that increasing of torrefied temperature; volatile fraction was reduced while fixed carbon was increased with increase in temperature from 21.34 to 52.74 and 18.58 to 56.83 for Leucaena leucocephala and Pinus carreabeanus respectively at 225 to 300°C. The volatile content is decreased from 78.58% to 62.76% with increase in temperature. Ash content of were within 1.57-3.41% of torrefied wood. It could be observed that the High calorific value (HCV for pine ranged between 19.80 and 28.06MJ/Kg for the top, 19.93and 24.96MJ/kg for middle with 19.72and 25.96MJ/Kg for base. The values recorded for raw sample and at 275°C been the lowest and highest respectively. The High calorific value (HCV were found to be on the increase and nose dive at 300°C for the tree parts used in this research. The result revealed that for Leuceana the value increased from raw up to

  6. COMBUSTION CHARACTERISTICS OF TORREFIED WOOD SAMPLES OF PINUS CARREBEA AND LEUCAENA LEUCOCEPHALA GROWN IN NIGERIA

    Directory of Open Access Journals (Sweden)

    Joseph Adeola FUWAPE

    2016-12-01

    Full Text Available Torrefaction of selected wood samples of Pinus Carrebea and Leucaena Leucocephala were carried out at temperatures ranging from 200 to 300°C to improve the energy parameters of biomass and to determine the effect of torrefication temperature on the physical and combustion properties of wood selected from Pinus carrebea and Leuceanea leucocephala grown in Nigeria. In this process the biomass hemicellulose is degraded, maintaining its cellulose and lignin content. The samples were dried and heated to 225, 250, 275, and 300°C. Then the torrefied mass was subjected to basic property testing on proximate analysis and heating value was calculated in order to understand the differences between raw material and its torrefied products. Specifically, the wood blocks changed from light brown to black, stemming from the partial carbonization at the wood surface. When the temperature is 225°C, the color of the wood is between dark brown and once the torrefaction temperatures are 250 and 275°C, the colors of the wood become dark and darker respectively. The results of the proximate analysis also showed that increasing of torrefied temperature; volatile fraction was reduced while fixed carbon was increased with increase in temperature from 21.34 to 52.74 and 18.58 to 56.83 for Leucaena leucocephala and Pinus carreabeanus respectively at 225 to 300°C. The volatile content is decreased from 78.58% to 62.76% with increase in temperature. Ash content of were within 1.57-3.41% of torrefied wood. It could be observed that the High calorific value (HCV for pine ranged between 19.80 and 28.06MJ/Kg for the top, 19.93and 24.96MJ/kg for middle with 19.72and 25.96MJ/Kg for base. The values recorded for raw sample and at 275°C been the lowest and highest respectively. The High calorific value (HCV were found to be on the increase and nose dive at 300°C for the tree parts used in this research. The result revealed that for Leuceana the value increased from raw up to

  7. Prolonged influenza virus shedding and emergence of antiviral resistance in immunocompromised patients and ferrets.

    Directory of Open Access Journals (Sweden)

    Erhard van der Vries

    Full Text Available Immunocompromised individuals tend to suffer from influenza longer with more serious complications than otherwise healthy patients. Little is known about the impact of prolonged infection and the efficacy of antiviral therapy in these patients. Among all 189 influenza A virus infected immunocompromised patients admitted to ErasmusMC, 71 were hospitalized, since the start of the 2009 H1N1 pandemic. We identified 11 (15% cases with prolonged 2009 pandemic virus replication (longer than 14 days, despite antiviral therapy. In 5 out of these 11 (45% cases oseltamivir resistant H275Y viruses emerged. Given the inherent difficulties in studying antiviral efficacy in immunocompromised patients, we have infected immunocompromised ferrets with either wild-type, or oseltamivir-resistant (H275Y 2009 pandemic virus. All ferrets showed prolonged virus shedding. In wild-type virus infected animals treated with oseltamivir, H275Y resistant variants emerged within a week after infection. Unexpectedly, oseltamivir therapy still proved to be partially protective in animals infected with resistant virus. Immunocompromised ferrets offer an attractive alternative to study efficacy of novel antiviral therapies.

  8. Glass formation, magnetic properties and magnetocaloric effect of ternary Ho–Al–Co bulk metallic glass

    International Nuclear Information System (INIS)

    Zhang, Huiyan; Li, Ran; Ji, Yunfei; Liu, Fanmao; Luo, Qiang; Zhang, Tao

    2012-01-01

    A ternary Ho–Al–Co system with high glass-forming ability (GFA) was developed and fully glassy rods with diameters up to 1 cm can be produced for the best glass former of Ho 55 Al 27.5 Co 17.5 alloy. The thermal stability and low-temperature magnetic properties of the Ho 55 Al 27.5 Co 17.5 bulk metallic glass (BMG) were studied. The magnetic transition temperature of this alloy is ∼14 K as determined by the thermomagnetic measurement. Two indicators, i.e. isothermal magnetic entropy change (ΔS M ) and the relative cooling power (RCP), were adopted to evaluate the magnetocaloric effect (MCE) of the alloy under a low magnetic field up to 2 T, which can be generated by permanent magnets. The values of |ΔS M | and RCP are 7.98 J kg −1 K −1 and 191.5 J kg −1 , respectively. The Ho 55 Al 27.5 Co 17.5 BMG with good MCE and high GFA provides an attractive candidate for magnetic refrigeration applications, like hydrogen liquefaction and storage. - Highlights: ► A ternary Ho–Al–Co BMG system with high glass-forming ability was developed. ► Fully glassy rods of Ho 55 Al 27.5 Co 17.5 alloy were produced up to 1 cm in diameter. ► The thermal stability and magnetic properties of the BMG were evaluated. ► The BMG exhibits good magnetocaloric effect under a low magnetic field up to 2 T.

  9. Accurate thermodynamic characterization of a synthetic coal mine methane mixture

    International Nuclear Information System (INIS)

    Hernández-Gómez, R.; Tuma, D.; Villamañán, M.A.; Mondéjar, M.E.; Chamorro, C.R.

    2014-01-01

    Highlights: • Accurate density data of a 10 components synthetic coal mine methane mixture are presented. • Experimental data are compared with the densities calculated from the GERG-2008 equation of state. • Relative deviations in density were within a 0.2% band at temperatures above 275 K. • Densities at 250 K as well as at 275 K and pressures above 10 MPa showed higher deviations. -- Abstract: In the last few years, coal mine methane (CMM) has gained significance as a potential non-conventional gas fuel. The progressive depletion of common fossil fuels reserves and, on the other hand, the positive estimates of CMM resources as a by-product of mining promote this fuel gas as a promising alternative fuel. The increasing importance of its exploitation makes it necessary to check the capability of the present-day models and equations of state for natural gas to predict the thermophysical properties of gases with a considerably different composition, like CMM. In this work, accurate density measurements of a synthetic CMM mixture are reported in the temperature range from (250 to 400) K and pressures up to 15 MPa, as part of the research project EMRP ENG01 of the European Metrology Research Program for the characterization of non-conventional energy gases. Experimental data were compared with the densities calculated with the GERG-2008 equation of state. Relative deviations between experimental and estimated densities were within a 0.2% band at temperatures above 275 K, while data at 250 K as well as at 275 K and pressures above 10 MPa showed higher deviations

  10. CDOM-DOC relationship in contrasted coastal waters: implication for DOC retrieval from ocean color remote sensing observation.

    Science.gov (United States)

    Vantrepotte, Vincent; Danhiez, François-Pierre; Loisel, Hubert; Ouillon, Sylvain; Mériaux, Xavier; Cauvin, Arnaud; Dessailly, David

    2015-01-12

    Increasing our knowledge on dissolved organic carbon (DOC) spatio-temporal distribution in the coastal ocean represents a crucial challenge for better understanding the role of these ecosystems in the global oceanic carbon cycle. The assessment of DOC concentration from the absorption properties of the colored part of the dissolved organic matter (a(cdom)) was investigated from an extensive data set covering a variety of coastal environments. Our results confirmed that variation in the a(cdom)(412) to DOC ratio (a*(cdom)(412)) can be depicted from the CDOM spectral slope in the UV domain (S(275-295)). They also evidenced that regional first order variation in both a*(cdom)(412) and S(275-295) are highly correlated to variation in a(cdom)(412). From these observations, generalized relationships for estimating a*(cdom)(412) from S(275-295) or a(cdom)(412) were parameterized from our development sites (N = 158; English Channel, French Guiana, Hai Phong Bay) and tested against an independent data set covering others coastal regions (N = 223; French Polynesia, Rhone River estuary, Gulf of Maine, Chesapeake Bay, Southern Middle Atlantic Bight) demonstrating the possibility to derive DOC estimates from in situ CDOM optical properties with an average accuracy of ~16% over very contrasted coastal environments (with DOC ranging from 50 to 250 µmol.L(-1)). The applicability of these generalized approaches was evaluated in the context of ocean color remote sensing observation emphasizing the limits of S(275-295)-based formulations and the potential for a(cdom)-based approaches to represent a compelling alternative for assessing synoptic DOC distribution.

  11. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available oup ... O1) ... Length = 67 ... Query: 216 MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEE...CNQIIS 275 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS Sbjct: 1 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS 60 ...

  12. Very Bright CV discovered by MASTER-ICATE (Argentina)

    Science.gov (United States)

    Saffe, C.; Levato, H.; Mallamaci, C.; Lopez, C.; Lipunov, F. Podest V.; Denisenko, D.; Gorbovskoy, E.; Tiurina, N.; Balanutsa, P.; Kornilov, V.; Belinski, A.; Shatskiy, N.; Chazov, V.; Kuznetsov, A.; Yecheistov, V.; Yurkov, V.; Sergienko, Y.; Varda, D.; Sinyakov, E.; Gabovich, A.; Ivanov, K.; Yazev, S.; Budnev, N.; Konstantinov, E.; Chuvalaev, O.; Poleshchuk, V.; Gress, O.; Frolova, A.; Krushinsky, V.; Zalozhnih, I.; Popov, A.; Bourdanov, A.; Parkhomenko, A.; Tlatov, A.; Dormidontov, D.; Senik, V.; Podvorotny, P.; Shumkov, V.; Shurpakov, S.

    2013-06-01

    MASTER-ICATE very wide-field camera (d=72mm f/1.2 lens + 11 Mpix CCD) located near San Juan, Argentina has discovered OT source at (RA, Dec) = 14h 20m 23.5s -48d 55m 40s on the combined image (exposure 275 sec) taken on 2013-06-08.048 UT. The OT unfiltered magnitude is 12.1m (limit 13.1m). There is no minor planet at this place. The OT is seen in more than 10 images starting from 2013-06-02.967 UT (275 sec exposure) when it was first detected at 12.4m.

  13. Algorithm Development and Validation of CDOM Properties for Estuarine and Continental Shelf Waters Along the Northeastern U.S. Coast

    Science.gov (United States)

    Mannino, Antonio; Novak, Michael G.; Hooker, Stanford B.; Hyde, Kimberly; Aurin, Dick

    2014-01-01

    An extensive set of field measurements have been collected throughout the continental margin of the northeastern U.S. from 2004 to 2011 to develop and validate ocean color satellite algorithms for the retrieval of the absorption coefficient of chromophoric dissolved organic matter (aCDOM) and CDOM spectral slopes for the 275:295 nm and 300:600 nm spectral range (S275:295 and S300:600). Remote sensing reflectance (Rrs) measurements computed from in-water radiometry profiles along with aCDOM() data are applied to develop several types of algorithms for the SeaWiFS and MODIS-Aqua ocean color satellite sensors, which involve least squares linear regression of aCDOM() with (1) Rrs band ratios, (2) quasi-analytical algorithm-based (QAA based) products of total absorption coefficients, (3) multiple Rrs bands within a multiple linear regression (MLR) analysis, and (4) diffuse attenuation coefficient (Kd). The relative error (mean absolute percent difference; MAPD) for the MLR retrievals of aCDOM(275), aCDOM(355), aCDOM(380), aCDOM(412) and aCDOM(443) for our study region range from 20.4-23.9 for MODIS-Aqua and 27.3-30 for SeaWiFS. Because of the narrower range of CDOM spectral slope values, the MAPD for the MLR S275:295 and QAA-based S300:600 algorithms are much lower ranging from 9.9 and 8.3 for SeaWiFS, respectively, and 8.7 and 6.3 for MODIS, respectively. Seasonal and spatial MODIS-Aqua and SeaWiFS distributions of aCDOM, S275:295 and S300:600 processed with these algorithms are consistent with field measurements and the processes that impact CDOM levels along the continental shelf of the northeastern U.S. Several satellite data processing factors correlate with higher uncertainty in satellite retrievals of aCDOM, S275:295 and S300:600 within the coastal ocean, including solar zenith angle, sensor viewing angle, and atmospheric products applied for atmospheric corrections. Algorithms that include ultraviolet Rrs bands provide a better fit to field measurements than

  14. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... fischeri ES114] ... Length = 67 ... Query: 216 MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIK...DTEECNEIIG 275 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEEC...NEIIG Sbjct: 1 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEECNEIIG 60 ...

  15. 32 CFR Appendix D to Part 275 - Obtaining Access By Search Warrant

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT... of Criminal Procedure. B. Unless a delay of notice has been obtained under provisions of Appendix H... following purpose: [state purpose]. You may have rights under the Right to Financial Privacy Act of 1978.” C...

  16. Voice Biometrics over the Internet in the Framework of COST Action 275

    Directory of Open Access Journals (Sweden)

    Evans Nicholas WD

    2004-01-01

    Full Text Available The emerging field of biometric authentication over the Internet requires both robust person authentication and secure computer network protocols. This paper presents investigations of vocal biometric person authentication over the Internet, both at the protocol and authentication robustness levels. As part of this study, an appropriate client-server architecture for biometrics on the Internet is proposed and implemented. It is shown that the transmission of raw biometric data in this application is likely to result in unacceptably long delays in the process. On the other hand, by using data models (or features, the transmission time can be reduced to an acceptable level. The use of encryption/decryption for enhancing the data security in the proposed client-server link and its effects on the transmission time are also examined. Furthermore, the scope of the investigations includes an analysis of the effects of packet loss and speech coding on speaker verification performance. It is experimentally demonstrated that whilst the adverse effects of packet loss can be negligible, the encoding of speech, particularly at a low bit rate, can reduce the verification accuracy considerably. The paper details the experimental investigations conducted and presents an analysis of the results.

  17. 32 CFR Appendix K to Part 275 - Format for Formal Written Request

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO FINANCIAL PRIVACY ACT... section 3402(5) and section 3408 of the Right to Financial Privacy Act of 1978, 12 U.S.C. 3401 et. seq., and [cite Component's implementation of this Part], you are requested to provide the following account...

  18. Strategic Defense Initiative: Splendid Defense or Pipe Dream? Headline Series No. 275.

    Science.gov (United States)

    Armstrong, Scott; Grier, Peter

    This pamphlet presents a discussion of the various components of President Reagan's Strategic Defense Initiative (SDI) including the problem of pulling together various new technologies into an effective defensive system and the politics of the so-called "star wars" system. An important part of the defense initiative is the…

  19. 32 CFR Appendix A to Part 275 - Obtaining Basic Identifying Account Information

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Basic Identifying Account Information... Information A. A DoD law enforcement office may issue a formal written request for basic identifying account... only the above specified basic identifying information concerning a customer's account. C. A format for...

  20. Anisotropy of the cosmic blackbody radiation.

    Science.gov (United States)

    Wilkinson, D T

    1986-06-20

    The universe is filled with thermal radiation having a current temperature of 2.75 K. Originating in the very early universe, this radiation furnishes strong evidence that the Big Bang cosmology best describes our expanding universe from an incredibly hot, compacted early stage until now. The model can be used to extrapolate our physics backward in time to predict events whose effects might be observable in the 2.75 K radiation today. The spectrum and isotropy are being studied with sophisticated microwave radiometers on the ground, in balloons, and in satellites. The results are as predicted by the simple theory: the spectrum is that of a blackbody (to a few percent) and the radiation is isotropic (to 0.01 percent) except for a local effect due to our motion through the radiation. However, a problem is emerging. Primordial fluctuations in the mass density, which later became the great clusters of galaxies that we see today, should have left an imprint on the 2.75 K radiation-bumpiness on the sky at angular scales of about 10 arc minutes. They have not yet been seen.

  1. Multidimensional modeling of the effect of fuel injection pressure on temperature distribution in cylinder of a turbocharged DI diesel engine

    Directory of Open Access Journals (Sweden)

    Sajjad Emami

    2013-06-01

    Full Text Available In this study, maintaining a constant fuel rate, injection pressure of 275 bar to 1000 bar (275×102 kPa to 1000×102 kPa, has been changed. Effect of injection pressure, the pressure inside the cylinder on the free energy, power, engine indicators, particularly indicators of fuel consumption, pollutants and their effects on parameters affecting the output of the engine combustion chamber have been studied in droplet diameter. Finally, the effects of fuel mixture equivalence, Cantor temperature, soot and NOx due to the increase of injection pressure, engine efficiency and emissions have been examined.

  2. Effects of irradiation at low temperature on V-4Cr-4Ti

    International Nuclear Information System (INIS)

    Alexander, D.J.; Snead, L.L.; Zinkle, S.J.

    1996-01-01

    Irradiation at low temperatures (100 to 275 degrees C) to 0.5 dpa causes significant embrittlement and changes in the subsequent room temperature tensile properties of V-4Cr-4Ti. The yield strength and microhardness at room temperature increase with increasing irradiation temperature. The tensile flow properties at room temperature show large increases in strength and a complete loss of work hardening capacity with no uniform ductility. Embrittlement, as measured by an increase in the ductile-to-brittle transition temperature, increases with increasing irradiation temperature, at least up to 275 degrees C. This embrittlement is not due to pickup of O or other interstitial solutes during the irradiation

  3. Effects of irradiation at low temperature on V-4Cr-4Ti

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, D.J.; Snead, L.L.; Zinkle, S.J. [Oak Ridge National Lab., TN (United States)] [and others

    1996-10-01

    Irradiation at low temperatures (100 to 275{degrees}C) to 0.5 dpa causes significant embrittlement and changes in the subsequent room temperature tensile properties of V-4Cr-4Ti. The yield strength and microhardness at room temperature increase with increasing irradiation temperature. The tensile flow properties at room temperature show large increases in strength and a complete loss of work hardening capacity with no uniform ductility. Embrittlement, as measured by an increase in the ductile-to-brittle transition temperature, increases with increasing irradiation temperature, at least up to 275{degrees}C. This embrittlement is not due to pickup of O or other interstitial solutes during the irradiation.

  4. Equivalent model and power flow model for electric railway traction network

    Science.gov (United States)

    Wang, Feng

    2018-05-01

    An equivalent model of the Cable Traction Network (CTN) considering the distributed capacitance effect of the cable system is proposed. The model can be divided into 110kV side and 27.5kV side two kinds. The 110kV side equivalent model can be used to calculate the power supply capacity of the CTN. The 27.5kV side equivalent model can be used to solve the voltage of the catenary. Based on the equivalent simplified model of CTN, the power flow model of CTN which involves the reactive power compensation coefficient and the interaction of voltage and current, is derived.

  5. Pro-inflammatory Cytokine Response and Genetic Diversity in Merozoite Surface Protein 2 of Plasmodium falciparum Isolates from Nigeria.

    Science.gov (United States)

    Ajibaye, Olusola; Osuntoki, Akinniyi A; Ebuehi, Albert Ot; Iwalokun, Bamidele A; Balogun, Emmanuel O; Egbuna, Kathleen N

    2017-01-01

    Polymorphisms in Plasmodium falciparum merozoite surface protein-2 ( msp -2) and associated parasite genetic diversity which varies between malaria-endemic regions remain a limitation in malaria vaccine development. Pro-inflammatory cytokines are important in immunity against malaria, understanding the influence of genetic diversity on cytokine response is important for effective vaccine design. P. falciparum isolates obtained from 300 Nigerians with uncomplicated falciparum malaria at Ijede General Hospital, Ijede (IJE), General Hospital Ajeromi, Ajeromi (AJE) and Saint Kizito Mission Hospital, Lekki, were genotyped by nested polymerase chain reaction of msp -2 block 3 while ELISA was used to determine the pro-inflammatory cytokine response to describe the genetic diversity of P. falciparum . Eighteen alleles were observed for msp -2 loci. Of the 195 isolates, 61 (31.0%) had only FC27-type alleles, 38 (19.7%) had only 3D7-type alleles, and 49.3% had multiple parasite lines with both alleles. Band sizes were 275-625 bp for FC27 and 150-425 bp for 3D7. Four alleles were observed from LEK, 2 (375-425 bp) and 2 (275-325 bp) of FC27-and 3D7-types, respectively; 12 alleles from AJE, 9 (275-625 bp) and 3 (325-425 bp) of FC27-types and 3D7-types, respectively; while IJE had a total of 12 alleles, 9 (275-625 bp) and 3 (325-425 bp) of FC27-types and 3D7-types, respectively. Mean multiplicity of infection (MOI) was 1.54. Heterozygosity ( H E ) ranged from 0.77 to 0.87 and was highest for IJE (0.87). Cytokine response was higher among 0.05) but with neither parasite density nor infection type. P. falciparum genetic diversity is extensive in Nigeria, protection via pro-inflammatory cytokines have little or no interplay with infection multiplicity.

  6. Application of automatic tube current modulation with 64-detector CT in infant brain

    International Nuclear Information System (INIS)

    Li Jianming; Xu Wenbiao; Luo Yuanli; Liu Hongsheng; Zhou Ning

    2010-01-01

    Objective: To evaluate the effect of automatic tube modulation on imaging quality and lesion revealed in infant brain. Methods: The infant patients of 200 cases were divided into four groups according to the values of SD (2.5, 2.75, 3.0, 4.0), 50 cases in each group. They were performed with the automatic tube current modulation scanning in brain. The imaging quality and radiation dose were analyzed. Results: When the values of SD were 2.5, 2.75, 3.0 and 4.0, the high values of CTDI vol were 60.0, 49.8, 42.9 and 25.8 mGy, respectively. The effective doses were (3.27±1.01), (2.78±0.85), (2.40±0.74) and (1.49±0.45) mSv·mGy -1 ·cm -1 , respectively. There was significant difference among those groups (F=48.99, P<0.05). The excellent imaging qualities were 100%, 96%, 70% and 20%, 12 cases were neonate in SD 2.5 group. In SD 2.75 group, the imaging quality of neonate (2 cases) were all fine. In SD 3.0 group, the imaging quality was not ideal for the ages less than 1 year. In SD 4.0 group, when the infants aged over 2 years and 6 months, or with the larger head circumference, their imaging quality were all excellent. Conclusions: The individual application of ATCM could obtain the best balance among imaging quality, radiation dose and diagnostic quality. The SD 2.5, 2.75, 3.0 and 4.0 might be suitable to infants of newborn, 1 month to 1 year old, 1 to 3 years, the larger head circumference and part of the reviewed cases. (authors)

  7. GETDB: 112122 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 112122 Link to Original y[*] w[*]; P{GawB}NP0275 / TM6, P{UAS-lacZ.UW23-1}UW23-1 47A12... ; -; 47A13 Link to DGRC Genome Viewer: 112122 lola psq 275 3 FlyBase Insertion: P{GawB}NP0275 NP line. R... 662 1 Request - muscle ubiquitous sg - - - - - - - - Show 112122 DGRC Number 11212...2 Link to Original Genotype y[*] w[*]; P{GawB}NP0275 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site 47A12 ...; -; 47A13 Map Viewer Link to DGRC Genome Viewer: 112122 Related Genes lola psq Original Number 275 Chr. 3 C

  8. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 86:SIMILARITY TO G BETA REPEATS. ... organism:CAENORHABDITIS ELEGANS. dbxref:GenBank; U41278; ... ... ... g1086900; -.'', species:''CAENORHABDITIS ELEGANS ... Length = 275 ... Query: 28 ... DGTYCLSCGSDKKIKLWNP

  9. Interspecific Transmission of Double-Stranded RNA and Hypovirulence from Sclerotinia sclerotiorum to S. minor.

    Science.gov (United States)

    Melzer, M S; Ikeda, S S; Boland, G J

    2002-07-01

    ABSTRACT Interspecific transmission of a hypovirulence-associated double-stranded RNA (dsRNA) and hypovirulent phenotype was attempted from hypovirulent isolate Ss275 of Sclerotinia sclerotiorum to five virulent isolates of S. minor. dsRNA and the hypovirulent phenotype were successfully transmitted to one of the five isolates, Sm10. Three putative converted isolates of Sm10 were slow growing and developed atypical colony morphologies characteristic of the hypovirulent phenotype. These isolates were assayed for virulence and produced significantly smaller lesions than isolate Sm10 on detached leaves of Romaine lettuce. One of these putative converted isolates, designated Sm10T, was tested to confirm interspecific transmission of dsRNA. In northern hybridizations, dsRNA isolated from Sm10T hybridized with a digoxigenin-labeled cDNA probe prepared from dsRNA isolated from Ss275. Random amplified polymorphic DNA analysis confirmed that isolate Sm10T was derived from Sm10 and not from Ss275 or a hybrid of the two species. The dsRNA and hypovirulent phenotype were subsequently transmitted intraspecifically from Sm10T to Sm8. To our knowledge, this is the first report of interspecific transmission of dsRNA and an associated hypovirulent phenotype between fungal plant pathogens by hyphal anastomosis.

  10. [Using UV-Vis Absorbance for Characterization of Maturity in Composting Process with Different Materials].

    Science.gov (United States)

    Zhao, Yue; Wei, Yu-quan; Li, Yang; Xi, Bei-dou; Wei, Zi-min; Wang, Xing-lei; Zhao, Zhi-nan; Ding, Jei

    2015-04-01

    The present study was conducted to assess the degree of humification in DOM during composting using different raw materials, and their effect on maturity of compost based on UV-Vis spectra measurements and chemometrics method. The raw materials of composting studied included chicken manure, pig manure, kitchen waste, lawn waste, fruits and vegetables waste, straw waste, green waste, sludge, and municipal solid waste. During composting, the parameters of UV-Vis spectra of DOM, including SUVA254 , SUVA280 , E250/E365, E4/E6, E2/E4, E2/E6, E253/E203, E253/E220, A226-400, S275-295 and S350-400 were calculated, Statistical analysis indicated that all the parameter were significantly changed during composting. SUVA254 and SUVA280 of DOM were continuously increased, E250/E365 and E4/E6 were continuously decreased in DOM, while A226-400, S275-295 and S350-400 of DOM at the final stage were significantly different with those at other stages of composting. Correlation analysis indicated that the parameters were significantly correlated with each other except for E2/E4 and E235/E203. Furthermore, principal component analysis suggested that A226-400, SUVA254, S350-400, SUVA280 and S275~295 were reasonable parameters for assessing the compost maturity. To distinguish maturity degree among different composts, hierarchical cluster analysis, an integrated tool utilizing multiple UV-Vis parameters, was performed based on the data (A226-400, SUVA254, S350-400, SUVA280 and S275-295) of DOM derived from the final stage of composting. Composts from different sources were clustered into 2 groups. The first group included chicken manure, pig manure, lawn waste, fruits and vegetables waste, green waste, sludge, and municipal solid waste characterized by a lower maturity degree, and the second group contained straw waste and kitchen waste associated with a higher maturity degree. The above results suggest that a multi-index of UV-Vis spectra could accurately evaluate the compost maturity

  11. 77 FR 12583 - Ocean Transportation Intermediary License; Applicants

    Science.gov (United States)

    2012-03-01

    ... Hermo, Vice President, Application Type: New NVO & OFF License. B2B Global Logistics Incorporated (NVO... Change. Global Logistics New Jersey Limited Liability Company (NVO & OFF) 275 Veterans Boulevard...

  12. Transformations and Fates of Terrigenous Dissolved Organic Matter in River-influenced Ocean Margins

    Science.gov (United States)

    Fichot, Cedric G.

    Rivers contribute about 0.25 Pg of terrigenous dissolved organic carbon (tDOC) to the ocean each year. The fate and transformations of this material have important ramifications for the metabolic state of the ocean, air-sea CO2 exchange, and the global carbon cycle. Stable isotopic compositions and terrestrial biomarkers suggest tDOC must be efficiently mineralized in ocean margins. Nonetheless, the extent of tDOC mineralization in these environments remains unknown, as no quantitative estimate is available. The complex interplay of biogeochemical and physical processes in these systems compounded by the limited practicality of chemical proxies (organic biomarkers, isotopic compositions) make the quantification of tDOC mineralization in these dynamic systems particularly challenging. In this dissertation, new optical proxies were developed (Chapters 1 and 2) and facilitated the first quantitative assessment of tDOC mineralization in a dynamic river-influenced ocean margin (Chapter 3) and the monitoring of continental runoff distributions in the coastal ocean using remote sensing (Chapter 4). The optical properties of chromophoric dissolved organic matter (CDOM) were used as optical proxies for dissolved organic carbon concentration ([DOC]) and %tDOC. In both proxies, the CDOM spectral slope coefficient ( S275-295) was exploited for its informative properties on the chemical nature and composition of dissolved organic matter. In the first proxy, a strong relationship between S275-295 and the ratio of CDOM absorption to [DOC] facilitated accurate retrieval (+/- 4%) of [DOC] from CDOM. In the second proxy, the existence of a strong relationship between S275-295 and the DOC-normalized lignin yield facilitated the estimation of the %tDOC from S 275-295. Using the proxies, the tDOC concentration can be retrieved solely from CDOM absorption coefficients (lambda = 275-295 nm) in river-influenced ocean margins. The practicality of optical proxies facilitated the calculation

  13. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    International Nuclear Information System (INIS)

    Nelson, Sarah L; Nelson, Sarah L

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studied with the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus at or near the same excitation energy with similar values of angular momentum via different nuclear reactions. In doing so, it can be determined if there is a preference in entrance channel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' model is nearly identical for the two reactions. Additionally, because the same compound nucleus is produced, the exit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs; cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrance channel in these paired reactions. Charge equilibration immediately prior to fusion leading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35 ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' theory

  14. 32 CFR Appendix N to Part 275 - Obtaining Access to Financial Records Overseas

    Science.gov (United States)

    2010-07-01

    ... Justice. 2. An intelligence organization may seek access pursuant to Procedure 7 of DoD 5240.1-R. 3... only where an official need-to-know exists. Failure to identify or limit access in accordance with this paragraph does not render the information inadmissible in courts-martial or other proceedings. 4. Access to...

  15. 32 CFR Appendix G to Part 275 - Releasing Information Obtained From Financial Institutions

    Science.gov (United States)

    2010-07-01

    ... SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS OBTAINING INFORMATION FROM FINANCIAL INSTITUTIONS: RIGHT TO... Financial Institutions A. Financial records obtained under 12 U.S.C. chapter 35 shall be marked: “This... 32 National Defense 2 2010-07-01 2010-07-01 false Releasing Information Obtained From Financial...

  16. TMFunction data: 234 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  17. TMFunction data: 233 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  18. Stages in the Formation of the Romanian Mental Space

    Directory of Open Access Journals (Sweden)

    POMPEI COCEAN

    2008-01-01

    Full Text Available In the evolution of the Romanian mental space, four distinct stages can be emphasized, each of them bringing its specific contribution to its defining and structuring. These stages are the following: the forerunning, Dacian stage, the 2nd century B.C. - 106 A.D.; the incipient, Dacian-Roman stage, 105 – 275 A.D.; the structuring, proto-Romanian stage, 275 – the 6th and 7th centuries; the Romanian stage of completion and affirmation, the 8th century – nowadays. Each stage is characterized by different forms, in continuous affirmation and improvement, of interrelations between the human communities and the site, of spiritually sublimation of the physical-geographical substratum features, of the territory inhabited by them.

  19. Thermally Stable Siloxane Hybrid Matrix with Low Dielectric Loss for Copper-Clad Laminates for High-Frequency Applications.

    Science.gov (United States)

    Kim, Yong Ho; Lim, Young-Woo; Kim, Yun Hyeok; Bae, Byeong-Soo

    2016-04-06

    We report vinyl-phenyl siloxane hybrid material (VPH) that can be used as a matrix for copper-clad laminates (CCLs) for high-frequency applications. The CCLs, with a VPH matrix fabricated via radical polymerization of resin blend consisting of sol-gel-derived linear vinyl oligosiloxane and bulky siloxane monomer, phenyltris(trimethylsiloxy)silane, achieve low dielectric constant (Dk) and dissipation factor (Df). The CCLs with the VPH matrix exhibit excellent dielectric performance (Dk = 2.75, Df = 0.0015 at 1 GHz) with stability in wide frequency range (1 MHz to 10 GHz) and at high temperature (up to 275 °C). Also, the VPH shows good flame resistance without any additives. These results suggest the potential of the VPH for use in high-speed IC boards.

  20. Crystallization and preliminary X-ray analysis of a complex formed between the antibiotic simocyclinone D8 and the DNA breakage–reunion domain of Escherichia coli DNA gyrase

    International Nuclear Information System (INIS)

    Edwards, Marcus J.; Flatman, Ruth H.; Mitchenall, Lesley A.; Stevenson, Clare E. M.; Maxwell, Anthony; Lawson, David M.

    2009-01-01

    Crystals of a complex formed between the 59 kDa N-terminal fragment of the E. coli DNA gyrase A subunit and the antibiotic simocyclinone D8 were obtained and X-ray data were recorded to a resolution of 2.75 Å. Crystals of a complex formed between the 59 kDa N-terminal fragment of the Escherichia coli DNA gyrase A subunit (also known as the breakage–reunion domain) and the antibiotic simocyclinone D8 were grown by vapour diffusion. The complex crystallized with I-centred orthorhombic symmetry and X-ray data were recorded to a resolution of 2.75 Å from a single crystal at the synchrotron. DNA gyrase is an essential bacterial enzyme and thus represents an attractive target for drug development

  1. Gambler’s fallacy and imperfect best response in legislative bargaining

    Czech Academy of Sciences Publication Activity Database

    Nunnari, S.; Zápal, Jan

    2016-01-01

    Roč. 99, September (2016), s. 275-294 ISSN 0899-8256 Institutional support: RVO:67985998 Keywords : legislative bargaining * experiments * quantal response Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

  2. Conference to Focus on Vast Need for 'Village Power'

    Science.gov (United States)

    site. Conference contact: Barbara Ferris, NREL, 1617 Cole Blvd., Golden, CO 80401. Phone: 303-275-3781 . E-mail Barbara Ferris. NREL is a national laboratory managed by Midwest Research Institute, Battelle

  3. Partial melting of metavolcanics in amphibolite facies regional ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Department of Geology and Geography, University of Massachusetts,. Amherst), pp 275. Hollocher K 1991 Prograde amphibole dehydration reac- tions during high grade regional metamorphism, Central. Massachusetts, U.S.A.; Am. Mineral.

  4. Emilie Bláhová (13. 6. 1931 - 9. 10. 2016)

    Czech Academy of Sciences Publication Activity Database

    Chromá, Martina

    2017-01-01

    Roč. 140, 1-2 (2017), s. 275-277 ISSN 0024-4457 Institutional support: RVO:68378017 Keywords : Bláhová, Emilie * obituary * paleoslavistics Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  5. TMFunction data: 238 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  6. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  7. TMFunction data: 239 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  8. 76 FR 27910 - Modification of the Significant New Uses of 2-Propen-1-one, 1-(4-morpholinyl)-

    Science.gov (United States)

    2011-05-13

    ... environmental release that may result from the significant new use of the chemical substance. Potential benefits... Edmont Neoprene number 865, and Solvex Nitrile Rubber number 275 gloves have been tested in accordance...

  9. Státní maturity nejsou lék, nýbrž symptom choroby

    Czech Academy of Sciences Publication Activity Database

    Janoušek, Pavel

    2010-01-01

    Roč. 21, 275 /27. 11./ (2010), 38-40 ISSN 1210-1168 Institutional research plan: CEZ:AV0Z90560517 Keywords : literature * leaving examinations * education Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. Effect of gamma radiation and ethylene oxide on neomycin sulphate

    International Nuclear Information System (INIS)

    Gopal, N.G.S.; Rajagopalan, S.

    1981-01-01

    Neomycin is affected by ethylene oxide but not by gamma radiation (2.75 Mrad). Differential refractometry is more advantageous in quantitating neomycin A, B and C than is the ninhydrin method. (Auth.)

  11. NREL Manager Elected to IREC Board of Directors

    Science.gov (United States)

    Manager Elected to IREC Board of Directors For more information contact: Sarah Holmes Barba, 303 -275-3023 email: Sarah Barba Golden, Colo., May 14, 2001 - David Warner, manager of the Information and

  12. [Near ultraviolet absorption spectral properties of chromophoric dissolved organic matter in the north area of Yellow Sea].

    Science.gov (United States)

    Wang, Lin; Zhao, Dong-Zhi; Yang, Jian-Hong; Chen, Yan-Long

    2010-12-01

    Chromophoric dissolved organic matter (CDOM) near ultraviolet absorption spectra contains CDOM molecular structure, composition and other important physical and chemical information. Based on the measured data of CDOM absorption coefficient in March 2009 in the north area of Yellow Sea, the present paper analyzed near ultraviolet absorption spectral properties of CDOM. The results showed that due to the impact of near-shore terrigenous input, the composition of CDOM is quite different in the north area of Yellow Sea, and this area is a typical case II water; fitted slope with specific range of spectral band and absorption coefficient at specific band can indicate the relative size of CDOM molecular weight, correlation between spectral slope of the Sg,275-300), Sg,300-350, Sg,350-400 and Sg,250-275 and the relative size of CDOM molecular weight indicative parameter M increases in turn and the highest is up to 0.95. Correlation between a(g)(lambda) and M value increases gradually with the increase in wavelength, and the highest is up to 0.92 at 400 nm; being correlated or not between spectral slope and absorption coefficient is decided by the fitting-band wavelength range for the spectra slope and the wavelength for absorption coefficient. Correlation between Sg,275-300 and a(g)(400) is the largest, up to 0.87.

  13. Well-Dispersed Co/CoO/C Nanospheres with Tunable Morphology as High-Performance Anodes for Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Bingqing Xu

    2016-11-01

    Full Text Available Well-dispersed Co/CoO/C nanospheres have been designed and constructed through a facile electrospinning method with a strategy controlling the morphology of nanocomposites via adjusting the pre-oxidized and heat treatments. Scanning electron microscopy results reveal that the as-synthesized sample pre-oxidized at 275 °C shows better spherical morphology with a diameter of around 300 nm without conspicuous agglomeration. X-ray diffraction analysis confirms the coexistence of cobalt and cobalt monoxide in the sample. Furthermore, the electrochemical tests reveal that the sample pre-oxidized at 275 °C displays excellent cycling stability with only 0.016% loss per cycle even after 400 cycles at 1000 mA·g−1 and enhanced high-rate capability with a specific discharge capacity of 354 mA·g−1 at 2000 mA·g−1. Besides, the sample pre-oxidized at 275 °C shows a specific capacity of 755 mA·g−1 at 100 mA·g−1 after 95 cycles. The improved electrochemical performance has been ascribed to the well dispersion of nanospheres, the improved electronic conductivity, and the structural integrity contribution from the carbon and cobalt coexisting nanocomposite. The strategy for preparing well-dispersed nanospheres by adjusting pre-oxidized and annealing processes could have insight for other oxide nanosphere synthesis.

  14. S¯adhan¯a Vol. 29, 2004 Subject Index

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Air-fuel combustion. Numerical study of effect of oxygen fraction on local entropy ... cous liquid. 27 ... Cantilevered pipe ... and exhaust opacity in compression ignition engines. 275. Diffraction ... Investigations of neutronic performance of a.

  15. 10 CFR 434.513 - Occupancy.

    Science.gov (United States)

    2010-01-01

    ... default assumptions. The same assumptions shall be made in computing Design Energy Consumption as were... area Ft 2 person Assembly 50 Office 275 Retail 300 Warehouse 15000 School 75 Hotel/Motel 250 Restaurant...

  16. Astronauts McDivitt and White look over training plans

    Science.gov (United States)

    1965-01-01

    Astronauts James A. McDivitt (left) and Edward H. White II are shown looking over training plans at Cape Kennedy during prelaunch preparations. The NASA Headquarters alternative photo number is 65-H-275.

  17. Nová konstrukce rotoru heliové expanzní turbiny

    Czech Academy of Sciences Publication Activity Database

    Dupák, Jan; Hanzelka, Pavel; Michalička, Petr; Tuček, L.; Ustohal, V.

    č. 9 (2002), s. 275 - 276 ISSN 0447-6441 Institutional research plan: CEZ:AV0Z2065902 Keywords : helium expansion turbine * nickel-chrome-tungsten steel 16720 Subject RIV: BM - Solid Matter Physics ; Magnetism

  18. Entomopathogenic Fungus as a Biological Control for an Important Vector of Livestock Disease: The Culicoides Biting Midge

    Science.gov (United States)

    Ansari, Minshad Ali; Pope, Edward C.; Carpenter, Simon; Scholte, Ernst-Jan; Butt, Tariq M.

    2011-01-01

    Background The recent outbreak of bluetongue virus in northern Europe has led to an urgent need to identify control measures for the Culicoides (Diptera: Ceratopogonidae) biting midges that transmit it. Following successful use of the entomopathogenic fungus Metarhizium anisopliae against larval stages of biting midge Culicoides nubeculosus Meigen, we investigated the efficacy of this strain and other fungi (Beauveria bassiana, Isaria fumosorosea and Lecanicillium longisporum) as biocontrol agents against adult C. nubeculosus in laboratory and greenhouse studies. Methodology/Findings Exposure of midges to ‘dry’ conidia of all fungal isolates caused significant reductions in survival compared to untreated controls. Metarhizium anisopliae strain V275 was the most virulent, causing a significantly decrease in midge survival compared to all other fungal strains tested. The LT50 value for strain V275 was 1.42 days compared to 2.21–3.22 days for the other isolates. The virulence of this strain was then further evaluated by exposing C. nubeculosus to varying doses (108–1011 conidia m−2) using different substrates (horse manure, damp peat, leaf litter) as a resting site. All exposed adults were found to be infected with the strain V275 four days after exposure. A further study exposed C. nubeculosus adults to ‘dry’ conidia and ‘wet’ conidia (conidia suspended in 0.03% aq. Tween 80) of strain V275 applied to damp peat and leaf litter in cages within a greenhouse. ‘Dry’ conidia were more effective than ‘wet’ conidia, causing 100% mortality after 5 days. Conclusion/Significance This is the first study to demonstrate that entomopathogenic fungi are potential biocontrol agents against adult Culicoides, through the application of ‘dry’ conidia on surfaces (e.g., manure, leaf litter, livestock) where the midges tend to rest. Subsequent conidial transmission between males and females may cause an increased level of fungi-induced mortality in midges

  19. 2014 National Asset Management Conference and training on implementation strategies.

    Science.gov (United States)

    2014-07-01

    This report documents the major research activities conducted as part of the Federal Highway Administration (FHWA) : Transportation Pooled Fund (TPF) Program project, TPF-5(275) 2014 National Asset Management Conference and Training on : Implementati...

  20. Dedifferentiation of tobacco cells is associated with ribosomal RNA gene hypomethylation, increased transcription, and chromatin alterations

    Czech Academy of Sciences Publication Activity Database

    Koukalová, Blažena; Fojtová, Miloslava; Lim, Yoong Kar; Fulneček, Jaroslav; Leitch, Rowland Andrew; Kovařík, Aleš

    2005-01-01

    Roč. 139, - (2005), s. 275-286 ISSN 0032-0889 Institutional research plan: CEZ:AV0Z50040507 Keywords : pluripotent tobacco cells * epigenetic changes Subject RIV: BO - Biophysics Impact factor: 6.114, year: 2005

  1. 75 FR 54601 - Lower South Fork LLC; Notice of Application Accepted for Filing and Soliciting Comments, Motions...

    Science.gov (United States)

    2010-09-08

    ... proposal consists of adding a Pelton style 470 kilowatt hydraulic turbine/generator into an existing 32... primary purpose of the conduit is agricultural use. The hydraulic capacity of the generator will be 27.5...

  2. Restoration of Transforming Growth Factor Beta Signaling by Histone Deacetylase Inhibitors in Human Prostate Carcinoma

    National Research Council Canada - National Science Library

    Qian, Zheng D

    2006-01-01

    The goal of the current grant is to investigate the potential antitumor activity of histone deacetylase inhibitor MS-275 along with the activation of TGFb signaling pathway with the restoration of TGFb receptor II...

  3. Restoration of Transforming Growth Factor Beta Signaling by Histone Deacetylase Inhibitors in Human Prostate Carcinoma

    National Research Council Canada - National Science Library

    Qian, Zheng D

    2005-01-01

    The goal of the current grant is to investigate the potential antitumor activity of histone deacetylase inhibitor MS-275 a with the activation of TGFb signaling pathway with the restoration of TGFbeta receptor II...

  4. Lepingute suhtes kohaldatava seaduse küsimusi Euroopa Liidus : [bakalaureusetöö] / Tarvo Lindma ; Tartu Ülikool, õigusteaduskond ; juhendaja: Heiki Pisuke

    Index Scriptorium Estoniae

    Lindma, Tarvo, 1974-

    1996-01-01

    Lepinguõiguse unifitseerimine; Rooma 1980. a. lepingulistele suhetele kohaldatava seaduse konventsioon; ostu-müügileping (Haagi konventsioonid); esindus; usaldusleping; Beneluxi leping; konventsioonide kohaldatavus liikmesriikides. Vt. ka: Juridica (1996) nr. 6, lk. 275-279

  5. Method development and validation of potent pyrimidine derivative by UV-VIS spectrophotometer.

    Science.gov (United States)

    Chaudhary, Anshu; Singh, Anoop; Verma, Prabhakar Kumar

    2014-12-01

    A rapid and sensitive ultraviolet-visible (UV-VIS) spectroscopic method was developed for the estimation of pyrimidine derivative 6-Bromo-3-(6-(2,6-dichlorophenyl)-2-(morpolinomethylamino) pyrimidine4-yl) -2H-chromen-2-one (BT10M) in bulk form. Pyrimidine derivative was monitored at 275 nm with UV detection, and there is no interference of diluents at 275 nm. The method was found to be linear in the range of 50 to 150 μg/ml. The accuracy and precision were determined and validated statistically. The method was validated as a guideline. The results showed that the proposed method is suitable for the accurate, precise, and rapid determination of pyrimidine derivative. Graphical Abstract Method development and validation of potent pyrimidine derivative by UV spectroscopy.

  6. Oxygen rocking aqueous batteries utilizing reversible topotactic oxygen insertion/extraction in iron-based perovskite oxides Ca(1-x)La(x)FeO(3-δ).

    Science.gov (United States)

    Hibino, Mitsuhiro; Kimura, Takeshi; Suga, Yosuke; Kudo, Tetsuichi; Mizuno, Noritaka

    2012-01-01

    Developments of large-scale energy storages with not only low cost and high safety but also abundant metals are significantly demanded. While lithium ion batteries are the most successful method, they cannot satisfy all conditions. Here we show the principle of novel lithium-free secondary oxygen rocking aqueous batteries, in which oxygen shuttles between the cathode and anode composed of iron-based perovskite-related oxides Ca(0.5)La(0.5)FeO(z) (2.5 ≤ z ≤ 2.75 and 2.75 ≤ z ≤ 3.0). Compound Ca(0.5)La(0.5)FeO(z) can undergo two kinds of reduction and reoxidation of Fe(4+)/Fe(3+) and Fe(3+)/Fe(2+), that are accompanied by reversible and repeatable topotactic oxygen extraction and reinsertion during discharge and charge processes.

  7. Oxygen rocking aqueous batteries utilizing reversible topotactic oxygen insertion/extraction in iron-based perovskite oxides Ca1–xLaxFeO3−δ

    Science.gov (United States)

    Hibino, Mitsuhiro; Kimura, Takeshi; Suga, Yosuke; Kudo, Tetsuichi; Mizuno, Noritaka

    2012-01-01

    Developments of large-scale energy storages with not only low cost and high safety but also abundant metals are significantly demanded. While lithium ion batteries are the most successful method, they cannot satisfy all conditions. Here we show the principle of novel lithium-free secondary oxygen rocking aqueous batteries, in which oxygen shuttles between the cathode and anode composed of iron-based perovskite-related oxides Ca0.5La0.5FeOz (2.5 ≤ z ≤ 2.75 and 2.75 ≤ z ≤ 3.0). Compound Ca0.5La0.5FeOz can undergo two kinds of reduction and reoxidation of Fe4+/Fe3+ and Fe3+/Fe2+, that are accompanied by reversible and repeatable topotactic oxygen extraction and reinsertion during discharge and charge processes. PMID:22924108

  8. Seroprevalence of toxoplasmosis in voluntary blood donors of Puducherry and surrounding districts of Tamil Nadu.

    Science.gov (United States)

    Stephen, Selvaraj; Pradeep, Jothimani; Anitharaj, Velmurugan; Janarthanam, Venkatraman

    2017-12-01

    Our objective is to study the seroprevalence of toxoplasmosis in the voluntary blood donors of Puducherry and surrounding districts of Tamil Nadu. A total of 275 healthy blood donors were screened for the presence of IgM and IgG antibodies to Toxoplasma gondii by ELISA test. Donor samples positive for IgM and/or IgG antibodies to T. gondii were subjected to IgG avidity ELISA. While, 54 out of 275 donors had IgG antibodies (19.66%), only one donor had IgM (0.36%) along with IgG. Among 54 IgG positive donors, only two had low avidity (3.7%), indicating recent exposure to the protozoa. Feasibility and cost effectiveness studies should be conducted throughout India to decide regarding screening of blood donors for toxoplasmosis.

  9. Hepatic Insulin Resistance Following Chronic Activation of the CREB Coactivator CRTC2

    DEFF Research Database (Denmark)

    Hogan, Meghan F; Ravnskjaer, Kim; Matsumura, Shigenobu

    2015-01-01

    and dephosphorylation of the cAMP regulated CREB coactivators CRTC2 and CRTC3. In parallel, decreases in circulating insulin also increase gluconeogenic gene expression via the de-phosphorylation and activation of the forkhead transcription factor FOXO1. Hepatic gluconeogenesis is increased in insulin resistance where...... increased gluconeogenic gene expression under fasting as well as feeding conditions. Circulating glucose concentrations were constitutively elevated in CRTC2S171,275A expressing mice, leading to compensatory increases in circulating insulin concentrations that enhance FOXO1 phosphorylation. Despite...... accompanying decreases in FOXO1 activity, hepatic gluconeogenic gene expression remained elevated in CRTC2S171,275A mice demonstrating that chronic increases in CRTC2 activity in the liver are indeed sufficient to promote hepatic insulin resistance and to disrupt glucose homeostasis....

  10. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275 ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.761, year: 2015

  11. Sankcionovat

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    2016-01-01

    Roč. 99, č. 5 (2016), s. 271-275 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : sanction * origin * different meanings * dictionary Subject RIV: AI - Linguistics

  12. The mitochondrial genome and ribosomal operon of Brachycladium goliath (Digenea: Brachycladiidae) recovered from a stranded minke whale

    Czech Academy of Sciences Publication Activity Database

    Briscoe, A.G.; Bray, R. A.; Brabec, Jan; Littlewood, D. T. J.

    2016-01-01

    Roč. 65, č. 3 (2016), s. 271-275 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : Digenea * Balaenoptera acutorostrata * Cetacea * Hologenophore * NGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.744, year: 2016

  13. Semeia und Tekmeria im 5. Jahrhundert v. Chr.: Ein Beitrag zur Geschichte der ältesten griechischen Semiotik und Argumentationstechnik

    Czech Academy of Sciences Publication Activity Database

    Klouda, Jiří

    2016-01-01

    Roč. 139, 3/4 (2016), s. 275-299 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : theory of signs * theory of argumentation * the older Attic orators * Hippocratic Prognosticon * Dissoi logoi Subject RIV: AA - Philosophy ; Religion

  14. 78 FR 50026 - Basin Electric Power Cooperative, Inc.: Notice of Intent To Prepare a Supplemental Draft...

    Science.gov (United States)

    2013-08-16

    ... transmission lines, 5 new substations, modifications to 4 existing substations, maintenance access roads... address the construction, operation, and maintenance of Basin Electric's proposed Project. The Project includes construction, operation and maintenance of approximately 275 [[Page 50027

  15. Elemental characterization of the new Czech meteorite "Morávka" by neutron and photon activation analysis

    Czech Academy of Sciences Publication Activity Database

    Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav

    2003-01-01

    Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003

  16. 75 FR 41017 - Political Contributions by Certain Investment Advisers

    Science.gov (United States)

    2010-07-14

    ... enterprise corruption and State securities fraud for selling access to management of public funds in return... Part IV Securities and Exchange Commission 17 CFR Part 275 Political Contributions by Certain... and Regulations#0;#0; [[Page 41018

  17. Disease: H01436 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available etion. ... JOURNAL ... Am J Med Genet 113:275-8 (2002) DOI:10.1002/ajmg.10725 ... PMID:25738052 ... AUTHORS ... Kumar... M, Aroor S, Mundkur S, Kumar S ... TITLE ... Guillain-barre syndrome: a clinical stu

  18. 75 FR 65625 - Osprey II, LLC; Notice of Preliminary Permit Application Accepted for Filing and Soliciting...

    Science.gov (United States)

    2010-10-26

    ... study the feasibility of the 649 Water Street Project to be located on the Cobbosseecontee Stream, in.... Applicant Contact: Hoon Won, 275 River Road, P.O. Box 202, Woolwich, ME 04579; (203) 340-2517. FERC Contact...

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Plant Growth Promoting Rhizobacteria - Potential Microbes for Sustainable Agriculture. Jay Shankar Singh. General Article Volume 18 Issue 3 March 2013 pp 275-281 ...

  20. Specific expression of an oxytocin-enhanced cyan fluorescent protein fusion transgene in the rat hypothalamus and posterior pituitary

    Czech Academy of Sciences Publication Activity Database

    Katoh, A.; Fujihara, H.; Ohbuchi, T.; Onaka, T.; Scott, W. S. III.; Dayanithi, Govindan; Yamasaki, Y.; Kawata, M.; Suzuki, H.; Otsubo, H.; Suzuki, Hi.; Murphy, D.; Ueta, Y.

    2010-01-01

    Roč. 204, č. 3 (2010), s. 275-285 ISSN 0022-0795 Institutional research plan: CEZ:AV0Z50390703 Keywords : magnocellular neurons * neurosecretory-cells * hypothalamus Subject RIV: FH - Neurology Impact factor: 3.099, year: 2010

  1. Crystal structure of vanadite: Refinement of anisotropic displacement parameters

    Czech Academy of Sciences Publication Activity Database

    Laufek, F.; Skála, Roman; Haloda, J.; Císařová, I.

    2006-01-01

    Roč. 51, 3-4 (2006), s. 271-275 ISSN 1210-8197 Institutional research plan: CEZ:AV0Z30130516 Keywords : anisotropic displacement parameter * crystal structure * single-crystal X-ray refinement * vanadinite Subject RIV: DB - Geology ; Mineralogy

  2. 75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-11

    ... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

  3. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... What is Cognitive Processing Therapy (CPT) [for posttraumatic stress disorder]? - Duration: 2:01. Veterans Health Administration 28, ... Health Administration 13,275 views 1:53 Managing Stress with the Moving Forward App: An Overview - Duration: ...

  4. Building policy leadership among HIV/AIDS health workers | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Learn more: Read a journal article on the reliability of data collected by community health workers for policy and planning in Kenya. Read project summaries​ of the Teasdale-Corti Global Research Partnership Program (PDF, 275KB) ...

  5. Study of corrosion resistance properties of nitrided carbon steel using radiofrequency N{sub 2}/H{sub 2} cold plasma process

    Energy Technology Data Exchange (ETDEWEB)

    Bouanis, F.Z. [Unite Materiaux et Transformations (UMET), Ingenierie des Systemes Polymeres, CNRS UMR 8207, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Jama, C., E-mail: charafeddine.jama@ensc-lille.f [Unite Materiaux et Transformations (UMET), Ingenierie des Systemes Polymeres, CNRS UMR 8207, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Traisnel, M. [Unite Materiaux et Transformations (UMET), Ingenierie des Systemes Polymeres, CNRS UMR 8207, ENSCL, BP 90108, F-59652 Villeneuve d' Ascq Cedex (France); Bentiss, F. [Laboratoire de Chimie de Coordination et d' Analytique, Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco)

    2010-10-15

    C38 carbon steel have been plasma-nitrided using a radiofrequency cold plasma discharge treatment in order to investigate the influence of gas composition on corrosion behaviour of nitrided substrates. The investigated C38 steel was nitrided by a RF plasma discharge treatment using two different gas mixtures (75% N{sub 2}/25% H{sub 2} and 25% N{sub 2}/75% H{sub 2}) at different times of plasma-treatment on non-heated substrates. Electron Probe Microanalysis (EPMA) showed that the nitrided layer formed using 75% N{sub 2}/25% H{sub 2} gas mixture was thicker compared to those formed in the case of 25% N{sub 2}/75% H{sub 2} or pure N{sub 2}. The modifications of the corrosion resistance characteristics of plasma-nitrided C38 steel in 1 M HCl solution were investigated by weight loss measurements and ac impedance technique. The results obtained from these two evaluation methods were in good agreement. It was shown that the nitriding treatment in both cases (75% N{sub 2}/25% H{sub 2} and 25% N{sub 2}/75% H{sub 2}) improves the corrosion resistance of investigated carbon steel, while the better performance is obtained for the 75% N{sub 2}/25% H{sub 2} gas mixture. X-ray photoelectron spectroscopy (XPS) was carried out before and after immersion in corrosive medium in order to establish the mechanism of corrosion inhibition using N{sub 2}/H{sub 2} cold plasma nitriding process.

  6. Using appropriate body mass index cut points for overweight and obesity among Asian Americans

    Science.gov (United States)

    Jih, Jane; Mukherjea, Arnab; Vittinghoff, Eric; Nguyen, Tung T.; Tsoh, Janice Y.; Fukuoka, Yoshimi; Bender, Melinda S.; Tseng, Winston; Kanaya, Alka M.

    2014-01-01

    Objective Asian Americans have low prevalence of overweight/obesity based on standard BMI cut points yet have higher rates of diabetes. We examined the prevalence of overweight/obesity, using lower BMI cut points recommended by the World Health Organization (WHO) for Asians, and diabetes in Asian American subgroups in California. Method Secondary analysis of the 2009 adult California Health Interview Survey (n = 45,946) of non-Hispanic Whites (NHW), African Americans, Hispanics and Asians (Vietnamese, Chinese, Korean, Filipino, South Asian and Japanese). WHO Asian BMI cut points (overweight = 23–27.5 kg/m2; obese ≥ 27.5 kg/m2) were used for Asian subgroups. Standard BMI cut points (overweight = 25–29.9 kg/m2; obese ≥ 30 kg/m2) were applied for other groups. Results Among Asian subgroups, overweight/obesity was highest among Filipinos (78.6%), which was higher than NHWs (p Asians with BMI = 23–24.9 kg/m2 and Koreans, Filipinos and Japanese with BMI = 27.5–29.9 kg/m2, the ranges WHO recommends as overweight or obese for Asians but not for other groups. Conclusions Filipinos should be a priority population for overweight/obesity screening. Filipinos, Vietnamese, Korean, South Asians and Japanese have higher diabetes prevalence at lower BMI cut points. WHO Asian BMI cut points may have clinical utility to identify at-risk Asian Americans. PMID:24736092

  7. [Affinity of the elements in group VI of the periodic table to tumors and organs].

    Science.gov (United States)

    Ando, A; Hisada, K; Ando, I

    1976-10-01

    In order to investigate the tumor affinity radioisotopes, chromium (51Cr), molybdenum (99Mo), tungsten (181W), selenium (75Se) and tellurium (127mTe)--the elements of group VI in the periodic table--were examined, using the rats which were subcutaneously transplanted with Yoshida sarcoma. Seven preprarations, sodium chromate (Na251CrO4), chromium chloride (51CrCl3), normal ammonium molybdate ((NH4)299MoO7), sodium tungstate (Na2181WO4), sodium selenate (Na275SeO4), sodium selenite (Na275SeO3) and tellurous acid (H2127mTeO3) were injected intravenously to each group of tumor bearing rats. These rats were sacrificed at various periods after injection of each preparation: 3 hours, 24 hours and 48 hours in all preparations. The radioactivities of the tumor, blood, muscle, liver, kidney and spleen were measured by a well-type scintillation counter, and retention values (in every tissue including the tumor) were calculated in percent of administered dose per g-tissue weight. All of seven preparations did not have any affinity for malignant tumor. Na251CrO4 and H2127mTeO3 had some affinity for the kidneys, and Na275SeO3 had some affinity for the liver. Na2181WO4 and (NH4)299MoO4 disappeared very rapidly from the blood and soft tissue, and about seventy-five percent of radioactivity was excreted in urine within first 3 hours.

  8. The Effectiveness of Experimental Diet with Varying Levels of Papain on The Growth Performance, Survival Rate and Feed Utilization of Keureling Fish (Tor tambra

    Directory of Open Access Journals (Sweden)

    Zainal Abidin Muchlisin

    2016-09-01

    Full Text Available The objective of present study was to determine the optimum level of papain in the diet of keureling fish (Tor tambra. The complete random design was utilized in this study. Six levels of papain dosage were tested in triplicates, i.e. 0 (control; 17.5 mg kg-1,  20.0 mg kg-1, 22.5 mg kg-1, 25.0 mg kg-1 and 27.5 mg kg-1 of feed. The experimental fish were fed the experimental diet two times a day at 8 AM and 5 PM at feeding level of 5% body weight for 90 days. The Anova test result showed that papain enzyme  gave a significant effect on the weight gain, daily growth rate, specific growth rate, survival rate, feed conversion ratio and feed efficiency (P<0.05. The Duncan multi-rage test result showed that the higher values for all measured parameters were obtained at the dosage of 27.5 mg kg-1. Therefore, it is concluded that the optimum dosage of papain enzyme for keureling fish was 27.5 mg kg-1 of feed.How to CiteMuchlisin, Z. A., Afrido, F., Murda, T., Fadli, N., Muhammadar, A. A., Jalil, Z., & Yulvizar, C. (2016. The Effectiveness of Experimental Diet with Varying Levels of Papain on The Growth Performance, Survival Rate and Feed Utilization of Keureling Fish (Tor tambra. Biosaintifika: Journal of Biology & Biology Education, 8(2, 172-177.

  9. Forced oscillations in Preisach systems

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel

    2000-01-01

    Roč. 275, - (2000), s. 81-86 ISSN 0921-4526. [HMMď99. Perurgia, 07.06.1999-09.06.1999] Institutional research plan: CEZ:AV0Z1019905 Subject RIV: BA - General Mathematics Impact factor: 0.893, year: 2000

  10. On the behavioural relevance of optional and mandatory impure public goods

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Munro, A.; Valente, M.

    2017-01-01

    Roč. 61, August (2017), s. 134-144 ISSN 0167-4870 Institutional support: RVO:67985998 Keywords : behavioural economic s * experiment * charity Subject RIV: AH - Economic s OBOR OECD: Applied Economic s, Econometrics Impact factor: 1.275, year: 2016

  11. Mizan Law Review - Vol 11, No 2 (2017)

    African Journals Online (AJOL)

    Legal and Practical Aspects of Child Custody, Visitation and Maintenance: A Case Study in SNNP Regional State · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Nigussie Afesha, 275-303 ...

  12. Efektivita přeměn energie - Možnosti dokonalejší přeměny

    Czech Academy of Sciences Publication Activity Database

    Luxa, Martin; Synáč, J.

    2013-01-01

    Roč. 92, č. 5 (2013), s. 272-275 ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics http://www.vesmir.cz/clanek/efektivita-premen-energie

  13. Ideas and Inspirations: Good News about Diabetes Prevention and Management in Indian Country

    Medline Plus

    Full Text Available ... Recruiter Newsroom Announcements Congressional Testimony Contact Us Director's Speeches Fact Sheets IHS Blog Press Releases Reports to ... DSMES Into Your Practice [PDF – 275 KB] In the Spotlight Save the Date! 2019 Diabetes in Indian ...

  14. Katolíci doufali, že se Hitler nažral

    Czech Academy of Sciences Publication Activity Database

    Med, Jaroslav; Peňás, J.

    2010-01-01

    Roč. 23, 275 /27. 11.; příloha Orientace/ (2010), s. 27-27 ISSN 0862-5921 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Catholic literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. Snow–Dust Storm: Unique case study from Iceland, March 6–7, 2013

    Czech Academy of Sciences Publication Activity Database

    Dagsson-Waldhauserova, P.; Arnalds, O.; Olafsson, H.; Hladil, Jindřich; Skála, Roman; Navrátil, Tomáš; Chadimová, Leona; Meinander, O.

    2015-01-01

    Roč. 16, March (2015), s. 69-74 ISSN 1875-9637 Institutional support: RVO:67985831 Keywords : snow dust deposition * atmosphere cryosphere interactions * volcanic dust * natural phenomenon * Arctic Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.275, year: 2015

  16. Metaphoric Perceptions of the Students of the Sports Sciences Faculty Regarding the Concept of Fair-Play

    Science.gov (United States)

    Çaglayan, Hakan Salim; Gül, Özgür

    2017-01-01

    The objective of this study is to reveal the perceptions of the students of the sports sciences faculty regarding the concept of "Fair-Play" by means of metaphors. 275 students [male[subscript (n = 173)], female [subscript (n = 102)

  17. 76 FR 58827 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year (FY) 2009

    Science.gov (United States)

    2011-09-22

    ... Corporacion de Desarrollo Economico De Ceiba, CD: 252 Lauro (787) 885-3020 4 100,000.00 Pittero Street, Ceiba... Rural Legal Assistance, Inc.: 631 Howard Street, Ste. (530) 742-7325 9 275,000.00 300, San Francisco, CA...

  18. Time-wise variation of scouring at bridge abutments

    Indian Academy of Sciences (India)

    provides useful information for the degree of scour counter-measure to be imple- mented against ..... the extension of the area of protection as well as the size, layer thickness, and surface elevation .... 275, School of Engineering, University of.

  19. Typewriting for Business Education Departments in Pennsylvania's Public Schools. Final Report. Bulletin 275 (Revised).

    Science.gov (United States)

    Leffingwell, Elsie L.; McKune, Mary B.

    The purposes of this guidebook for secondary typewriting teachers are to provide information about common typewriting problems, to suggest alternative teaching strategies, and to explore new areas of concern. Contents include suggested performance objectives for the first and second year of typewriting instruction at the secondary level;…

  20. Mill, John Stuart, El sometimiento de las mujeres. Madrid: Editorial Edaf, 2005, 275 p.

    Directory of Open Access Journals (Sweden)

    Cristhian Camilo Rodríguez Arias

    2014-07-01

    Full Text Available El sometimiento de las mujeres es uno de los libros más importantes del filósofo y economista inglés John Stuart Mill, defensor del utilitarismo como doctrina moral y padre del feminismo liberal, que llegó a defender delante del Parlamento inglés la amplitud de derechos en el terreno político mediante el reconocimiento del sufragio universal para las mujeres.

  1. 32 CFR Appendix I to Part 275 - Format for Obtaining Basic Identifying Account Information

    Science.gov (United States)

    2010-07-01

    ... Account Information [Official Letterhead] [Date] Mr./Mrs. XXXXXXXXXX Chief Teller [as appropriate] First.... 3401 et. seq., you are requested to provide the following account information: [Name, address, account... to this request for account information. Under section 3417(c) of the Act, good faith reliance upon...

  2. Supplement 1: Advanced nuclear turbojet powerplant characteristics summary for supersonic aircraft

    International Nuclear Information System (INIS)

    Larson, John W.

    1959-01-01

    The powerplant characteristics previously described in PWAC-275 were based on the use of low compressor pressure ratio nuclear turbojet engines equipped with interburners but without afterburners. The performance of an afterburning version of the same engine is presented in Section B of this supplement. The engine selection for the previous report and for Section B of this supplement was based on best engine performance at Mach No. 3 on nuclear heat alone. For this reason a low compression turbojet engine was selected. However, it is desirable that the nuclear data in report PWAC-275 be useful for both subsonic and supersonic missions. Therefore, the engine performance has been computed for a nuclear conversion of the Pratt & Whitney Aircraft J-58 turbojet engine which has a higher compressor pressure ratio. The performance of this engine is outlined in Section C of this supplement.

  3. Electrical Characteristics of the Contour-Vibration-Mode Piezoelectric Transformer with Ring/Dot Electrode Area Ratio

    Science.gov (United States)

    Yoo, Juhyun; Yoon, Kwanghee; Lee, Yongwoo; Suh, Sungjae; Kim, Jongsun; Yoo, Chungsik

    2000-05-01

    Contour-vibration-mode Pb(Sb1/2Nb1/2)O3-Pb(Zr, Ti)O3 [PSN-PZT] piezoelectric transformers with different ring/dot electrode area ratios were fabricated to the size of 27.5× 27.5× 2.5 mm3 by cold isostatic pressing. The electrical properties and characteristic temperature rises caused by the vibration were measured at various load resistances. Efficiencies above 90% with load resistance were obtained from all the transformers. The voltage step-up ratio appeared to be proportional to the dot electrode area. A 14 W fluorescent lamp, T5, was successfully driven by all of the fabricated transformers. The transformer with ring/dot electrode area ratio of 4.85 exhibited the best properties in terms of output power, efficiency and characteristic temperature rise, 14.88 W, 98% and 5°C, respectively.

  4. Life Satisfaction, Self-Esteem, and Loneliness Among LGB Adults and Heterosexual Adults in China.

    Science.gov (United States)

    Hu, Jingchu; Hu, Jize; Huang, Gang; Zheng, Xifu

    2016-01-01

    Low levels of life satisfaction have been linked to low self-esteem and loneliness, but this association has never been tested directly in LGB (lesbian/gay/bisexual) populations. We compared 275 Chinese LGB adults to 275 demographic-matched Chinese heterosexual controls on life satisfaction, self-esteem, and loneliness. LGB adults reported lower levels of self-esteem and higher levels of loneliness than heterosexuals, but similar levels of overall life satisfaction. Self-esteem partially mediated (but did not moderate) the relationship between loneliness and life satisfaction in both groups. Hierarchical regressions indicated that demographic variables, loneliness, and self-esteem can predict life satisfaction in both LGB and heterosexual adults, but explained more variance of life satisfaction in the LGB group. Thus self-esteem and loneliness play a more important role in life satisfaction for LGB rather than heterosexual Chinese adults.

  5. Inactivation of colicin Y by intramembrane helix–helix interaction with its immunity protein

    Czech Academy of Sciences Publication Activity Database

    Šmajs, D.; Doležalová, M.; Macek, Pavel; Žídek, L.

    2008-01-01

    Roč. 275, č. 21 (2008), s. 5325-5331 ISSN 1742-464X Institutional research plan: CEZ:AV0Z50200510 Keywords : colicin immunity * colicin y * helix-helix interaction Subject RIV: CE - Biochemistry Impact factor: 3.139, year: 2008

  6. Ideas and Inspirations: Good News about Diabetes Prevention and Management in Indian Country

    Medline Plus

    Full Text Available ... Health Topics Improve Your Health Patient Forms Patients Rights & Responsibilities Purchased/Referred Care (PRC) Social Media Suggestions & ... DSMES Into Your Practice [PDF – 275 KB] In the Spotlight "Wit and Wisdom" is Back – Updated Book ...

  7. Quantum optics, molecular spectroscopy and low-temperaturespectroscopy: general discussion

    Czech Academy of Sciences Publication Activity Database

    Orrit, M.; Evans, G.; Cordes, T.; Kratochvílová, Irena

    2015-01-01

    Roč. 184, Sep (2015), 275-303 ISSN 1359-6640 R&D Projects: GA TA ČR TA04020156 Institutional support: RVO:68378271 Keywords : quantum optics * molecular spectroscopy Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.544, year: 2015

  8. Is diversification history of maize influencing selection of soil bacteria by roots?

    Czech Academy of Sciences Publication Activity Database

    Bouffaud, M.-L.; Kyselková, Martina; Gouesnard, B.; Grundmann, G.; Muller, D.; Moënne-Loccoz, Y.

    2012-01-01

    Roč. 21, č. 1 (2012), s. 195-206 ISSN 0962-1083 Institutional research plan: CEZ:AV0Z60660521 Keywords : bacterial community * plant diversity * rhizosphere * taxonomic microarray Subject RIV: EH - Ecology, Behaviour Impact factor: 6.275, year: 2012

  9. Patterns of Traumatic Intracranial Bleeds at Kenyatta National

    African Journals Online (AJOL)

    Valued eMachines Customer

    Conclusion: Acute subdural hematomas are the commonest traumatic ... Most of the intracranial bleeds were acute, 27.5% (n=14) followed by chronic, 9.8% .... Gentry LR, Godersky JC, Thomson B. MR imaging of head trauma: review of the ...

  10. On the anisotropy of martensitic transformations in Cu-based alloys

    Czech Academy of Sciences Publication Activity Database

    Novák, Václav; Šittner, Petr; Vokoun, D.; Zárubová, Niva

    273-275, - (1999), s. 280-285 ISSN 0921-5093 R&D Projects: GA AV ČR IAA1010621 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.943, year: 1999

  11. Cross-Linked Poly-Vinyl Polymers versus Polyureas as Designed Supports for Catalytically Active M0 Nanoclusters. Part I. Nanometer Scale Structure of the Polyurea Support EnCatTM 40

    Czech Academy of Sciences Publication Activity Database

    Bolfa, C.; Zoleo, A.; Sassi, A.S.; Maniero, A.L.; Pears, D.; Jeřábek, Karel; Corain, B.

    2007-01-01

    Roč. 275, 1-2 (2007), s. 233-239 ISSN 1381-1169 Institutional research plan: CEZ:AV0Z40720504 Keywords : esr spectroscopy * functional resins * nanopores Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.707, year: 2007

  12. Nicholas Thornburg | NREL

    Science.gov (United States)

    -Chemical Engineering Nicholas.Thornburg@nrel.gov | 303-275-4885 Orcid ID http://orcid.org/0000-0002-4680 reaction systems Chemical reaction engineering and reactor design Chemical product design Gas (EXAFS) spectroscopies Education Ph.D., Chemical Engineering, Northwestern University, 2017 B.S

  13. Assessment of shale-oil resources of the Central Sumatra Basin, Indonesia, 2015

    Science.gov (United States)

    Schenk, Christopher J.; Charpentier, Ronald R.; Klett, Timothy R.; Tennyson, Marilyn E.; Mercier, Tracey J.; Brownfield, Michael E.; Pitman, Janet K.; Gaswirth, Stephanie B.; Leathers-Miller, Heidi M.

    2015-11-12

    Using a geology-based assessment methodology, the U.S. Geological Survey estimated means of 459 million barrels of shale oil, 275 billion cubic feet of associated gas, and 23 million barrels of natural gas liquids in the Central Sumatra Basin, Indonesia.

  14. Scratch- and mar-resistant refinish two-pack clear coats – linear versus branched acrylics

    Czech Academy of Sciences Publication Activity Database

    Huybrechts, J.; Vaes, A.; Dušek, Karel; Dušková, Miroslava; Barsotti, R. J.

    2006-01-01

    Roč. 89, B4 (2006), s. 275-283 ISSN 1476-4865 Institutional research plan: CEZ:AV0Z40500505 Keywords : scratch resistance * mar resistance * refinishing two-pack clear coats Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.338, year: 2006

  15. Problém repatriace dětských utečenců z Řecka v politice československého komunistického režimu let 1948-1954

    Czech Academy of Sciences Publication Activity Database

    Hradečný, Pavel

    2004-01-01

    Roč. 90, č. 2 (2004), s. 275-294 ISSN 0037-6922 R&D Projects: GA ČR GA409/03/0138 Institutional research plan: CEZ:AV0Z8015903 Keywords : history * greek-czechoslovak relations * repatriation Subject RIV: AB - History

  16. Optimisation of Lab-Scale Continuous Alcohol-Free Beer Production

    Czech Academy of Sciences Publication Activity Database

    Lehnert, R.; Novák, Pavel; Macieira, F.; Kuřec, M.; Teixeira, J.A.; Brányik, T.

    2009-01-01

    Roč. 27, č. 4 (2009), s. 267-275 ISSN 1212-1800 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol-free beer * continuous reactor * immobilised yeast Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.602, year: 2009

  17. Active substance from some blue green algal species used as ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-10

    May 10, 2010 ... pathogens, has recently received considerable attention as a new source of novel .... mass spectra with the profiles from the Wiley GC-MS 275 libraries. Khairy and ..... Selective isolation of blue-green algae from water and soil ...

  18. Modo in Quadragesimale Admontense

    Czech Academy of Sciences Publication Activity Database

    Nývlt, Pavel

    2014-01-01

    Roč. 137, 3/4 (2014), s. 275-292 ISSN 0024-4457 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval Latin * lexicography * particles in medieval Latin * conjunctions in medieval Latin Subject RIV: AI - Linguistics

  19. 75 FR 29914 - Telecommunications Relay Services, Speech-to-Speech Services, E911 Requirements for IP-Enabled...

    Science.gov (United States)

    2010-05-28

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 64 [CG Docket No. 03-123; WC Docket No. 05-196; FCC 08-275] Telecommunications Relay Services, Speech-to-Speech Services, E911 Requirements for IP... with the Commission's Telecommunications Relay Services, [[Page 29915

  20. Condensation reactions catalyzed by α-N-acetylgalactosaminidase from Aspergillus niger yielding a-N-acetylgalactosaminides

    Czech Academy of Sciences Publication Activity Database

    Weignerová, Lenka; Pelantová, Helena; Manglová, Dana; Michálková, Klára; Křen, Vladimír

    2010-01-01

    Roč. 28, č. 2 (2010), s. 150-155 ISSN 1024-2422 R&D Projects: GA MŠk OC 136 Keywords : alpha-N-Acetylgalactosaminidase * amino acid glycosylation * enzymatic glycosylation Subject RIV: EE - Microbiology, Virology Impact factor: 1.275, year: 2010

  1. Organisational Commitment, Job Satisfaction and Turnover ...

    African Journals Online (AJOL)

    This study investigated organisational commitment, job satisfaction and turnover intentions among records management personnel in Ondo State Civil Service, Akure, Nigeria. Simple random sampling technique was used to draw 240 subjects from a population size of 275 records management personnel.

  2. Recruitment Strategies and Activities Used by Agriculture Teachers.

    Science.gov (United States)

    Myers, Brian E.; Dyer, James E.; Breja, Lisa M.

    2003-01-01

    The most frequent student recruitment strategies reported by 275 secondary agriculture teachers were (in order of effectiveness) feeder schools, personal contacts, FFA, publications, strong curriculum, support groups, and special events. Specific activities for each strategy were identified. (Contains 34 references.) (SK)

  3. 78 FR 13664 - Piedmont Triad Regional Water Authority; Notice of Termination of Exemption by Implied Surrender...

    Science.gov (United States)

    2013-02-28

    ... intake canal; (5)a penstock off the right side of the intake canal;(6) a powerhouse with two turbine/ generator units operating at a hydraulic head of 16-feet for a total installed capacity of 275 kW; (7)a 50...

  4. 26 CFR 25.2502-1 - Rate of tax.

    Science.gov (United States)

    2010-04-01

    ... of this section with respect to gifts made by citizens or residents of the United States: Example 1...,635 (5) Tax computed on item (2) 10,275 (6) Tax for year (item (4) minus item (5)) 3,360 Example 5. A...

  5. Seed dispersal by fishes in tropical and temperate fresh waters: The growing evidence

    NARCIS (Netherlands)

    Horn, M.H.; Correa, S.B.; Parolin, P.; Pollux, B.J.A.; Anderson, J.T.; Lucas, C.; Widmann, P.; Tjiu, A.; Galetti, M.; Goulding, M.

    2011-01-01

    Fruit-eating by fishes represents an ancient (perhaps Paleozoic) interaction increasingly regarded as important for seed dispersal (ichthyochory) in tropical and temperate ecosystems. Most of the more than 275 known frugivorous species belong to the mainly Neotropical Characiformes (pacus, piranhas)

  6. Analysis of efflorescence on surface of beeswax seals

    Czech Academy of Sciences Publication Activity Database

    Bartl, B.; Trejbal, J.; Ďurovič, M.; Vašíčková, Soňa; Valterová, Irena

    2012-01-01

    Roč. 13, č. 3 (2012), s. 275-284 ISSN 1296-2074 Institutional research plan: CEZ:AV0Z40550506 Keywords : beeswax bloom * (Z)-tritriacont-10-ene * efflorescence * unsaturated hydrocarbons Subject RIV: CC - Organic Chemistry Impact factor: 1.176, year: 2012

  7. Utilization Status of Electronic Information Sources (EIS) for HIV ...

    African Journals Online (AJOL)

    Tesfa

    2017-09-01

    Sep 1, 2017 ... currently married and the mean family members ... mean length of work experience of the ... Female. 87. 27.5. Religion. Orthodox. 111. 35.0. Protestant. 173. 54.6 ... Unmarried ... fourth, 78.4%, were not satisfied on the current.

  8. Guilty by association: olympic law and the IP effect / Mark James, Guy Osborn

    Index Scriptorium Estoniae

    James, Mark

    2013-01-01

    Intellektuaalse omandi kaitsest seoses olümpiamängudega seotud sümbolite ja kaubamärkidega Londoni 2012. aasta olümpiamängude näitel. Vaata ka vastukaja artiklile: Intellectual Property Quarterly (2013) nr 3, lk. 275-277

  9. Hegelova teorie mravního státu

    Czech Academy of Sciences Publication Activity Database

    Chotaš, Jiří

    2003-01-01

    Roč. 51, č. 2 (2003), s. 275-291 ISSN 0015-1831 R&D Projects: GA ČR GA401/03/0863 Institutional research plan: CEZ:AV0Z9009908 Keywords : state * ethical state * Hegel * Popper Subject RIV: AA - Philosophy ; Religion

  10. Department of Agricultural Extension and Rural Development ...

    African Journals Online (AJOL)

    USER

    2017-03-20

    Mar 20, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(2): 262 – 275, 2017. ISSN:1998-0507 ... providing farmers with appropriate innovations on environmental management and protection. ..... Fish wealth solution. African Journal of. Environmental. Science and ... Agricultural Development Project.

  11. Occupational induced health problems in floriculture workers in ...

    African Journals Online (AJOL)

    admin

    workers who did not use personal protective equipment properly, and odds of reported symptoms of disease were 2.75. (95% CI 1.15- ... workers is intense and acute in closed plastic ..... that has poster which shows spraying time and entry.

  12. Prevalência de idosos restritos ao domicílio em região metropolitana de Belo Horizonte (Minas Gerais, Brasil Prevalence of housebound elderly people in the urban region of Belo Horizonte (Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Príscila Guedes Santana Ursine

    2011-06-01

    Full Text Available Este artigo tem por objetivo estimar a prevalência e o perfil sociodemográfico e de saúde dos idosos restritos ao domicílio adscritos a uma unidade de saúde da família da região metropolitana de Belo Horizonte (Minas Gerais. Realizou-se inquérito domiciliar no período de maio a julho de 2006 com 275 idosos selecionados através de amostragem por conglomerados. Utilizou-se a suíte svy do aplicativo Stata 9.0 para lidar adequadamente com a estrutura amostral de conglomeração e permitir a incorporação das frações de expansão nas análises. Dos 275 idosos entrevistados, 22,4% (IC95%: 14,7; 32,4 eram restritos ao domicílio. A prevalência dessa condição foi maior entre as mulheres, entre os indivíduos com 80 anos ou mais e entre aqueles com suspeita de déficit cognitivo (p-valor The aim of this article is to estimate the prevalence and the socio-demographic and health profile of housebound elderly people registered at a Family Health Unit in the urban region of Belo Horizonte (Minas Gerais, Brazil. A household survey was conducted between May and July 2006 with 275 elderly people selected via cluster sampling. The svy suite of commands in Stata 9.0 was used to deal adequately with the cluster sample structure and to allow the incorporation of fractions of expansion in the analyses. Among the 275 elderly, 22.4% (IC95%: 14.7; 32.4 were restricted to their homes. The prevalence of this condition was greater among women, people over 80 and suspected of suffering from cognitive impairment (p-valor < 0.05. The majority of housebound people had incomes below the minimum wage, reported history of falls, depression and indicated physical disorders as the cause of the restriction. The large contingent of low-income housebound elderly with several health problems, reinforces the need for incorporation of proposals for promotion and vigilance of the health of the elderly, which extend beyond the boundaries of the healthcare units.

  13. Hubble Space Telescope  Wide Field Camera 3 Observations of Escaping Lyman Continuum Radiation from Galaxies and Weak AGN at Redshifts z ∼ 2.3–4.1

    Science.gov (United States)

    Smith, Brent M.; Windhorst, Rogier A.; Jansen, Rolf A.; Cohen, Seth H.; Jiang, Linhua; Dijkstra, Mark; Koekemoer, Anton M.; Bielby, Richard; Inoue, Akio K.; MacKenty, John W.; O’Connell, Robert W.; Silk, Joseph I.

    2018-02-01

    We present observations of escaping Lyman Continuum (LyC) radiation from 34 massive star-forming galaxies (SFGs) and 12 weak AGN with reliably measured spectroscopic redshifts at z≃ 2.3{--}4.1. We analyzed Hubble Space Telescope (HST) Wide Field Camera 3 (WFC3) mosaics of the Early Release Science (ERS) field in three UVIS filters to sample the rest-frame LyC over this redshift range. With our best current assessment of the WFC3 systematics, we provide 1σ upper limits for the average LyC emission of galaxies at = 2.35, 2.75, and 3.60 to ∼28.5, 28.1, and 30.7 mag in image stacks of 11–15 galaxies in the WFC3/UVIS F225W, F275W, and F336W, respectively. The LyC flux of weak AGN at = 2.62 and 3.32 are detected at 28.3 and 27.4 mag with S/Ns of ∼2.7 and 2.5 in F275W and F336W for stacks of 7 and 3 AGN, respectively, while AGN at = 2.37 are constrained to ≳27.9 mag at 1σ in a stack of 2 AGN. The stacked AGN LyC light profiles are flatter than their corresponding non-ionizing UV continuum profiles out to radii of r≲ 0\\buildrel{\\prime\\prime}\\over{.} 9, which may indicate a radial dependence of porosity in the ISM. With synthetic stellar SEDs fit to UV continuum measurements longward of {{Ly}}α and IGM transmission models, we constrain the absolute LyC escape fractions to {f}{esc}{abs}≃ {22}-22+44% at = 2.35 and ≲55% at = 2.75 and 3.60, respectively. All available data for galaxies, including published work, suggests a more sudden increase of {f}{esc} with redshift at z≃ 2. Dust accumulating in (massive) galaxies over cosmic time correlates with increased H I column density, which may lead to reducing {f}{esc} more suddenly at z≲ 2. This may suggest that SFGs collectively contributed to maintaining cosmic reionization at redshifts z≳ 2{--}4, while AGN likely dominated reionization at z≲ 2.

  14. The Mediator Effect of Career Development between Personality Traits and Organizational Commitment: The Example of Sport Communication Technology Talents

    Science.gov (United States)

    Lo, Hung-Jen; Lin, Chun-Hung; Tung-Hsing, Lin; Tu, Peng-Fei

    2014-01-01

    This paper explored the relationships among career development, personality trait, and organizational commitment and examines whether career development mediates the relationship between personality trait and organizational commitment. The sample was 275 sport communication technology talents in Taiwan. The instrument included the Personality…

  15. Media as the mechanism behind structural coupling and the evolution of the mind

    DEFF Research Database (Denmark)

    Tække, Jesper

    Luhmann (2002, 275), in his introduction to the systems theory, explicitly writs, that language is the mechanism behind the structural coupling between psychic – and social systems. This paper, in its first part, provides an interpretative and selective presentation of Luhmann’s argumentation...

  16. Opportunity or Obligation? Participation in Adult Vocational Training.

    Science.gov (United States)

    Hemsley-Brown, Jane; Humphreys, John

    1998-01-01

    British nurses (n=275), many of whom had to upgrade skills for conversion to registered nursing, participated in an upskilling exercise. Participants and a comparison group of nonparticipants were categorized as either opportunity-takers or conscripts (those who viewed retraining as obligatory). (SK)

  17. Economic Impacts and Business Opportunities | NREL

    Science.gov (United States)

    Economic Impacts and Business Opportunities Economic Impacts and Business Opportunities NREL corporations alike. Colorado flag Economic Impact The economic impact of NREL operations on the nation totaled Jefferson County where the economic benefit totaled $275 million in 2014. Growth chart Economic Benefit NREL

  18. Does sea level pressure modulate the dynamic and thermodynamic forcing in the tropical Indian Ocean?

    Digital Repository Service at National Institute of Oceanography (India)

    Nisha, P.G.; Muraleedharan, P.M.; Keerthi, M.G.; Sathe, P.V.; Ravichandran, M.

    place marks the threshold SST which appears to have an inherent relationship with the SLP, especially when the ocean–atmosphere system is coupled. North of 5 degrees S, the LHF peaks at the threshold SST of 27.5 degrees C and decreases gradually...

  19. A Formula for Making Every Hour Count

    Science.gov (United States)

    Warihay, Philomena

    1978-01-01

    Making people aware of how they use--and waste--time must be the first step in any program to increase office productivity. Available from Geyer-McAllister Publications, Inc., 51 Madison Avenue, New York, New York 10010; single issue $2.75. (Author)

  20. Monitoring the behaviour of 4-ketocyclophosphamide versus cyclophosphamide during capillary gas chromatography by mass spectrometry

    NARCIS (Netherlands)

    Bruijn, de E.A.; Oosterom, van A.T.; Leclercq, P.A.; Haan, de J.W.; Ven, van de L.J.M.; Tjaden, U.R.

    1987-01-01

    Capillary Gas Chromatography (CGC) is capable of determining underivatized cyclophosphamide (CPA) using SCOT OV 275 columns. Then CPA is subjected to in situ degradation resulting in formation of a cyclization product which can be determined selectively in biological fluids. In routine bioanalysis

  1. Modified low-grade aluminosilicates as efective sorbents of hazardeous axyanions from aqueous systems

    Czech Academy of Sciences Publication Activity Database

    Doušová, B.; Fuitová, L.; Hercogová, J.; Grygar, Tomáš; Koloušek, D.; Machovič, Vladimír

    2009-01-01

    Roč. 6, č. 2 (2009), s. 193-200 ISSN 1214-9705 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z30460519 Keywords : toxic oxyanions * adsorption * Fe/Al/Mn modification Subject RIV: DD - Geochemistry Impact factor: 0.275, year: 2009

  2. Pitfalls using tributyrin agar screening to detect lipolytic activity in ...

    African Journals Online (AJOL)

    ONOS

    2010-07-05

    Jul 5, 2010 ... lysis and synthesis of acylglycerides and other fatty acid esters. The true ... the addition of 1 M sodium hydroxide. Following treatment, DNA ... After cooling, 275 µl 7 M ammonium acetate (pH 7) was added, incubated for 5 min ...

  3. Computers, pattern, chaos and beauty

    CERN Document Server

    Pickover, Clifford A

    1980-01-01

    Combining fractal theory with computer art, this book introduces a creative use of computers. It describes graphic methods for detecting patterns in complicated data and illustrates simple techniques for visualizing chaotic behavior. ""Beautiful."" - Martin Gardner, Scientific American. Over 275 illustrations, 29 in color.

  4. Natural gas industry in Iran

    Energy Technology Data Exchange (ETDEWEB)

    Omidvar, Hedayat

    2010-09-15

    Iran holds the second largest gas reserves in the word with over 27.5 trillion cubic meters (TCM) of natural gas. Due to lack of geological surveys in certain geographical regions in Iran, it is likely to explore further reserves in the future.

  5. Renal injury is accelerated by global hypoxia-inducible factor 1 alpha deficiency in a mouse model of STZ-induced diabetes

    Czech Academy of Sciences Publication Activity Database

    Bohuslavová, Romana; Čerychová, Radka; Nepomucká, Kateřina; Pavlínková, Gabriela

    2017-01-01

    Roč. 17, č. 1 (2017), č. článku 48. ISSN 1472-6823 Institutional support: RVO:86652036 Keywords : Diabetic complications * Diabetic nephropathy * Hypoxia Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition OBOR OECD: Urology and nephrology Impact factor: 2.275, year: 2016

  6. A new [(1R,2R)-1,2-diaminocyclohexane]platinum(II) complex: formation by nitrate-acetonitrile ligand exchange

    Czech Academy of Sciences Publication Activity Database

    Pažout, R.; Housková, J.; Dušek, Michal; Maixner, J.; Cibulková, J.; Kačer, P.

    2010-01-01

    Roč. 66, Part 10 (2010), m273-m275 ISSN 0108-2701 Institutional research plan: CEZ:AV0Z10100521 Keywords : platinum complexes * structure analysis * disorder * cyclohexane * diamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.745, year: 2010

  7. Sadhana – Academy Proceedings in Engineering Sciences: A ...

    Indian Academy of Sciences (India)

    collaboration in research work. Table 4 explains the authorship pattern of contributions volume-wise. Regarding contributions by single author, the volume number 31 records the highest percentage (27.5%). Regarding two authors contributions, the volume 32 shows maximum percentage (25.58%). Regarding three.

  8. Doctor Blade-Coated Polymer Solar Cells

    KAUST Repository

    Cho, Nam Chul; Kim, Jong H.

    2016-01-01

    In this work, we report polymer solar cells based on blade-coated P3HT:PC71BM and PBDTTT-EFT:PC71BM bulk heterojunction photoactive layers. Enhanced power conversion efficiency of 2.75 (conventional structure) and 3.03% (inverted structure

  9. Gastrointestinal Parasites of Two Populations of Arctic Foxes (Vulpes lagopus) from Northeast Greenland

    DEFF Research Database (Denmark)

    Andreassen, P.N.S.; Schmidt, Niels Martin; Kapel, Christian M. O.

    2017-01-01

    Parasitological examination of 275 faecal samples from Arctic foxes (Vulpes lagopus) collected at Zackenberg Valley and Karupelv Valley in north-east Greenland from 2006 to 2008 was conducted using sieving and microscopy. Overall, 125 (45.5%) samples contained parasite eggs of Taenia crassiceps...

  10. The phylogeny and evolution of the genus Claviceps

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie

    2001-01-01

    Roč. 105, - (2001), s. 275-283 ISSN 0953-7562 R&D Projects: GA ČR GA206/97/0611 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 1.346, year: 2001

  11. FIS STUDY FOR CLARION COUNTY, PA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This is a revised preliminary to case 11-03-1438S, adding 11.3 miles of new Zone AE study on Allegheny River and updating a 2.75 mile Zone AE detailed study on...

  12. Bulletin of Animal Health and Production in Africa - Vol 62, No 3 (2014)

    African Journals Online (AJOL)

    Co-administration of Albendazole and Levamisole to control multiple anthelmintic resistant nematodes in a sheep farm in Kabete Kenya · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CJ Nganga, DW Gakuya, RO Otieno, RW Githinji, 275-278 ...

  13. Development of depressive symptoms and depression during organizational change--a two-year follow-up study of civil servants

    DEFF Research Database (Denmark)

    Netterstrøm, Bo; Blønd, Morten; Nielsen, Martin

    2010-01-01

    On 1 January 2007, Denmark went through a major reorganization, where most of its 275 municipalities and 14 counties merged into larger units. Our study aimed to examine the development of depressive symptoms and incident depression among employees affected by this organizational change....

  14. Measuring the readability of sustainability reports: : A corpus-based analysis through standard formulae and NLP

    NARCIS (Netherlands)

    Smeuninx, N.; De Clerck, B.; Aerts, Walter

    2016-01-01

    This study characterises and problematises the language of corporate reporting along region, industry, genre, and content lines by applying readability formulae and more advanced natural language processing (NLP)–based analysis to a manually assembled 2.75-million-word corpus. Readability formulae

  15. Contrasting petrogenesis of spatially related carbonatites from Samalpatti and Sevattur, Tamil Nadu, India

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Magna, T.; Rapprich, V.; Upadhyay, D.; Krátký, O.; Čejková, B.; Erban, V.; Kochergina, Y. V.; Hrstka, Tomáš

    284/285, 1 July (2017), s. 257-275 ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : carbonatite * geochemistry * Samalpatti * Sevattur * silicocarbonatite * Sr–Nd–Pb–C–O isotopic systematics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  16. Markers of oxidative and antioxidative activity in female dogs with mammary gland tumour with and without additional vitamin E supplementation

    Czech Academy of Sciences Publication Activity Database

    Stavinohová, R.; Lorenzová, J.; Papežíková, I.; Borkovcová, I.; Pfeifr, J.; Lojek, Antonín; Mrázová, M.; Crha, M.

    2012-01-01

    Roč. 81, č. 3 (2012), s. 275-280 ISSN 0001-7213 Grant - others:Veterinární a farmaceutická univerzita(CZ) 62 Institutional support: RVO:68081707 Keywords : Mastectomy * ovariohysterectomy * alpha-tocopherol Subject RIV: BO - Biophysics Impact factor: 0.393, year: 2012

  17. Kdo byl Georg Placzek (1905-1955)

    Czech Academy of Sciences Publication Activity Database

    Gottvald, Aleš

    2005-01-01

    Roč. 55, č. 3 (2005), s. 275-287 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20650511 Keywords : Georg Placzek * the oretical physics * history of physics * nuclear physics * Manhattan project * spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  18. Gastrointestinal Parasites of Two Populations of Arctic Foxes (Vulpes lagopus) from Northeast Greenland

    DEFF Research Database (Denmark)

    Andreassen, P.N.S.; Schmidt, Niels Martin; Kapel, Christian M. O.

    2017-01-01

    Parasitological examination of 275 faecal samples from Arctic foxes (Vulpes lagopus) collected at Zackenberg Valley and Karupelv Valley in north-east Greenland from 2006 to 2008 was conducted using sieving and microscopy. Overall, 125 (45.5%) samples contained parasite eggs of Taenia crassiceps...

  19. Gambler’s fallacy and imperfect best response in legislative bargaining

    Czech Academy of Sciences Publication Activity Database

    Nunnari, S.; Zápal, Jan

    2016-01-01

    Roč. 99, September (2016), s. 275-294 ISSN 0899-8256 R&D Projects: GA ČR(CZ) GP14-27902P Institutional support: PRVOUK-P23 Keywords : legislative bargaining * experiments * quantal response Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

  20. Changes in Nafion® 117 internal structure and related properties during exposure to elevated temperature and pressure in an aqueous environment

    Czech Academy of Sciences Publication Activity Database

    Mališ, J.; Paidar, M.; Bystroň, T.; Brožová, Libuše; Zhigunov, Alexander; Bouzek, K.

    2018-01-01

    Roč. 262, 1 February (2018), s. 264-275 ISSN 0013-4686 Institutional support: RVO:61389013 Keywords : Nafion * elevated temperature * excessive swelling Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

  1. Violent women : A multicentre study into gender differences in forensic psychiatric patients

    NARCIS (Netherlands)

    de Vogel, Vivienne; Stam, Jeantine; Bouman, Yvonne H. A.; Ter Horst, P.R.M.; Lancel, Marike

    2016-01-01

    To gain insight into the relatively small, but increasing group of women in forensic psychiatry, a retrospective multicentre study was started gathering information from the files of 275 female patients of four Dutch forensic psychiatric hospitals on characteristics and violence risk factors.

  2. Tiger Nut

    African Journals Online (AJOL)

    proximate analysis show brown yellow variety had higher ash, crude protein and crude fiber contents with values of 1.85%, 2.75% and ... wooden mortar and pestle until a fine powder was obtained to .... from tiger nut so as to boost economic.

  3. Case Study: Intra-abdominal hypertension

    African Journals Online (AJOL)

    2014-05-05

    May 5, 2014 ... his weight estimated to be 75 kg, with a body mass index (BMI) of 27.5kg/m2. ... critically ill adults).1 During the laparotomy, a diagnosis of intra- ... Peer reviewed. ..... Best practices for determining resting energy expenditure in.

  4. Antagonism of Taxol Cytotoxicity by Prolactin: Implication for Patient Resistance to Chemotherapy

    Science.gov (United States)

    2008-03-01

    often occurs during adolescence . When both estrogen and PRL are elevated, men can have galactorrhea, or inap- propriate milk production (246, 275...Women treated with oral contraceptives or postmenopausal hormone replacement therapy do not have a higher inci- dence of prolactinomas. Statements on

  5. Unbehaglich

    Directory of Open Access Journals (Sweden)

    Diemut Majer

    2012-01-01

    Full Text Available Rezension von: Gaby Temme und Christine Künzel (Hg., Hat Strafrecht ein Geschlecht? Zur Deutung und Bedeutung der Kategorie Geschlecht in strafrechtlichen Diskursen vom 18. Jahrhundert bis heute, Bielefeld: Transcript 2010, 275 S., ISBN 978-3-8376-1384-1

  6. REVIEW ARTICLE Venous thromboembolism associated with ...

    Indian Academy of Sciences (India)

    Navya

    2017-03-24

    Mar 24, 2017 ... It has been long recognized that reduced PS activity is a risk factor for venous .... individual had PS deficiency type I but was unavailable for DNA .... Influence of PROS1 gene mutations affecting protein S amino-acid 275 on ...

  7. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-10

    Nov 10, 2017 ... that the thermodynamic properties of molecules at the air/water interface. .... first and second peaks in SBL-Cl and SBL-Br which are 242 nm and 275 ... By using Beer-Lambert Law, the molar absorptivity for both ligands were ...

  8. 77 FR 77079 - Agency Information Collection Activities: Proposed Collection: Comment Request

    Science.gov (United States)

    2012-12-31

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Resources and Services Administration Agency.... L. 104-13), the Health Resources and Services Administration (HRSA) publishes periodic summaries of... Medicare Improvements for Patients and Providers Act of 2008, Public Law 110-275, is to support...

  9. Jing Tong Yu Shu, a traditional Chinese medicine, suppresses IL-1β ...

    African Journals Online (AJOL)

    Zhang et al. 2953. Tropical ... Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a ..... Flower A, Liu JP, Chen S, Lewith G, Little P. Chinese ... Mol Hum Reprod 2000; 6: 269-275. 18.

  10. Long-wavelength character of subducted slabs in the lower mantle

    Czech Academy of Sciences Publication Activity Database

    Běhounková, Marie; Čížková, H.

    2008-01-01

    Roč. 275, 1-2 (2008), s. 43-53 ISSN 0012-821X Institutional research plan: CEZ:AV0Z30120515 Keywords : subduction process * slab thickening * non-linear rheology * tomography Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 3.955, year: 2008

  11. Karlynn Cory | NREL

    Science.gov (United States)

    . Research Interests Clean energy project financing Renewable energy techno-economic analysis Distributed Karlynn Cory Photo of Karlynn Cory Karlynn Cory Group Manager - Project Development & Finance Karlynn.Cory@nrel.gov | 303-275-3087 Karlynn Cory is the Group Manager for Project Development & Finance in

  12. Color center lasers passively mode locked by quantum wells

    International Nuclear Information System (INIS)

    Islam, M.N.; Soccolich, C.E.; Bar-Joseph, I.; Sauer, N.; Chang, T.Y.; Miller, B.I.

    1989-01-01

    This paper describes how, using multiple quantum well (MQW) saturable absorbers, the authors passively mode locked a NaCl color center laser to produce 275 fs transform-limited, pedestal-free pulses with as high as 3.7 kW peak power. The pulses are tunable from λ = 1.59 to 1.7 μm by choosing MQW's with different bandgaps. They shortened the output pulses from the laser to 25 fs using the technique of soliton compression in a fiber. The steady-state operation of the laser requires the combination of a fast saturable absorber and gain saturation. In addition to the NaCl laser, they passively mode locked a Tl 0 (1):KCl color center laser and produced -- 22 ps pulses. Although the 275 fs pulses from the NaCl laser are Gaussian, when broadened, the pulses acquire an asymmetric spectrum because of carrier-induced refractive index changes

  13. Genetic diversity analysis of Zingiber Officinale Roscoe by RAPD collected from subcontinent of India.

    Science.gov (United States)

    Ashraf, Kamran; Ahmad, Altaf; Chaudhary, Anis; Mujeeb, Mohd; Ahmad, Sayeed; Amir, Mohd; Mallick, N

    2014-04-01

    The present investigation was undertaken for the assessment of 12 accessions of Zingiber officinale Rosc. collected from subcontinent of India by RAPD markers. DNA was isolated using CTAB method. Thirteen out of twenty primers screened were informative and produced 275 amplification products, among which 261 products (94.90%) were found to be polymorphic. The percentage polymorphism of all 12 accessions ranged from 88.23% to 100%. Most of the RAPD markers studied showed different levels of genetic polymorphism. The data of 275 RAPD bands were used to generate Jaccard's similarity coefficients and to construct a dendrogram by means of UPGMA. Results showed that ginger undergoes genetic variation due to a wide range of ecological conditions. This investigation was an understanding of genetic variation within the accessions. It will also provide an important input into determining resourceful management strategies and help to breeders for ginger improvement program.

  14. Can low BMI Chinese patients with type 2 diabetes benefit from laparoscopic Roux-en-Y gastric bypass surgery?

    Science.gov (United States)

    Wang, Guohui; Zhu, Liyong; Li, Weizheng; Yang, Xiangwu; Li, Pengzhou; Zhu, Shaihong

    2016-12-01

    The efficacy of laparoscopic Roux-en-Y gastric bypass (LRYGB) in type 2 diabetes mellitus (T2D) is closely associated with the preoperative body mass index (BMI) of the patient. There is a lack of long-term and large sampling evidence on the efficacy of LRYGB in T2D patients with low BMI in China. This retrospective study aimed to evaluate the efficacy of surgical treatment in a Chinese population with T2D (especially patients with BMIBMI≥27.5 kg/m 2 in group 1 (high BMI group) had significant improvements in waist circumference, blood glucose levels, homeostasis model assessment-insulin resistance index, and C-peptide levels after LRYGB (PBMIBMI group, including 19 T2D patients with BMIBMI<27.5 kg/m 2 in China. Copyright © 2016 American Society for Bariatric Surgery. Published by Elsevier Inc. All rights reserved.

  15. The behavior of self-compacting concrete (SCC) with bagasse ash

    Science.gov (United States)

    Hanafiah, Saloma, Whardani, Putri Nurul Kusuma

    2017-11-01

    Self-Compacting Concrete (SCC) has the ability to flow and self-compacting. One of the benefit of SCC can reduced the construction time and labor cost. The materials to be used for see slightly different with the conventional concrete. Less coarse aggregate to be used up to 50%. The maximum size of coarse aggregate was also limited e.g. 10 mm. Other material was quartz sand with grain size of 50-650 µm. For reducing the around of cement, bagasse ash was used as partial replacement of cement. In this research, the variations of w/c to be used, e.g. 0.275, 0.300, 0.325 and the percentage of bagasse ash substitution were 10%, 15%, and 20%. EFNARC standard was conducted for slump flow test following the V-funnel test and L-box shape test. The maximum value of slump flow test was 75.75 cm, V-funnel test was 4.95 second, and L-box test was 1.000 yielded by mixture with w/c = 0.325 and 0% of bagasse ash. The minimum value of slump flow test was 61.50 cm, V-funnel test is 21.05 second, and L-box test was 0.743 yielded by mixture with w/c = 0.275 and 20% of bagasse ash. The maximum value of compressive strength was 67.239 MPa yielded by mixture with w/c = 0.275 and 15% of bagasse ash. And the minimum value of compressive strength was 41.813 MPa yielded by mixture with w/c = 0.325 and 20% bagasse ash.

  16. [Study on the correlation between PMI and OD changes in rat's plasma].

    Science.gov (United States)

    Li, Wei; Ke, Yong; He, Guang-she; Xu, Yong-cheng; Wang, Zhen-yuan

    2008-12-01

    We chose the UV-Vis spectrophotometry as a new way to investigate the postmortem interval (PMI). One hundred fifty Sprague-Dawley female rats (weight 260 g +/- 10 g, from Xi'an Jiaotong University Animal Center) were chosen and sacrificed by cervical dislocation. The bodies were kept in a controlled environmental chamber set at (20 +/- 2) degrees C. The plasma was harvested in course of 0 to 24 hours after death. The optical density (OD) at different wavelengths was measured with an UV-Vis spectrophotometer (type-UV250). It was shown that the OD changes of plasma at 577, 416 and 275 nm in 24 hours were dramatically related to PMI, and the R-indexes were 0.969, 0.97 and 0.898. The regression formulae of these indexes were worked out taking OD as independent variable, and PMI as variable. The quadratic equations were: PMI = 231.2270D(plasma at wavelength of 577 nm) - 501.160D(plasma at wavelength of 577 nm)2 - 3.0809(R2 = 0.945), PMI = 31.7426OD(plasma at wavelength of 416 nm) - 9.1847OD(plasma at wavelength of 416 nm)2 - 31837(R2 = 0.94), and PMI = 95.2388OD(plasma at wavelength of 275 nm) - 39.343OD(plama at wavelength of 275 nm)2 - 32.408(R2 = 0.795). It was concluded that the OD changes of rat's plasma are good and potential markers for the estimation of PMI and should be very useful in forensic practice.

  17. In vivo architectural analysis of clear corneal incisions using anterior segment optical coherence tomography.

    Science.gov (United States)

    Dupont-Monod, Sylvère; Labbé, Antoine; Fayol, Nicolas; Chassignol, Alexis; Bourges, Jean-Louis; Baudouin, Christophe

    2009-03-01

    To use anterior segment optical coherence tomography (AS-OCT) to analyze the in vivo architecture of clear corneal incisions after phacoemulsification using different techniques. Department of Ophthalmology, Quinze-Vingts National Ophthalmology Hospital, Paris, France. This prospective observational study analyzed clear corneal incisions used in phacoemulsification. All wounds were evaluated 1 day and 8 days postoperatively by AS-OCT (Visante). Incision architecture and pachymetry at the wound level were analyzed. Thirty-five clear corneal incisions were analyzed. Six eyes had 2.75 mm coaxial phacoemulsification, 19 had 2.20 mm microincision coaxial phacoemulsification, and 10 had 1.30 mm bimanual microincision phacoemulsification. The 1.30 mm incision had a straight-line configuration. The 2.20 mm and 2.75 mm incisions had an arcuate configuration. The angles of incidence of 1.30 mm incisions were greater than those of 2.20 mm incisions (P<.001). All incisions had slight corneal edema limited to the incision area. The edema was slightly greater around 1.30 mm incisions (mean pachymetry 1143 microm +/- 140 [SD]) than around 2.20 mm incisions (mean 1012 +/- 101 microm) (P = .001). Bimanual procedures had satisfactory endothelial apposition in the enlarged areas, where stromal edema was less than that surrounding the unenlarged 1.30 mm incisions. The 3 phacoemulsification techniques induced gaping of the endothelial edge, minor inadequate endothelial apposition, and mild stromal edema in the area of the clear corneal incisions. Bimanual microincision sleeveless phacoemulsification may alter the wound slightly more than coaxial 2.75 mm and microcoaxial 2.20 mm sleeved-tip phacoemulsification.

  18. Gestational age and birth weight centiles of singleton babies delivered normally following spontaneous labor, in Southern Sri Lanka

    Science.gov (United States)

    Attanayake, K; Munasinghe, S; Goonewardene, M; Widanapathirana, P; Sandeepani, I; Sanjeewa, L

    2018-03-31

    To estimate the gestational age and birth weight centiles of babies delivered normally, without any obstetric intervention, in women with uncomplicated singleton pregnancies establishing spontaneous onset of labour. Consecutive women with uncomplicated singleton pregnancies, attending the Academic Obstetrics and Gynecology Unit of the Teaching Hospital Mahamodara Galle, Sri Lanka, with confirmed dates and establishing spontaneous onset of labor and delivering vaginally between gestational age of 34 - 41 weeks, without any obstetric intervention , during the period September 2013 to February 2014 were studied. The gestational age at spontaneous onset of labor and vaginal delivery and the birth weights of the babies were recorded. There were 3294 consecutive deliveries during this period, and of them 1602 (48.6%) met the inclusion criteria. Median gestational age at delivery was 275 days (range 238-291 days, IQR 269 to 280 days) and the median birth weight was 3000 g (range1700g - 4350g; IQR 2750-3250g). The 10th, 50th and 90th birth weight centiles of the babies delivered at a gestational age of 275 days were approximately 2570g, 3050g and 3550g respectively. The median gestational age among women with uncomplicated singleton pregnancies who established spontaneous onset of labor and delivered vaginally, without any obstetric intervention, was approximately five days shorter than the traditionally accepted 280 days. At a gestational age of 275 days, the mean birth weight was approximately 3038g and the 50th centile of the birth weight of the babies delivered was approximately 3050g.

  19. 41 CFR 101-27.503 - Allowable credit.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Allowable credit. 101-27.503 Section 101-27.503 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.5...

  20. Cold Response of Dedifferentiated Barley Cells at the Gene Expression, Hormone Composition, and Freezing Tolerance Levels: Studies on Callus Cultures

    Czech Academy of Sciences Publication Activity Database

    Vashegyi, I.; Marozsan-Toth, Z.; Galiba, G.; Dobrev, Petre; Vaňková, Radomíra; Toth, B.

    2013-01-01

    Roč. 54, č. 2 (2013), s. 337-349 ISSN 1073-6085 R&D Projects: GA ČR GA522/09/2058 Institutional research plan: CEZ:AV0Z50380511 Keywords : ABA * Barley * Callus Subject RIV: ED - Physiology Impact factor: 2.275, year: 2013

  1. South African Medical Journal - Vol 88, No 3 (1998)

    African Journals Online (AJOL)

    Tuberculosis and anorexia nervosa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Christopher Paul Szabo, 275-276. Books Advances in Pediatric Pulmonology. Pediatric and Adolescent Medicine Vol. 7 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  2. Morphology evolution during cooling of quiescent immiscible polymer blends: matrix crystallization effect on the dispersed phase coalescence

    Czech Academy of Sciences Publication Activity Database

    Dimzoski, Bojan; Fortelný, Ivan; Šlouf, Miroslav; Sikora, Antonín; Michálková, Danuše

    2013-01-01

    Roč. 70, č. 1 (2013), s. 263-275 ISSN 0170-0839 R&D Projects: GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * coalescence * morphology evolution Subject RIV: BJ - Thermodynamics Impact factor: 1.491, year: 2013

  3. Latest AMS Results: The Positron Fraction and the p-bar/p Ratio

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    A precision measurement by AMS of the positron fraction in primary cosmic rays is presented. The results show that at 275±32 GeV the positron fraction no longer increases with energy. The current status of the anti-proton analysis is also presented.

  4. Documentation of 50% water conservation in a single process at a beef abattoir. Meat Science

    Science.gov (United States)

    Beef slaughter is water intensive due to stringent food safety requirements. We conducted a study at a commercial beef processor to demonstrate water conservation by modifying the mechanical head wash. We documented the initial nozzle configuration (112 nozzles), water pressure (275 kPa), and flowra...

  5. Efficient optical trapping and visualization of silver nanoparticles

    DEFF Research Database (Denmark)

    Bosanac, Lana; Aabo, Thomas; Bendix, Pól Martin

    2008-01-01

    We performed efficient optical trapping combined with sensitive optical detection of individual silver nanoparticles. The particles ranging in size from 20 to 275 nm in diameter were trapped in three dimensions using low laser power by minimizing spherical aberrations at the focus. The optical fo...

  6. Tick sialostatins L and L2 differentially influence dendritic cell responses to Borrelia spirochetes

    Czech Academy of Sciences Publication Activity Database

    Lieskovská, Jaroslava; Páleníková, Jana; Langhansová, Helena; Chagas, A. C.; Calvo, E.; Kotsyfakis, Michalis; Kopecký, Jan

    2015-01-01

    Roč. 8, MAY 15 2015 (2015), s. 275 ISSN 1756-3305 R&D Projects: GA ČR GAP302/12/2208 Institutional support: RVO:60077344 Keywords : Dendritic cell s * Borrelia burgdorferi * Tick cystatin * Signalling Subject RIV: EC - Immunology Impact factor: 3.234, year: 2015

  7. Relationship between School Administrators' Organizational Power Sources and Teachers' Organizational Citizenship Behaviors

    Science.gov (United States)

    Altinkurt, Yahya; Yilmaz, Kursad

    2012-01-01

    The main purpose of the research was to determine correlation between school administrators' organizational power sources and teachers' organizational citizenship behaviors in primary schools. The research was a correlational survey model study. 275 participants were randomly chosen for the research. The data were collected by…

  8. 77 FR 16266 - Division of Longshore and Harbor Workers' Compensation; Proposed Extension of Existing Collection...

    Science.gov (United States)

    2012-03-20

    ... Number: LS-426. Affected Public: Individuals or households. Total Respondents: 1,100. Total Annual Responses: 1,100. Estimated Total Burden Hours: 275. Estimated Time per Response: 15 minutes. Frequency: On occasion. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $528.00...

  9. Agro. no 1 June Latest

    African Journals Online (AJOL)

    (7.21 11.20%), crude fibre (3.56 5.20%) and total ash (1.50 2.75%) showed an increase ... found in Moringa oleiferais effective against this bacterium (Arnold, 2007). .... has about 25 times more iron than spinach alone and it enhances recall ...

  10. 'Echoing Silences\\': Ethnicity in post-colonial Zimbabwe, 1980-2007 ...

    African Journals Online (AJOL)

    ... structures and institutions which enacted and reproduced ethnicity. Such neglected processes, structures and institutions included unequal development of the provinces and the marginalisation of particular ethnic groups in politics, economy and society. African Journal on Conflict Resolution Vol. 7 (2) 2007: pp. 275-297 ...

  11. A two-stage decentralised system combining high rate activated ...

    African Journals Online (AJOL)

    Total ammonium nitrogen (TAN) and total phosphates (TP) were largely retained in the effluent with average removal percentages of 19.5 and 27.5%, respectively, encouraging reuse for plant growth. Key words: A-stage, sustainable wastewater treatment, resource recovery, developing countries, water reuse, nutrient ...

  12. Two new species of Schistura from Myanmar (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula

    2013-01-01

    Roč. 24, č. 1 (2013), s. 21-30 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional research plan: CEZ:AV0Z50450515 Keywords : loach * basin * drainage Subject RIV: EG - Zoology Impact factor: 2.275, year: 2013

  13. Schistura puncticeps, a new species of loach from Myanmar (Cypriniformes: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula

    2013-01-01

    Roč. 24, č. 1 (2013), s. 85-92 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional research plan: CEZ:AV0Z50450515 Keywords : Teleostei Nemacheilidae * basin Subject RIV: EG - Zoology Impact factor: 2.275, year: 2013

  14. Higher Doses of (+)MK-801 (Dizocilpine) Induced Mortality and Procedural but Not Cognitive Deficits in Delayed Testing in the Active Place Avoidance With Reversal on the Carousel

    Czech Academy of Sciences Publication Activity Database

    Lobellová, Veronika; Brichtová, Eva; Petrásek, Tomáš; Valeš, Karel; Stuchlík, Aleš

    2015-01-01

    Roč. 64, č. 2 (2015), s. 269-275 ISSN 0862-8408 R&D Projects: GA MZd(CZ) NT13386 Institutional support: RVO:67985823 Keywords : Dizocilpine * (+)MK-801 * active place avoidance * Carousel * Long-Evans rats Subject RIV: FH - Neurology Impact factor: 1.643, year: 2015

  15. A Study of the Reactivity of Polyhydroxylated Sterol Derivatives

    Czech Academy of Sciences Publication Activity Database

    Marek, Aleš; Klepetářová, Blanka; Elbert, Tomáš

    2015-01-01

    Roč. 4, č. 8 (2015), s. 808-817 ISSN 2193-5807 R&D Projects: GA AV ČR IAA400550801 Institutional support: RVO:61388963 Keywords : alpha-hydroxyketones * polyhydroxylated compounds * regiospecific reactions * silylation * sterols Subject RIV: CC - Organic Chemistry Impact factor: 3.275, year: 2015

  16. Untitled

    Indian Academy of Sciences (India)

    1987). DHBT June {Ꮹ > 275 Nottenburg et al (1987). SAGM-APD July t = 14 Tsang et al ... *Source: IEEE Trans. Electron Devices Lett. 8 (1987). Table 2. Physical constants of in (0.53) Ga (0.47) As. Physical constant. T Valley L valley X valley.

  17. Ferromagnetism in 5f-band metamagnet UCoAl induced by Os doping

    Czech Academy of Sciences Publication Activity Database

    Andreev, Alexander V.; Shirasaki, K.; Šebek, Josef; Vejpravová, Jana; Gorbunov, Denis; Havela, L.; Daniš, S.; Yamamura, T.

    2016-01-01

    Roč. 681, Oct (2016), 275-282 ISSN 0925-8388 R&D Projects: GA ČR GA16-03593S Institutional support: RVO:68378271 Keywords : uranium intermetallics * UCoAl * itinerant metamagnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.133, year: 2016

  18. Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.

    2015-01-01

    Roč. 591, Sep (2015), s. 271-275 ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.761, year: 2015

  19. Accumulation of phosphorus in nests of red wood ants .i.Formica s. str../i

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří; Cudlín, Pavel

    2005-01-01

    Roč. 42, - (2005), s. 269-275 ISSN 0003-455X Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6087904 Keywords : accumulation of phosphorus * nests of ants * red wood ants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.992, year: 2005

  20. 'Je to bezesporu trápení cestovat touto zemí v takové zimě.' Andaluský rytíř Pero Tafur v Čechách, ve Slezsku a na Moravě (1438-1439)

    Czech Academy of Sciences Publication Activity Database

    Svátek, Jaroslav

    2014-01-01

    Roč. 6, č. 2 (2014), s. 275-288 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : medieval voyager * Pero Tafur * Albert II of Habsburg * Kaspar Schlick * Wroclaw Subject RIV: AB - History

  1. Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro

    Czech Academy of Sciences Publication Activity Database

    Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.

    2016-01-01

    Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016

  2. Genome-wide architecture of reproductive isolation in a naturally occurring hybrid zone between Mus musculus musculus and M. m. domesticus

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Wang, L.; Luzynski, K.; Dufková, Petra; Mrkvicová Vyskočilová, Martina; Nachman, M. W.; Munclinger, P.; Macholán, Miloš; Piálek, Jaroslav; Tucker, P. K.

    2012-01-01

    Roč. 21, č. 12 (2012), s. 3032-3047 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : genomics * proteomics * hybridization * mammals * speciation Subject RIV: EG - Zoology Impact factor: 6.275, year: 2012

  3. Oxidation of aniline with strong and weak oxidants

    Czech Academy of Sciences Publication Activity Database

    Sapurina, I. Yu.; Stejskal, Jaroslav

    2012-01-01

    Roč. 82, č. 2 (2012), s. 256-275 ISSN 1070-3632 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * conducting polymer * oxidant Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.432, year: 2012

  4. Documentation of 50% water conservation in a single process at a beef abattoir

    Science.gov (United States)

    Beef slaughter is water intensive due to stringent food safety requirements. We conducted a study at a commercial beef processor to demonstrate water conservation by modifying the mechanical head wash. We documented the initial nozzle configuration (112 nozzles), water pressure (275 kPa), and flowra...

  5. Seed banks of managed and degraded grasslands in the Krkonoše Mts., Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Handlová, Viola; Münzbergová, Zuzana

    2006-01-01

    Roč. 41, - (2006), s. 275-288 ISSN 1211-9520 R&D Projects: GA ČR GA526/05/0430 Institutional research plan: CEZ:AV0Z60050516 Keywords : degradation * mountain grasslands * seed bank Subject RIV: EF - Botanics Impact factor: 1.196, year: 2006

  6. The relationship of diversity and biomass in phytoplankton communities weakens when accounting for species proportions

    Czech Academy of Sciences Publication Activity Database

    Skácelová, O.; Lepš, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 67-77 ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : algae * cyanobacteria * database Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014 http://link.springer.com/article/10.1007%2Fs10750-013-1723-2#

  7. Application of the Monte Carlo method for investigation of dynamical parameters of rotors supported by magnetorheological squeeze film damping devices

    Czech Academy of Sciences Publication Activity Database

    Zapoměl, Jaroslav; Ferfecki, Petr; Kozánek, Jan

    2014-01-01

    Roč. 8, č. 1 (2014), s. 129-138 ISSN 1802-680X Institutional support: RVO:61388998 Keywords : uncertain parameters of rigid motors * magnetorheological dampers * force transmission * Monte Carlo method Subject RIV: BI - Acoustics http://www.kme.zcu.cz/acm/acm/article/view/247/275

  8. Forward osmosis for oily wastewater reclamation: Multi-charged oxalic acid complexes as draw solutes

    KAUST Repository

    Ge, Qingchun; Amy, Gary L.; Chung, Neal Tai-Shung

    2017-01-01

    Cl and other recently synthesized draw solutes, the OA complexes show superior FO performance in terms of high water fluxes up to 27.5 and 89.1 LMH under the respective FO and PRO (pressure retarded osmosis) modes, both with negligible reverse solute fluxes

  9. Multiphoton bibliography

    International Nuclear Information System (INIS)

    Eberly, J.H.; Gallagher, J.W.

    1981-12-01

    A bibliography is presented of approximately 275 references from literature published since 1980 on multiphoton research. A subject list is provided which divides the references into four subdivisions, i.e., ionization, bound-bound transitions, dissociation, and free-free transitions. An author index is included

  10. 49 CFR 587.17 - Construction.

    Science.gov (United States)

    2010-10-01

    ... Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) DEFORMABLE BARRIERS Offset Deformable Barrier § 587.17 Construction... in), 700 mm (27.5 in), 900 mm (35.4 in) horizontally, from either edge of the barrier. All holes are...

  11. New knowledge for yield, composition and insecticidal activity ofessential oils obtained from the aerial parts or seeds of fennel(Foeniculum vulgare Mill.)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda

    2016-01-01

    Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016

  12. Engineers as Information Processors: A Survey of US Aerospace Engineering Faculty and Students.

    Science.gov (United States)

    Holland, Maurita Peterson; And Others

    1991-01-01

    Reports on survey results from 275 faculty and 640 students, predominantly in the aerospace engineering field, concerning their behaviors about the appropriation and dissemination of information. Indicates that, as information processors, aerospace faculty and students are "information naive." Raises questions about the efficacy of…

  13. Demographic characteristics, leadership styles, job attitudes and ...

    African Journals Online (AJOL)

    This purpose of this study was to investigate the predictive influence of demographic characteristics, leadership styles, job attitudes and personality on job performance among civil servants in Southwest Nigeria. The sample consists of 400 civil servants (males = 275, females = 125) randomly selected from Southwestern ...

  14. Development of molecular assays for the identification of the 11 Eimeria species of the domestic rabbit (Oryctolagus cuniculus)

    Czech Academy of Sciences Publication Activity Database

    Oliveira, U. C.; Fraga, J. S.; Licois, D.; Pakandl, Michal; Gruber, A.

    2011-01-01

    Roč. 176, 2/3 (2011), 275-280 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Eimeria * Rabbit * Coccidiosis * ITS1 * Ribosomal DNA * PCR-based diagnosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011

  15. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  16. Comparative study of the prevalence of leptospirosis in vaccinated ...

    African Journals Online (AJOL)

    This work presents serological reactions of vaccinated and unvaccinated dogs in Ibadan, Nigeria to eight leptospirtal serovars. The overall seroprevelence to leptospires was 16.7% while in unvaccinated dogs it was 14.4%. The following seroprevalences were obtained: L. canicola 27.5% L. grippotyphosa 25.5%, ...

  17. Dicty_cDB: AFM791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ts) Value AB170103_1( AB170103 |pid:none) Macaca fascicularis brain cDNA clo... 246 e-130 EU684308_1( EU6843...08 |pid:none) Exorista civilis heat shock protei... 275 e-125 ( P36415 ) RecName: Full=Heat shock cognate 70

  18. 41 CFR 101-27.505 - Notice to activity.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Notice to activity. 101-27.505 Section 101-27.505 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.5...

  19. 41 CFR 101-27.501 - Eligibility for return.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Eligibility for return. 101-27.501 Section 101-27.501 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.5...

  20. 41 CFR 101-27.502 - Criteria for return.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Criteria for return. 101-27.502 Section 101-27.502 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.5...

  1. 76 FR 50997 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2011-08-17

    ... DEPARTMENT OF COMMERCE International Trade Administration Application(s) for Duty-Free Entry of..., School of Earth Sciences, 275 Mendenhall Laboratory, 125 South Oval Mall, Columbus, OH 43210. Instrument... and high-contrast images, a stage that is easy to move, a focus that does not change with changing...

  2. 75 FR 20999 - Proposed Collection; Comment Request; Survey of Health Care Professionals' Awareness and...

    Science.gov (United States)

    2010-04-22

    ... Request; Survey of Health Care Professionals' Awareness and Perceptions of the National Cancer Institute's... approval. Proposed Collection: Title: The Survey of Health Care Professionals' Awareness and Perceptions of... respondents response (minutes/hour) hours Health care professionals who complete the 330 1 5/60 27.5 survey (0...

  3. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Piue Ghoshal. Articles written in Journal of Chemical Sciences. Volume 120 Issue 2 March 2008 pp 275-287. Structural transition in alcohol-water binary mixtures: A spectroscopic study · Tuhin Pradhan Piue Ghoshal Ranjit Biswas · More Details Abstract Fulltext PDF.

  4. Isotopic studies of beach rock carbonates from Konkan, central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, B.; Rajamanickam, G.V.; Gujar, A.R.

    .7% (PDB) and delta sup(18)O signatures lie in a narrow range of +27.5 to +28.6% (SMOW), respectively. Isotopic data obtained in this study show that cementation of beach rock carbonates might have taken place in a shallow vadose zone. The large variations...

  5. Environmental Effects Exceed Genetic Effects on Perceived Intensity and Pleasantness of Several Odors

    DEFF Research Database (Denmark)

    Knaapila, Antti; Tuorila, Hely; Silventoinen, Karri

    2008-01-01

    and pleasantness of cinnamon, chocolate, turpentine, and isovaleric acid (sweaty) odors by quantitative genetic modeling of odor rating data from 856 twin individuals (including 83 complete monozygotic and 275 dizygotic twin pairs) aged 10-60 years (44% males and 56% females) from Australia, Denmark, and Finland...

  6. Research Staff | Wind | NREL

    Science.gov (United States)

    Research Staff Research Staff Learn more about the expertise and technical skills of the wind power research team and staff at NREL. Name Position Email Phone Anstedt, Sheri Professional III-Writer/Editor /Web Content Sheri.Anstedt@nrel.gov 303-275-3255 Baker, Donald Research Technician V-Electrical

  7. Research Staff | Water Power | NREL

    Science.gov (United States)

    Research Staff Research Staff Learn more about the expertise and technical skills of the water power research team and staff at NREL. Name Position Email Phone Anstedt, Sheri Professional III-Writer /Editor/Web Content Sheri.Anstedt@nrel.gov 303-275-3255 Baker, Donald Research Technician V-Electrical

  8. Marine Caulobacters. Isolation, Characterization and Assessing the Potential for Genetic Experimentation.

    Science.gov (United States)

    1987-01-01

    grants from the Washington SeaGrant Program, the Office of Naval Research (N00014-81-C-0570) and the California Toxic Substances Research and Teaching ...negative bacteria. Biotechnology _, 269-275. 45.ZoBell, C.E. (1946) Marine microbiology: a monograph on hydrobacteriology. Chronica Botanica Co., Waltham

  9. Effect of nitrogen addition and drought on above-ground biomass of expanding tall grasses Calamagrostis epigejos and Arrhenatherum elatius

    Czech Academy of Sciences Publication Activity Database

    Fiala, Karel; Tůma, Ivan; Holub, Petr

    2011-01-01

    Roč. 66, č. 2 (2011), s. 275-281 ISSN 0006-3088 R&D Projects: GA ČR(CZ) GA526/06/0556 Institutional research plan: CEZ:AV0Z60050516 Keywords : nitrogen * drought * above-ground biomass Subject RIV: EF - Botanics Impact factor: 0.557, year: 2011

  10. Advances in Metal Supported Cells in the METSOFC EU Consortium

    DEFF Research Database (Denmark)

    McKenna, B. J.; Christiansen, N.; Schauperl, R.

    2013-01-01

    industrial anode supported ceramic cells. The best stacked MSCs had power densities approaching 275 mW cm–2 (at 680 °C and 0.8 V). Furthermore, extended testing at AVL determined extra stack performance and reliability characteristics, including behavior toward sulfur and simulated diesel reformate...

  11. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  12. Epigenetic regulation – contribution to herbicide resistance in weeds?

    Czech Academy of Sciences Publication Activity Database

    Markus, C.; Pečinka, Aleš; Karan, R.; Barney, J. N.; Merotto, A.

    2018-01-01

    Roč. 74, č. 2 (2018), s. 275-281 ISSN 1526-498X Institutional support: RVO:61389030 Keywords : DNA methylation * epigenetic s * gene expression * gene regulation * herbicide detoxification * plant stress response Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.253, year: 2016

  13. 46 CFR 2.75-70 - Welding procedure and performance qualifications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Welding procedure and performance qualifications. 2.75... for Construction Personnel § 2.75-70 Welding procedure and performance qualifications. (a) Welding... requirements for the welding of pressure piping, boilers, pressure vessels, and nonpressure vessel type tanks...

  14. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian Institute of Pulses Research, Kanpur 208 024, India; Department of Plant Pathology and CAES Genomics Facility, University of California, Davis, CA 95616, USA; National Bureau of Agriculturally Important Microorganisms, Mau Nath Bhanjan 275 101, India; University of Port Harcourt, East/West Road PMB 5323 ...

  15. Appropriate body mass index cut-offs to determine thinness, overweight and obesity in South Asian children in The Netherlands

    NARCIS (Netherlands)

    Wilde, J.A. de; Dommelen, P. van; Middelkoop, B.J.C.

    2013-01-01

    Background: Asian populations have an increased risk of developing cardiometabolic disorders at a lower body mass index (BMI) than other ethnic groups. Therefore, lower adult BMI cut-offs to determine overweight and obesity are recommended to assess the associated health risks for Asian (23 and 27.5

  16. Libraries in New York: MedlinePlus

    Science.gov (United States)

    ... 212-410-8142 http://library.nycpm.edu NYU School of Medicine Health Sciences Library 550 First Avenue New York, NY 10016-6402 ... 4743 http://wernerlibrary.org/wellness University of Rochester School of Medicine and Dentistry Edward G. Miner Library 601 Elmwood Avenue Rochester, NY 14642 585-275- ...

  17. 78 FR 6107 - Agency Information Collection Activities: Announcement of Board Approval Under Delegated...

    Science.gov (United States)

    2013-01-29

    ... Derivatives Market Activity (FR 3036; OMB No. 7100-0285). The FR 2436 collects similar data on the outstanding... of Foreign Exchange and Derivative Market Activity. Agency form number: FR 3036. OMB control number... and derivatives market and dealers. Estimated annual reporting hours: Turnover Survey, 2,275 hours...

  18. 77 FR 67816 - Proposed Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2012-11-14

    ... complements the triennial Survey of Foreign Exchange and Derivatives Market Activity (FR 3036; OMB No. 7100... Derivative Market Activity. Agency form number: FR 3036. OMB control number: 7100-0285. Frequency: One-time... derivatives market and dealers. Estimated annual reporting hours: Turnover Survey, 2,275 hours; Outstandings...

  19. Sex differences in the timing of identification among children and adults with autism spectrum disorders

    NARCIS (Netherlands)

    Begeer, S.; Mandell, S.; Wijnker-Holmes, B.; Venderbosch, S.; Rem, D.; Stekelenburg, F.; Koot, H.M.

    2013-01-01

    To examine differences by sex in the timing of identification of individuals with autism spectrum disorders (ASD), survey data were collected in the Netherlands from 2,275 males and females with autistic disorder, Asperger's syndrome and PDD-NOS. Among participants <18 years of age, females with

  20. Temperature measurements in a wall stabilized steady flame using CARS

    KAUST Repository

    Sesha Giri, Krishna; Lacoste, Deanna; Damazo, Jason; Kwon, Eddie; Roberts, William L.

    2017-01-01

    -Stokes Raman Scattering (CARS) thermometry as close as 275 μm to a convex wall cooled with water has been carried out. The standard deviation of mean temperatures is observed to be ~6.5% for high temperatures (>2000K) and ~14% in the lower range (<500K

  1. Informed trading and the bid-ask spread: evidence from an emerging market

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Podpiera, R.

    2003-01-01

    Roč. 31, č. 2 (2003), s. 275-296 ISSN 0147-5967 R&D Projects: GA MŠk ME 595 Institutional research plan: CEZ:AV0Z7085904 Keywords : market microstructure * bid-ask spread * informed trading Subject RIV: AH - Economics Impact factor: 0.746, year: 2003

  2. 75 FR 75704 - Pacific Gas and Electric Company (Diablo Canyon Nuclear Power Plant, Units 1 And 2); Notice of...

    Science.gov (United States)

    2010-12-06

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-275-LR; 50-323-LR] Pacific Gas and Electric Company (Diablo Canyon Nuclear Power Plant, Units 1 And 2); Notice of Appointment of Adjudicatory Employee... Seismologist, Office of Nuclear Material Safety and Safeguards, has been appointed as a Commission adjudicatory...

  3. Production and verification of heterozygous clones in Japanese ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Microsatellite-centromere mapping in the zebrafish (Danio rerio). Genomics, 30: 337-341. Kobayashi T, Ide A, Hiasa T, Fushiki S, Ueno K (1994). Production of cloned amago salmon Oncorhynchus rhodurus. Fish. Sci. 60: 275-281. Komen H, Thorgaard GH (2007). Androgenesis, gynogenesis and the.

  4. Jennifer N. Markham | NREL

    Science.gov (United States)

    Jennifer.Markham@nrel.gov | 303-275-4154 Orcid ID http://orcid.org/0000-0003-0086-1559 Research Interests Techno Affiliated Research Programs Process Design, Modeling, and Economics Areas of Expertise Aspen Plus Process Biomass Fractionation to Lipid-and Carbohydrate-Derived Fuel Products, NREL Technical Report (2014) "

  5. 77 FR 20356 - Foreign-Trade Zone 277-Western Maricopa County, AZ; Application for Manufacturing Authority...

    Science.gov (United States)

    2012-04-04

    ... Maricopa County, AZ; Application for Manufacturing Authority; Suntech Arizona, Inc., (Solar Panel... facility is used for the manufacture of 275 and 290 watt solar panels for industrial use. Components and... to solar panels (duty-free) for the foreign inputs noted above. Suntech would also be exempt from...

  6. Relationship of birth order and the marketing-related variable of materialism.

    Science.gov (United States)

    Zemanek, J E; Claxton, R P; Zemanek, W H

    2000-04-01

    The relationship between the birth order and materialism scores was investigated using materialism conceptualized as a consumer value. Data were collected from 275 alumni of a major southwestern university. The analysis indicated that first-borns in this sample scored significantly lower on materialism than younger siblings.

  7. Trophic niche partitioning in communities of African annual fish: evidence from stable isotopes

    Czech Academy of Sciences Publication Activity Database

    Polačik, Matej; Harrod, C.; Blažek, Radim; Reichard, Martin

    2014-01-01

    Roč. 721, č. 1 (2014), s. 99-106 ISSN 0018-8158 R&D Projects: GA ČR GPP505/11/P646 Institutional support: RVO:68081766 Keywords : Nothobranchius * Coexistence * Niche separation * Sympatric * Extreme environment * Africa Subject RIV: EG - Zoology Impact factor: 2.275, year: 2014

  8. Ideas and Inspirations: Good News about Diabetes Prevention and Management in Indian Country

    Medline Plus

    Full Text Available ... Tools Diabetes Education Lesson Plan Outlines Integrating Case Management Into Your Practice [PDF – 290 KB] Integrating DSMES Into Your Practice [PDF – 275 KB] In the Spotlight Save the Date! 2019 Diabetes ... Updated Glucose Management Algorithm Now Available! Check out the updated "Glucose ...

  9. "Green on the Screen": Promoting Sustainability through a Campus Film Series

    Science.gov (United States)

    Lindsay, Nathan; Harrell-Blair, Krista; McDaniel, Lindsey; Williams, Clifton; Reed, Diane

    2010-01-01

    Without question, sustainability efforts and initiatives are on the rise on college campuses. In a 2007 American College Personnel Association (ACPA) presentation, Debra Rowe reported that across the country there were 250 sustainability coordinators/offices/committees, 300 LEED (green) buildings, 275 campus sustainability assessments that had…

  10. Effect of habitat conditions on parasite infection in 0+juvenile perch (Perca fluviatilis L.) in two Czech reservoirs

    Czech Academy of Sciences Publication Activity Database

    Francová, K.; Ondračková, Markéta

    2014-01-01

    Roč. 721, č. 1 (2014), s. 57-66 ISSN 0018-8158 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Parasite * Intermediate host * Food availability * Habitat conditions * Lentic * Littoral Subject RIV: EG - Zoology Impact factor: 2.275, year: 2014

  11. Layered hydroxides intercalated with organic anions and their application in preparation of LDH/polymer nanocomposites

    Czech Academy of Sciences Publication Activity Database

    Kovanda, F.; Jindová, E.; Doušová, B.; Koloušek, D.; Pleštil, Josef; Sedláková, Zdeňka

    2009-01-01

    Roč. 6, č. 1 (2009), s. 111-119 ISSN 1214-9705 R&D Projects: GA AV ČR KAN100500651 Institutional research plan: CEZ:AV0Z40500505 Keywords : hydrotalcite * layered double hydroxides * intercalation Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.275, year: 2009

  12. 78 FR 24755 - Agency Information Collection Activities: Submission to OMB for Review and Approval; Public...

    Science.gov (United States)

    2013-04-26

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Resources and Services Administration Agency... Section 121 of the Medicare Improvements for Patients and Providers Act of 2008, Public Law 110-275, is to support improvements in the quality of health care provided in communities served by Critical Access...

  13. Bibliography of Soviet Laser Developments

    Science.gov (United States)

    1975-09-22

    Radiofiz IV. SOURCE ABBREVIATIONS Acta physica polonica Bulletin de l’Academie Polonaise des Sciences. Serie des Sciences Techniques...properties of dyes in polarized solutions. Acta phys. et ehem. Szeged, v. 20, no. 1-2, 197f J5-45. (RZhKh, 19AB, 2/75

  14. Using stable isotopes to trace resource acquisition and trophic position in four Afrotropical birds with different diets

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Reif, J.; Hořák, D.; Klvaňa, P.; Lee, R. W.; Yohannes, E.

    2010-01-01

    Roč. 81, č. 3 (2010), s. 273-275 ISSN 0030-6525 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : stable isotope analysis * diet ary niche * Cameroon Mountains Subject RIV: EG - Zoology Impact factor: 0.338, year: 2010

  15. Effect of addition of a second metal in Mo/ZSM-5 catalyst for methane aromatization reaction under elevated pressures

    Czech Academy of Sciences Publication Activity Database

    Fíla, V.; Bernauer, Milan; Bernauer, B.; Sobalík, Zdeněk

    2015-01-01

    Roč. 256, č. 2 (2015), s. 269-275 ISSN 0920-5861 Grant - others:EU 7th Framework Program(XE) NMP3-LA-2009-229183 Institutional support: RVO:61388955 Keywords : methane * aromatization * metal dopants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  16. Crystallization and preliminary X-ray characterization of the catalytic domain of collagenase G from Clostridium histolyticum

    International Nuclear Information System (INIS)

    Eckhard, Ulrich; Nüss, Dorota; Ducka, Paulina; Schönauer, Esther; Brandstetter, Hans

    2008-01-01

    The catalytic domain of collagenase G from C. histolyticum was expressed in E. coli BL21 (DE3) and purified using affinity and size-exclusion column-chromatographic methods. Crystals were obtained at 290 K by the sitting-drop vapour-diffusion method and diffraction data have been collected to 2.75 Å resolution. The catalytic domain of collagenase G from Clostridium histolyticum has been cloned, recombinantly expressed in Escherichia coli and purified using affinity and size-exclusion column-chromatographic methods. Crystals of the catalytic domain were obtained from 0.12 M sodium citrate and 23%(v/v) PEG 3350 at 293 K. The crystals diffracted to 2.75 Å resolution using synchrotron radiation. The crystals belong to an orthorhombic space group, with unit-cell parameters a = 57, b = 109, c = 181 Å. This unit cell is consistent with the presence of one molecule per asymmetric unit and a solvent content of approximately 53%

  17. Crystallization and preliminary X-ray characterization of the catalytic domain of collagenase G from Clostridium histolyticum

    Energy Technology Data Exchange (ETDEWEB)

    Eckhard, Ulrich, E-mail: ulrich.eckhard@sbg.ac.at; Nüss, Dorota; Ducka, Paulina; Schönauer, Esther; Brandstetter, Hans [Structural Biology Group, Department of Molecular Biology, University of Salzburg, 5020 Salzburg (Austria)

    2008-05-01

    The catalytic domain of collagenase G from C. histolyticum was expressed in E. coli BL21 (DE3) and purified using affinity and size-exclusion column-chromatographic methods. Crystals were obtained at 290 K by the sitting-drop vapour-diffusion method and diffraction data have been collected to 2.75 Å resolution. The catalytic domain of collagenase G from Clostridium histolyticum has been cloned, recombinantly expressed in Escherichia coli and purified using affinity and size-exclusion column-chromatographic methods. Crystals of the catalytic domain were obtained from 0.12 M sodium citrate and 23%(v/v) PEG 3350 at 293 K. The crystals diffracted to 2.75 Å resolution using synchrotron radiation. The crystals belong to an orthorhombic space group, with unit-cell parameters a = 57, b = 109, c = 181 Å. This unit cell is consistent with the presence of one molecule per asymmetric unit and a solvent content of approximately 53%.

  18. Operation of a free-electron laser from the extreme ultraviolet to the water window

    Science.gov (United States)

    Ackermann, W.; Asova, G.; Ayvazyan, V.; Azima, A.; Baboi, N.; Bähr, J.; Balandin, V.; Beutner, B.; Brandt, A.; Bolzmann, A.; Brinkmann, R.; Brovko, O. I.; Castellano, M.; Castro, P.; Catani, L.; Chiadroni, E.; Choroba, S.; Cianchi, A.; Costello, J. T.; Cubaynes, D.; Dardis, J.; Decking, W.; Delsim-Hashemi, H.; Delserieys, A.; di Pirro, G.; Dohlus, M.; Düsterer, S.; Eckhardt, A.; Edwards, H. T.; Faatz, B.; Feldhaus, J.; Flöttmann, K.; Frisch, J.; Fröhlich, L.; Garvey, T.; Gensch, U.; Gerth, Ch.; Görler, M.; Golubeva, N.; Grabosch, H.-J.; Grecki, M.; Grimm, O.; Hacker, K.; Hahn, U.; Han, J. H.; Honkavaara, K.; Hott, T.; Hüning, M.; Ivanisenko, Y.; Jaeschke, E.; Jalmuzna, W.; Jezynski, T.; Kammering, R.; Katalev, V.; Kavanagh, K.; Kennedy, E. T.; Khodyachykh, S.; Klose, K.; Kocharyan, V.; Körfer, M.; Kollewe, M.; Koprek, W.; Korepanov, S.; Kostin, D.; Krassilnikov, M.; Kube, G.; Kuhlmann, M.; Lewis, C. L. S.; Lilje, L.; Limberg, T.; Lipka, D.; Löhl, F.; Luna, H.; Luong, M.; Martins, M.; Meyer, M.; Michelato, P.; Miltchev, V.; Möller, W. D.; Monaco, L.; Müller, W. F. O.; Napieralski, O.; Napoly, O.; Nicolosi, P.; Nölle, D.; Nuñez, T.; Oppelt, A.; Pagani, C.; Paparella, R.; Pchalek, N.; Pedregosa-Gutierrez, J.; Petersen, B.; Petrosyan, B.; Petrosyan, G.; Petrosyan, L.; Pflüger, J.; Plönjes, E.; Poletto, L.; Pozniak, K.; Prat, E.; Proch, D.; Pucyk, P.; Radcliffe, P.; Redlin, H.; Rehlich, K.; Richter, M.; Roehrs, M.; Roensch, J.; Romaniuk, R.; Ross, M.; Rossbach, J.; Rybnikov, V.; Sachwitz, M.; Saldin, E. L.; Sandner, W.; Schlarb, H.; Schmidt, B.; Schmitz, M.; Schmüser, P.; Schneider, J. R.; Schneidmiller, E. A.; Schnepp, S.; Schreiber, S.; Seidel, M.; Sertore, D.; Shabunov, A. V.; Simon, C.; Simrock, S.; Sombrowski, E.; Sorokin, A. A.; Spanknebel, P.; Spesyvtsev, R.; Staykov, L.; Steffen, B.; Stephan, F.; Stulle, F.; Thom, H.; Tiedtke, K.; Tischer, M.; Toleikis, S.; Treusch, R.; Trines, D.; Tsakov, I.; Vogel, E.; Weiland, T.; Weise, H.; Wellhöfer, M.; Wendt, M.; Will, I.; Winter, A.; Wittenburg, K.; Wurth, W.; Yeates, P.; Yurkov, M. V.; Zagorodnov, I.; Zapfe, K.

    2007-06-01

    We report results on the performance of a free-electron laser operating at a wavelength of 13.7 nm where unprecedented peak and average powers for a coherent extreme-ultraviolet radiation source have been measured. In the saturation regime, the peak energy approached 170 µJ for individual pulses, and the average energy per pulse reached 70 µJ. The pulse duration was in the region of 10 fs, and peak powers of 10 GW were achieved. At a pulse repetition frequency of 700 pulses per second, the average extreme-ultraviolet power reached 20 mW. The output beam also contained a significant contribution from odd harmonics of approximately 0.6% and 0.03% for the 3rd (4.6 nm) and the 5th (2.75 nm) harmonics, respectively. At 2.75 nm the 5th harmonic of the radiation reaches deep into the water window, a wavelength range that is crucially important for the investigation of biological samples.

  19. Parkinson’s disease and low frequency alleles found together throughout LRRK2

    Science.gov (United States)

    Paisán-Ruiz, Coro; Washecka, Nicole; Nath, Priti; Singleton, Andrew B.; Corder, Elizabeth H.

    2016-01-01

    Mutations within LRRK2, most notably p.G2019S, cause Parkinson’s disease (PD) in rare monogenic families, and sporadic occurrences in diverse populations. We investigated variation throughout LRRK2 (84 SNPs; genotype or diplotype found for 49 LD blocks) for 275 cases (European ancestry, onset at age 60 or older) and 275 neurologically healthy control subjects (NINDS Neurogenetics Repository). Three grade-of-membership groups, i.e. genetic risk sets, were identified that exactly matched many subjects (cases: 46, 4, 137; controls: 0, 178, 0), and distinguished 94% of the subjects (i.e. > 50% likeness to one set). Set I, affected, carried certain low frequency alleles located in multiple functional domains. Set II was unaffected. Set III, also affected, resembled II except for slightly elevated frequencies of minor alleles not defining set I. We conclude that certain low frequency alleles distributed throughout LRRK2 are a genetic background to a third of cases, defining a distinct subset. PMID:19489756

  20. Gluten detection in foods available in the United States - a market survey.

    Science.gov (United States)

    Sharma, Girdhari M; Pereira, Marion; Williams, Kristina M

    2015-02-15

    Many gluten-free (GF) food choices are now available in supermarkets. However, the unintentional presence of gluten in these foods poses a serious health risk to wheat-allergic and celiac patients. Different GF labelled foods (275) and non-GF labelled foods, without wheat/rye/barley on the ingredient label (186), were analysed for gluten content by two different enzyme linked immunosorbent assay (ELISA) kits. Considering the gluten threshold of 20ppm, GF labelled foods had 98.9% GF labelling compliance with 1.1% (3 out of 275) of foods being mislabelled/misbranded. Among the non-GF labelled foods, 19.4% (36 out of 186) of foods had >20ppm of gluten, as measured by at least one ELISA kit, of which 19 foods had >100ppm of gluten. The presence of oats in non-GF labelled foods was strongly correlated with a positive ELISA result. Gluten was also found in a significant number of foods with gluten/wheat-related advisory warnings. Published by Elsevier Ltd.

  1. Protein expression, crystallization and preliminary X-ray crystallographic studies of LidA from Legionella pneumophila

    International Nuclear Information System (INIS)

    Zhu, Wenzhuang; Meng, Geng; Liu, Yong; Zhang, Feiyun; Zheng, Xiaofeng

    2011-01-01

    The crystallization of recombinant lidA, a translocated substrate of the Legionella pneumophila Dot/Icm type IV secretion system, is reported. Crystals were obtained and diffracted to 2.75 Å in space group P2 1 2 1 2 1 . LidA, a translocated substrate of the Legionella pneumophila Dot/Icm type IV secretion system, is associated with maintenance of bacterial integrity and interferes with the early secretory pathway. However, the precise mechanism of LidA in these processes remains elusive. To further investigate the structure and function of LidA, the full-length protein was successfully expressed in Escherichia coli and purified. LidA was crystallized using sitting-drop vapour diffusion and diffracted to a resolution of 2.75 Å. The crystal belonged to space group P2 1 2 1 2 1 , with unit-cell parameters a = 57.5, b = 64.5, c = 167.3 Å, α = β = γ = 90°. There is one molecule per asymmetric unit

  2. Simultaneous Determination of Ibuprofen and Caffeine in Urine Samples by Combining MCR-ALS and Excitation-emission Data

    Directory of Open Access Journals (Sweden)

    Masoumeh Mohammadnejad

    2016-06-01

    Full Text Available Second order advantage of excitation-emission fluorescence matrix was applied for the simultaneous determination of ibuprofen and caffeine. The proposed method is based on the measurement of the native fluorescence and recording emission spectra of ibuprofen and caffeine in different excitation wavelengths. The mixture of these compounds was resolved by multivariate curve resolution coupled with alternative least squares (MCR-ALS on constructed matrix. The EEM spectra were recorded at excitation wavelengths from 250-275 nm; the emission wavelengths ranged from 275-400 nm. For each particular quantitative determination, an augmented matrix was defined. The resolution of each augmented-data matrix gave an estimation of the excitation and emission spectra of the species included in the model. Ibuprofen and caffeine were determined in concentration range from 0.10-8.00 and 0.50-15.00 mg ml-1, respectively. The minimal sample pretreatment and relatively low running cost, make this method a good alternative to existing methods for determination of the analytes in urine samples.

  3. Distribution of Complex Chemicals in Oil-Water Systems

    DEFF Research Database (Denmark)

    Riaz, Muhammad

    condensates, MEG and water has been measured in the temperature range of 275-326 K at atmospheric pressure. The detailed composition of condensates is measured by GC analysis and 85 components are identified up to n-nonane and hundreds of ill-defined components in decane plus fraction. In order to develop...... and tested for such measurements. The mutual solubility of two North Sea condensates, MEG and water has been measured in the temperature range of 275-326 K at atmospheric pressure. The detailed composition of condensates is measured by GC analysis and 85 components are identified up to n-nonane and hundreds...... the mutual solubility of condensate/oil, MEG and water is predicted satisfactorily using the same average kij for MEG-HC pairs and water-HC kij from a generalized correlation as a function of carbon number. The experimental trends in mutual solubility as a function of temperature and MEG content in polar...

  4. The elastic properties of zirconium alloy fuel cladding and pressure tubing materials

    International Nuclear Information System (INIS)

    Rosinger, H.E.; Northwood, D.O.

    1979-01-01

    A knowledge of the elastic properties of zirconium alloys is required in the mathematical modelling of cladding and pressure tubing performance. Until recently, little of this type of data was available, particularly at elevated temperatures. The dynamic elastic moduli of zircaloy-2, zircaloy-4, the alloys Zr-1.0 wt%Nb, Zr-2.5 wt%Nb and Marz grade zirconium have therefore been determined over the temperature range 275 to 1000 K. Young's modulus and shear modulus for all the zirconium alloys decrease with temperature and are expressed by empirical relations fitted to the data. The elastic properties are texture dependent and a detailed study has been conducted on the effect of texture on the elastic properties of Zr-1.0 wt% Nb over the temperature range 275 to 775 K. The results are compared with polycrystalline elastic constants computed from single crystal elastic constants, and the effect of texture on the dynamic elastic moduli is discussed in detail. (Auth.)

  5. 41 CFR 102-33.275 - Are there restrictions on replacing aircraft by exchange or sale?

    Science.gov (United States)

    2010-07-01

    ...). In your letter of request to GSA, you must include the full details of your situation and the... request and justify a waiver from GSA, Aircraft Management Policy Division (MTA), 1800 F Street, NW...

  6. 17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...

  7. Variants of clinicoroentgenological manifestations of sarcoidosis of respiratory organs

    International Nuclear Information System (INIS)

    Borisova, N.K.; Daurov, B.I.

    1988-01-01

    The paper is concerned with clinicoroentgenological characterization of 275 patients with different stages of intrathoracic sarcoidosis. Different X-ray types of sarcoidosis of the respiratory organs were detected in 67 (24.4%) of them. The number of patients with different types of sarcoidosis increased with progression of disease

  8. Smoking and airway hyperresponsiveness especially in the presence of blood eosinophilia increase the risk to develop respiratory symptoms - A 25-year follow-up study in the general adult population

    NARCIS (Netherlands)

    Jansen, DF; Schouten, JP; Vonk, JM; Rijcken, B; Timens, W; Kraan, J; Weiss, ST; Postma, DS

    Airway hyperresponsiveness (AHR) constitutes a risk for development of respiratory symptoms. We assessed whether blood eosinophilia (greater than or equal to 275 eosinophils/mu l), skin test positivity (sum score greater than or equal to 3) and cigarette smoking (never, ex-smoker, 1-14 cig/d, 15-24

  9. 41 CFR 101-27.504 - Notice to GSA.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Notice to GSA. 101-27.504 Section 101-27.504 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.5-Return of GSA...

  10. Quality assessment of drinking water from different sources in Lafia ...

    African Journals Online (AJOL)

    Treated pipe borne water, sachet water and water sold in open containers were also investigated. Standard plate count technique, multiple tube fermentation technique, and membrane filtration technique were employed in determining the microbial quality of the water. The study showed uniform temperature range of 27.5 to ...

  11. Discrete maximum principle for FE solutions of the diffusion-reaction problem on prismatic meshes

    Czech Academy of Sciences Publication Activity Database

    Hannukainen, A.; Korotov, S.; Vejchodský, Tomáš

    2009-01-01

    Roč. 226, č. 2 (2009), s. 275-287 ISSN 0377-0427 R&D Projects: GA AV ČR IAA100760702 Institutional research plan: CEZ:AV0Z10190503 Keywords : diffusion-reaction problem * maximum principle * prismatic finite elements Subject RIV: BA - General Mathematics Impact factor: 1.292, year: 2009

  12. 77 FR 19670 - Agency Information Collection Activities; Proposed Collection; Comment Request; Food Contact...

    Science.gov (United States)

    2012-04-02

    ... Nutrition, Food and Drug Administration, 5100 Paint Branch Pkwy (HFS-275), College Park, MD 20740, 240-402... Nutrition using Form FDA 3480 whether it is submitted in electronic or paper format. FDA recently made minor... food contact articles. These notifications require the submission of Form FDA 3479 (``Notification for...

  13. Measuring Students' Perceptions of Institutional Identity: Validating the DePaul Mission and Values Inventory at a Franciscan University

    Science.gov (United States)

    Matteo, Elizabeth K.; Bottom, Todd L.; Ferrari, Joseph R.

    2013-01-01

    The "DePaul Mission and Values Inventory" ("DMV") was validated based on the mission, identity, and values of a large, urban, Catholic, Vincentian institution. We examined the suitability of the "DMV" at a small, suburban, Catholic, Franciscan university. A sample of 275 undergraduates (218 women, 57 men:…

  14. Effect of copper sulphate supplementation on performance of broiler chickens, cholesterol content and fatty acid profile of meat

    Czech Academy of Sciences Publication Activity Database

    Skřivan, M.; Ševčíková, S.; Tůmová, E.; Skřivanová, V.; Marounek, Milan

    2002-01-01

    Roč. 47, č. 7 (2002), s. 275-280 ISSN 1212-1819 R&D Projects: GA AV ČR KSK5020115 Grant - others:GA NATO(XX) MO2-99-04 Keywords : broiler * copper sulphate * quality of meat Subject RIV: GH - Livestock Nutrition Impact factor: 0.187, year: 2002

  15. Pepper yellow mosaic virus, a new potyvirus in sweet-pepper. Archives of Virology

    NARCIS (Netherlands)

    Inoue-Nagata, A.K.; Fonseca, M.E.N.; Resende, de R.O.; Boiteux, L.S.; Monte, D.C.; Dusi, A.N.; Ávila, de A.C.; Vlugt, van der R.A.A.

    2002-01-01

    A potyvirus was found causing yellow mosaic and veinal banding in sweetpepper in Central and Southeast Brazil. The sequence analysis of the 3' terminal region of the viral RNA revealed a coat protein of 278 amino acids, followed by 275 nucleotides in the 3'-untranslated region preceding a

  16. Place-Based Stewardship Education: Nurturing Aspirations to Protect the Rural Commons

    Science.gov (United States)

    Gallay, Erin; Marckini-Polk, Lisa; Schroeder, Brandon; Flanagan, Constance

    2016-01-01

    In this mixed-methods study, we examine the potential of place-based stewardship education (PBSE) for nurturing rural students' community attachment and aspirations to contribute to the preservation of the environmental "commons." Analyzing pre- and post-experience surveys (n = 240) and open-ended responses (n = 275) collected from…

  17. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Abhijit Chakraborty. Articles written in Journal of Earth System Science. Volume 114 Issue 3 June 2005 pp 275-286. Significance of transition between Talchir Formation and Karharbari Formation in Lower Gondwana basin evolution — A study in West Bokaro Coal basin, ...

  18. Identification and characterization of locus specific methylation patterns within novel loci undergoing hypermethylation during breast cancer pathogenesis

    DEFF Research Database (Denmark)

    Wojdacz, Tomasz K; Windeløv, Johanne Agerlin; Thestrup, Britta B

    2014-01-01

    (DMRs) was validated using Methylation Sensitive High Resolution Melting (MS-HRM) in a case control study on a panel of breast carcinomas (N = 275) and non-malignant controls (N = 74). RESULTS: Based on microarray results we selected 19 DMRs for large-scale screening of cases and controls. Analysis...

  19. The Videogame and the College Student.

    Science.gov (United States)

    D'Alessio, Dave; And Others

    College students' activities and personality characteristics associated with video game use were studied using existing theories about the effects of television as a framework. A three-part questionnare was given to 275 students enrolled in introductory communication classes at a large, midwestern university to gather data on: (1) the…

  20. Antimicrobial activity of some endemic plant species from Turkey

    African Journals Online (AJOL)

    SERVER

    2007-08-06

    Aug 6, 2007 ... Antibacterial and antifungal activity of Heracleum sphondylium subsp. arvinense. Afr. J. Biotechnol. 5: 1087-1089. Ertürk Ö (2006). Antibacterial and antifungal activity of ethanolic extracts from eleven spice plants. Biologia. 61: 275-278. Fazly Bazzaz BS, Haririzadeh G (2003). Screening of Iranian plants for.