WorldWideScience

Sample records for bohrium 272

  1. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  2. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  4. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  5. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  6. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  7. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  8. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  9. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  10. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  11. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  12. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  13. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  14. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  15. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  16. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  17. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  18. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  19. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  20. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  1. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  2. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  3. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  4. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  5. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  6. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  7. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  8. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  9. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  10. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  11. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  12. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  13. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  14. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  15. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  16. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  17. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  18. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  19. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  20. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  1. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  2. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  3. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  4. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  5. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  6. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  7. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  8. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  9. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  10. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  11. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  12. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  13. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  14. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  15. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  16. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  17. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  18. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  19. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  20. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  1. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  2. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  3. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  4. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  5. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  6. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  7. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  8. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  9. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  10. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  11. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  12. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  13. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  14. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  15. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  16. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  17. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  18. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  19. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  20. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  1. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  2. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  3. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  4. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  5. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  6. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  7. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  8. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  9. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  10. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  11. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  12. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  13. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  14. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  15. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  16. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  17. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  18. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  19. 36 CFR 272.4 - Commercial use.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial use. 272.4 Section 272.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE USE OF âWOODSY OWLâ SYMBOL § 272.4 Commercial use. (a) General. The Chief may authorize the Commercial...

  20. 32 CFR 272.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 272.5 Section 272.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.5 Responsibilities. (a)...

  1. Dicty_cDB: SLA272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CCTATACAGC TGGTGTAGTGTTACXXXXXXXXXX sequence update 1999.11.18 Translated Amino Acid sequence KMADDKKKQLEESKRLVELFKASSLA...SL (Link to library) SLA272 (Link to dictyBase) - - - Contig-U16479-1 SLA272F (Link to Original site) SLA...272F 614 - - - - - - Show SLA272 Library SL (Link to library) Clone ID SLA272 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-C/SLA272Q.Seq.d/ Representative seq. ID SLA27...2F (Link to Original site) Representative DNA sequence >SLA272 (SLA272Q) /CSM/SL/SLA2-C/SLA272Q.Seq.d/ AAAAA

  2. 27 CFR 19.272 - Equipment.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Equipment. 19.272 Section... THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Construction, Equipment and Security § 19.272 Equipment. The proprietor shall provide equipment suitable for the operations conducted on the distilled...

  3. 32 CFR 272.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... training of scientists and engineers critical to meeting future needs of the Nation's defense workforce. (b... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 272.4 Section 272.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...

  4. Dicty_cDB: SSI272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI272 (Link to dictyBase) - G02314 DDB0215394 Contig-U13726-1 SSI...272E (Link to Original site) - - - - - - SSI272E 655 Show SSI272 Library SS (Link to library) Clone ID SSI...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-C/SSI272Q.Seq.d/ ...Representative seq. ID SSI272E (Link to Original site) Representative DNA sequence >SSI272 (SSI272Q) /CSM/SS/SSI2-C/SSI...pnynqlvtlvhslsalq rvlklv*lvifinvllqpnqvsvnsqipsi*livv*ninh*vmqrvvsvilvlv*liwsk ptkdvvlenslvkslpfqkklptklvssnslfmkssi

  5. 40 CFR 264.272 - Treatment demonstration.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Land Treatment § 264.272 Treatment demonstration. (a) For each waste that will be applied to the treatment zone, the owner or operator must demonstrate, prior to application of the waste, that...

  6. 40 CFR Appendix A to Part 272 - State Requirements

    Science.gov (United States)

    2010-07-01

    ... citations affecting appendix A to part 272, see the List of CFR Sections Affected, which appears in the...) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS Pt. 272, App. A Appendix A to Part 272—State... 17.53.111” in the introductory paragraph), 17.53.111(3) (except the phrase “and the generator...

  7. 40 CFR 52.272 - Research operations exemptions.

    Science.gov (United States)

    2010-07-01

    ... August 2, 1976. Editorial Note: For Federal Register citations affecting § 52.272, see the List of CFR... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Research operations exemptions. 52.272... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.272 Research...

  8. 48 CFR 211.272 - Alternate preservation, packaging, and packing.

    Science.gov (United States)

    2010-10-01

    ..., packaging, and packing. 211.272 Section 211.272 Federal Acquisition Regulations System DEFENSE ACQUISITION... Requirements Documents 211.272 Alternate preservation, packaging, and packing. Use the provision at 252.211-7004, Alternate Preservation, Packaging, and Packing, in solicitations which include...

  9. 36 CFR 272.6 - Power to revoke.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Power to revoke. 272.6 Section 272.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE USE OF âWOODSY OWLâ SYMBOL § 272.6 Power to revoke. It is the intention of these regulations that the Chief,...

  10. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  11. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  12. 7 CFR 2.72 - Chairman, World Agricultural Outlook Board.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Chairman, World Agricultural Outlook Board. 2.72... § 2.72 Chairman, World Agricultural Outlook Board. (a) Delegations. Pursuant to § 2.29 (a)(3) through (a)(7), the following delegations of authority are made by the Chief Economist to the Chairman,...

  13. Dicty_cDB: SLI272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLI272 (Link to dictyBase) - - - Contig-U16527-1 SLI272E (Link to Original ... . 254 e-110 3 AY163443 |AY163443.1 Uncultured soil fungus ... clone Pent 5.3ex 18S ribosomal RNA gene, partial s ...

  14. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  15. 40 CFR 60.272 - Standard for particulate matter.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for particulate matter. 60.272... Standard for particulate matter. (a) On and after the date on which the performance test required to be... control device and contain particulate matter in excess of 12 mg/dscm (0.0052 gr/dscf). (2) Exit from...

  16. 7 CFR 272.2 - Plan of operation.

    Science.gov (United States)

    2010-01-01

    ... Federal Register citations affecting § 272.2, see the List of CFR Sections Affected, which appears in the... Project shall include that Project's Work Plan in the State Plan of Operation. The Plan's attachments... offices, maintenance and renovation work, and inflation; issuance system costs, including renegotiation...

  17. 46 CFR 272.22 - Improvements and other similar work.

    Science.gov (United States)

    2010-10-01

    ... provisions of this Part. (b) Capital expenditures. An expenditure in excess of $200,000 for work effected... considered to be a capital expenditure, ineligible for M&R subsidy, except that work on an Eligible Vessel... 46 Shipping 8 2010-10-01 2010-10-01 false Improvements and other similar work. 272.22 Section...

  18. 40 CFR 180.272 - Tribuphos; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Tribuphos; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.272 Tribuphos; tolerances for residues. (a) General. Tolerances are established for residues...

  19. 27 CFR 24.272 - Payment of tax by electronic fund transfer.

    Science.gov (United States)

    2010-04-01

    ... electronic fund transfer. 24.272 Section 24.272 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Removal, Return and Receipt of Wine Taxpaid Removals § 24.272 Payment of tax by electronic fund transfer. (a) General. (1) During a...

  20. Comparison of extraction of U(VI) with Cyanex-272, PC-88A, DEHPA and TBP and effect of diluents on its extraction with Cyanex-272

    International Nuclear Information System (INIS)

    The di-alkyl phosphoric acid extractants viz. Cyanex-272, PC-88A and DEHPA extract U(VI) efficiently from HNO3 medium. The D values increase as the aqueous phase acidity decreases in case of all the three extractants. At lower acidities (0.1 to 0.5M), the distribution ratio follows an order Cyanex-272 > PC-88A > DEHPA at 2 M HNO3 concentration, Cyanex-272 extracts U(VI) far more efficiently than TBP. Cyanex-272 is soluble in almost all the aromatic and aliphatic diluents, the D value of U(VI)-Cyanex-272 system were found to follow the order cyclohexane > n-dodecane > CCl4 > benzene. (author)

  1. Incidence of Canine Hip Dysplasia : A Survey of 272 Cases

    Directory of Open Access Journals (Sweden)

    G. D. Rao

    2010-10-01

    Full Text Available A total of 272 cases of hip dysplasia were reviewed. A review of clinical cases presented with the clinical signs of hip dysplasia were referred to Radiology Unit of Madras Veterinary College, from May 2007-April 2009 was taken for this study.The incidence was highest in young animals of age group over three months to one year (52.94 percent. The breed-wise incidence was more common in Labrador Retriever (36.76 percent. Male dogs were found to be more affected (59.55 percent than female dogs. Bilateral hip dysplasia was found to be more (88.60 percent than unilateral. Among the unilateral hip dysplasia, left side was found to be more (54.83 percent than right. [Vet. World 2010; 3(5.000: 219-220

  2. Methane hydrate dissociation rates as 0.1 MPa and temperatures above 272K

    Energy Technology Data Exchange (ETDEWEB)

    Durham, W B; Circone, S; Stern, L A; Kirby, S H; Pinkston, J C

    1999-10-25

    We performed rapid depressurization experiments on methane hydrate under isothermal conditions above 272 K to determine the amount and rate of methane evolution. Sample temperatures rapidly drop below 273 K and stabilize near 272.5 K during dissociation. This thermal anomaly and the persistence of methane hydrate are consistent with the reported recovery of partially dissociated methane hydrate from ocean drilling cores.

  3. 26 CFR 1.272-1 - Expenditures relating to disposal of coal or domestic iron ore.

    Science.gov (United States)

    2010-04-01

    ... making and administering a coal royalty contract or iron ore royalty contract or to the preservation of... rendered in connection with the making of a coal royalty contract or iron ore royalty contract (assuming... domestic iron ore. 1.272-1 Section 1.272-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF...

  4. 37 CFR 2.72 - Amendments to description or drawing of the mark.

    Science.gov (United States)

    2010-07-01

    ... drawing of the mark. 2.72 Section 2.72 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND....72 Amendments to description or drawing of the mark. (a) In an application based on use in commerce under section 1(a) of the Act, the applicant may amend the description or drawing of the mark only...

  5. Solvent extraction of thorium from nitrate medium by TBP, Cyanex272 and their mixture

    International Nuclear Information System (INIS)

    The extraction behavior of thorium(IV) has been investigated with tri-butyl phosphate (TBP) and bis(2,4,4-trimethylpentyl) phosphinic acid (Cyanex272) in kerosene from nitrate medium. The effect of operating variables including time, aqueous phase acidity (pH), extractant concentration and temperature were investigated. This study also examined the synergistic enhancement of the extraction of thorium(IV) from nitrate medium by mixtures of TBP and Cyanex272 for the first time. The optimum synergistic enhancement factor of 3.86 was obtained at a Cyanex272/TBP molar ratio of 1:4. (author)

  6. Metabolic Characterization of a Tripeptide Human Immunodeficiency Virus Type 1 Protease Inhibitor, KNI-272, in Rat Liver Microsomes

    OpenAIRE

    Kiriyama, Akiko; Nishiura, Tomoyuki; Yamaji, Hirokazu; Takada, Kanji

    1999-01-01

    KNI-272 is a tripeptide protease inhibitor for treating human immunodeficiency virus type 1 (HIV-1). In in vitro stability studies using rat tissue homogenates, KNI-272 concentrations in the liver, kidney, and brain decreased significantly with time. Moreover, in tissue distribution studies, KNI-272 distributed highly to the liver, kidney, and small intestine in vivo. From these results and reported physiological parameters such as the tissue volume and tissue blood flow rate, we considered t...

  7. Liquid-liquid extraction of praseodymium (III) using Cyanex 272 in kerosene

    International Nuclear Information System (INIS)

    The extraction of Pr(III) from nitric acid medium using Cyanex 272(HA) in kerosene was studied. The effect of various parameters like equilibration time, nitric acid concentration, extractant concentration, temperature, nature of diluents on the extraction of Pr (III) has been investigated. The extraction of metal decreased with increase in acid concentration. The extraction of Pr (III) was 70% from the aqueous phase of 0.001M HNO3 using 1M Cyanex 272. On the basis of slope analysis, the composition of the extracted species is proposed to be Pr(NO3)2.A(HA). Kerosene was found to be effective diluent for the extraction of Pr (III) from nitric acid medium using Cyanex 272. (author)

  8. Liquid-liquid extraction of uranium (VI) using Cyanex 272 in kerosene from sodium salicylate medium

    International Nuclear Information System (INIS)

    Liquid-liquid extraction of uranium (VI) from sodium salicylate media using Cyanex 272 in kerosene has been carried out. Uranium (VI) was quantitatively extracted from 1x10-4 M sodium salicylate with 5x10-4 M Cyanex 272 in kerosene. It was stripped quantitatively from the organic phase with 4M HCl and determined spectrophotometrically with arsenazo(III) at 600 nm. The effects of concentrations of sodium salicylate, metal ions and strippants have been studied. Separation of uranium (VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)

  9. Atomic Mass and NuclearBinding Energy for Uup-272(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-272 (Ununpentium, atomic number Z = 115, mass number A = 272).

  10. 40 CFR 272.751 - Indiana state-administered program: Final authorization.

    Science.gov (United States)

    2010-07-01

    ... Restrictions (Checklist 159) 62 FR 32974 June 17, 1997. 11. Land Disposal Restrictions-Phase III—Emergency... (CONTINUED) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS Indiana § 272.751... the hazardous waste management program under subtitle C of RCRA, 42 U.S.C. 6921 et seq....

  11. 40 CFR 272.2251 - Utah State-Administered program: Final authorization.

    Science.gov (United States)

    2010-07-01

    ... Revision Checklist 138 (Rule 154.1) 59 FR 62896 12/6/94 Land Disposal Restrictions Phase III—Emergency...) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS Utah § 272.2251 Utah State... management program under subtitle C of RCRA, 42 U.S.C. 6921 et seq. This incorporation by reference...

  12. 7 CFR 272.11 - Systematic Alien Verification for Entitlements (SAVE) Program.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Systematic Alien Verification for Entitlements (SAVE... FOR PARTICIPATING STATE AGENCIES § 272.11 Systematic Alien Verification for Entitlements (SAVE... and Naturalization Service (INS), in order to verify the validity of documents provided by...

  13. Collective dipole motion in highly excited (272)Hs (Z=108) nuclei

    NARCIS (Netherlands)

    Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsay, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G

    1996-01-01

    The heavy nucleus (272)(108)Hs (Z = 108) and its evaporation daughters were produced using the reaction Th-232(Ar-40, gamma xn) with beam energies 10.5 and 15.0 MeV/A. The giant dipole resonance gamma radiation from the hot composite system prior to fission has been isolated using a differential met

  14. Mutational analysis of Glu272 in elongation factor 1A of E. coli

    DEFF Research Database (Denmark)

    Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.

    1998-01-01

    In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge...... combination with one of the above mentioned mutations (Arg7Glu/Glu272Arg) in order to test this hypothesis. Our results show that, in confirmation of our thesis based on structural knowledge, the substitution of Glu272 (Asp284) decreases the ability of EF1A:GTP to bind aa-tRNA. Udgivelsesdato: 1998-Jun-16...

  15. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-05-12

    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  16. Collective dipole motion in highly excited {sup 272}Hs ({ital Z}=108) nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Tveter, T.S.; Gaardho/je, J.J.; Maj, A.; Ramso/y, T.; Atac, A.; Bacelar, J.; Bracco, A.; Buda, A.; Camera, F.; Herskind, B.; Korten, W.; Krolas, W.; Menthe, A.; Million, B.; Nifenecker, H.; Pignanelli, M.; Pinston, J.A.; Ploeg, H.v.; Schussler, F.; Sletten, G. [Niels Bohr Institute, Tandem Accelerator Laboratory, Riso/, DK-400 Roskilde (Denmark)]|[Department of Physics, University of Oslo, Box 1048 Blindern, N-0316 Oslo (Norway)]|[Niewodniczanski Institute of Nuclear Physics, Radzikowskiego 152, PL-31-342 Krakow (Poland)]|[Norwegian Radiation Protection Authority, Grini naeringfspark 13, Box 55, N-1345 O/steras (Norway)]|[Institut for Stralningsvetenskap, Uppsala Universitet, Box 535, S-751 21 Uppsala (Sweden)]|[Kernfysisch Verschneller Institut, Zernikelaan 25, NL-9747 AA Groningen (The Netherlands)]|[Dipartimento di Fisica, Universita di Milano e INFN, Via Celoria 16, I-20133 Milano (Italy)]|[Institut fur Strahlen- und Kernphysik, Universitaet Bonn, Nussallee 14-16, W-5300 Bonn (Germany)

    1996-02-01

    The heavy nucleus {sup 272}{sub 108}Hs ({ital Z}=108) and its evaporation daughters were produced using the reaction {sup 232}Th ({sup 40}Ar,{gamma}{ital xn}) with beam energies 10.5 and 15.0 MeV/{ital A}. The giant dipole resonance {gamma} radiation from the hot composite system prior to fission has been isolated using a differential method. The prefission component shows a strong dipole angular distribution relative to the spin direction. {copyright} {ital 1996 The American Physical Society.}

  17. Crystallization and preliminary neutron diffraction studies of HIV-1 protease cocrystallized with inhibitor KNI-272

    International Nuclear Information System (INIS)

    In order to determine the protonation states of the residues within the active site of an HIV-1 protease–inhibitor complex, a crystal of HIV-1 protease complexed with inhibitor (KNI-272) was grown to a size of 1.4 mm3 for neutron diffraction study. The crystal diffracted to 2.3 Å resolution with sufficient quality for further structure determination. This paper reports the crystallization and preliminary neutron diffraction measurements of HIV-1 protease, a potential target for anti-HIV therapy, complexed with an inhibitor (KNI-272). The aim of this neutron diffraction study is to obtain structural information about the H atoms and to determine the protonation states of the residues within the active site. The crystal was grown to a size of 1.4 mm3 by repeated macroseeding and a slow-cooling method using a two-liquid system. Neutron diffraction data were collected at room temperature using a BIX-4 diffractometer at the JRR-3 research reactor of the Japan Atomic Energy Agency (JAEA). The data set was integrated and scaled to 2.3 Å resolution in space group P21212, with unit-cell parameters a = 59.5, b = 87.4, c = 46.8 Å

  18. EXTRACTION OF COPPER FROM LEACH LIQUOR OF METALLIC COMPONENT IN DISCARDED CELL PHONE BY CYANEX® 272

    Directory of Open Access Journals (Sweden)

    ALAFARA A. BABA

    2016-06-01

    Full Text Available Discarded cell phones contribute significantly to the amount of electronic waste generation whilst some of its components are toxic and recoverable. Also, due to the increasing demand for Cu(II in building/construction, electrical and as chemical tool in freshwater, it is imperative to develop low cost and ecofriendly technique as a substitute for the conventional treatments such as reduction-roasting route at elevated temperatures. In the present study, the hydrometallurgical operations involving leaching, solvent extraction and precipitation for the recovery of Cu(II by Cyanex® 272 in kerosene was examined. Various parameters affecting the extraction of Cu(II such as pH, extractant concentration and phase ratio were optimized. At optimal conditions, about 96.3 % Cu(II was extracted into the organic phase by 0.2 mol/L Cyanex® 272 at equilibrium pH 5.0 and aqueous to organic phase ratio 1:1. The stripping of the loaded organic was carried out by 0.1 mol/L HCl solution and stripping efficiency of 98 % was obtained. By McCabe Thiele diagram, four stages are required for complete extraction of Cu(II.

  19. Extraction and Separation of Cobalt and Nickel with Extractants Cyanex 302, Cyanex 272 and Their Mixture

    Directory of Open Access Journals (Sweden)

    Lenhard, Z.

    2008-09-01

    Full Text Available The extraction and separation of cobalt(II and nickel(II from sulphate solutions with different initial volume fractions of commercial organophosphorus extractants Cyanex 302, Cyanex 272 and their mixture, in kerosene as diluent, were investigated. Prepared samples contained the mixture of cobalt(II and nickel(II in mass concentrations chosen to approximate the mass concentrations of the two metals in solutions obtained by leaching typical low-grade ores or waste materials with sulphuric acid. The experiments were carried out at two concentration ratios of nickel to cobalt(ζNi/Co, 25 and 125. The latter ratio was chosen as model for the solutions of naturally occurring ores and other materials in which the concentration of nickel is much higher than that of cobalt. In all cases, the concentration of cobalt was approximately y= 0.15 g L–1, and the concentration of nickel was approximately g= 3.80 g L–1 (at ζNi/Co = 25 and 18.80 g L–1 (at ζNi/Co = 125. Other initial values were based on conditions found to be optimal in previous investigations, and kept constant in all experiments: pH0= 8, θ0 = 25 °C, phase volume ratio organic to aqueous ψ = 1 and 0.5, contact time 2 minutes.The tested fractions of extractants (Cyanex 302 or Cyanex 272, diluted in kerosene, were j = 2.5, 5.0, 7.5 and φ = 10 %. The studies of the mixture of extractants were carried out at two sets of fractions. In the first set, the fraction of Cyanex 302 was kept at φ = 10 %, and Cyanex 272 was varied in the range φ = 2.5 –10 %. In the second set, the mass concentration of each of the two extractants was varied in the range φ = 2.5–10 % so that the total fraction of the two extractants always added up to φ= 10 %.The obtained results describe the influences of type and initial volume fraction of extractant on the separation and extraction of cobalt and nickel. Under the investigated range of conditions, Cyanex 302 outperformed Cyanex 272 in cobalt

  20. Extraction of polonium from aqueous lactic acid solutions using dioctyl sulphide, Cyanex 272, Cyanex 301 or Cyanex 302 in toluene

    International Nuclear Information System (INIS)

    The extraction of polonium from lactic acid (HLac) solutions has been studied with di-n-octyl sulphide (DOS), Cyanex 272, Cyanex 301 and Cyanex 302 extractants dissolved in toluene. For the extraction with DOS, the extracted species is most likely PoO(Lac)2 x 3DOS. The results for Cyanex 272 also indicate extraction via a solvation mechanism rather than cation exchange. The extracted species is probably PoO(Lac)2 x 2HA. The major species extracted with Cyanex 301 or Cyanex 302 do not contain any lactate molecules. The extracted species is most likely PoOA2 at low extractant concentrations, while at higher concentrations an adduct complex of the type PoOA2 x 2HA is formed. The extraction of polonium increases in the order Cyanex 272 < Cyanex 302 < DOS < Cyanex 301, which is the same order as the increase of the number of sulphur atoms in the reagents. (author)

  1. Co(II) removal by magnetic alginate beads containing Cyanex 272.

    Science.gov (United States)

    Ngomsik, Audrey-Flore; Bee, Agnès; Siaugue, Jean-Michel; Talbot, Delphine; Cabuil, Valérie; Cote, Gérard

    2009-07-30

    In this study, a series of batch experiments is conducted to investigate the ability of magnetic alginate beads containing Cyanex 272 to remove Co(II) ions from aqueous solutions. Equilibrium sorption experiments show a Co(II) uptake capacity of 0.4 mmol g(-1). The data are successfully modelled with a Langmuir equation. A series of kinetics experiments is then carried out and a pseudo-second order equation is used to fit the experimental data. The effect of pH on the sorption of Co(II) ions is also investigated. Desorption experiments by elution of the loaded beads with nitric acid at pH 1 show that the magnetic alginate beads could be reused without significant losses of their initial properties even after 3 adsorption-desorption cycles. PMID:19157703

  2. News from the "Dentist's Chair": Observations of AM 1353-272 with the VIMOS IFU

    CERN Document Server

    Weilbacher, P M; Weilbacher, Peter M.; Duc, Pierre-Alain

    2006-01-01

    The galaxy pair AM 1353-272 nicknamed "The Dentist's Chair" shows two ~30 kpc long tidal tails. Previous observations using multi-slit masks showed that they host up to seven tidal dwarf galaxies. The kinematics of these tidal dwarfs appeared to be decoupled from the surrounding tidal material. New observations of the tip of the southern tidal tail with the VIMOS integral field unit confirm the results for two of these genuine tidal dwarfs but raise doubts whether the velocity gradient attributed to the outermost tidal dwarf candidate is real. We also discuss possible effects to explain the observational difference of the strongest velocity gradient seen in the slit data which is undetected in the new integral field data, but arrive at no firm conclusion. Additionally, low-resolution data covering most of the two interacting partners show that the strongest line emitting regions of this system are the central parts.

  3. 20 CFR 404.272 - Indexes we use to measure the rise in the cost-of-living.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Indexes we use to measure the rise in the... Increases § 404.272 Indexes we use to measure the rise in the cost-of-living. (a) The bases. To measure... Consumer Price Index (CPI) for urban wage earners and clerical workers as published by the Department...

  4. Analysis of postnatal visits of 272 cases in Beihang community%北航社区272例产后访视情况分析

    Institute of Scientific and Technical Information of China (English)

    岳秀云

    2011-01-01

    目的:探讨北航社区教工及居民对产后访视的需求、实际产后访视情况及其与纯母乳喂养的关系.方法:将2007年1月~2009年7月272例在北航社区医院建立的母子健康档案随机分为两组,即:接受产后访视1次或仅接受产后42天检查为A组,接受产后访视2次及以上为B组.通过对档案中登记的产妇文化程度、产后访视情况及纯母乳喂养情况进行分类、统计、电话回访,分析文化程度与保证首次访视时间(产后3~7天内)、保证产后访视2次以上以及自访、外访与纯母乳喂养之间的关系.结果:产妇文化程度与保证首次访视时间和产后访视2次以上无必然联系(P>0.05);保证首次访视时间及产后访视2次以上与纯母乳喂养存在正比例关系(P<0.05);自访、外访与纯母乳喂养之间无必然联系(P>0.05).结论:高校社区高文化程度人群也是围产保健宣教重点;保证产后访视至少2次和首次访视时间,增加访视内容及保证宣教到位,是达到产后访视效果、确保产妇康复、新生儿健康及母乳喂养的有力措施.%Objective: To explore the relationship between exclusive breasffeeding and the demand of faculty and residents and actual situation of post - natal visits in Beihang community. Methods: 272 cases who established mother and child health files from January 2007 to July 2009 at the Beihang University Community Hospital were randomly divided into two groups, namely: received postnatal visits one time or just acceptted the 42 day postnatal checks as A group, received postnatal visits 2 times and above, as B group. Through the mother -child health record on maternal education, postnatal visits, and exclusive breastfeeding, as the case of classification, statistics, telephone interview, maternal educational level and guarantee for the first time visiting time (3 to 7 days postpartum) and postnatal visits two or more times, self- access, foreign visits and

  5. The extraction of zinc and other minor metals from concentrated ammonium chloride solutions with D2EHPA and Cyanex 272

    Directory of Open Access Journals (Sweden)

    Amer, S.

    1995-12-01

    Full Text Available A comparative study is made of the extractants D2EHPA and Cyanex 272 for the zinc and minor metal extraction from aqueous concentrated ammonium chloride solutions, as those of the leaching liquors of the CENIM-LNETI process. Extraction equilibrium data for zinc are presented as extraction isotherms at constant pH and at a temperature of 50 °C. Zinc extraction and coextraction of minor metal ions as Cu, Ca, Pb, Mg, Cd, Co, Ni and Hg are studied. Mercury does not extract from concentrated ammonium chloride solutions. Cyanex 272 shows a better selectivity for zinc with regard to the minor metals than D2EHPA, which is especially remarkable for calcium, the most coextracted element by D2EHPA. Nickel and cadmium coextraction is negligible for both extractants. The possible use of the Cyanex 272 as an alternative to D2EHPA is considered.

    Se realiza un estudio comparativo del comportamiento del D2EHPA y del Cyanex 272 durante la extracción del cinc y otros metales minoritarios de soluciones acuosas concentradas de cloruro amónico, como las de las soluciones de lixiviación del proceso CENIM-LNETI. Se presentan los datos de equilibrio de extracción del cinc en forma de isotermas de extracción a una temperatura de 50 °C y pH constante y se estudia la coextracción de los metales minoritarios Cu, Ca, Pb, Mg, Cd, Co, Ni y Hg. El mercurio no se extrae de las soluciones concentradas de cloruro amónico. La selectividad del Cyanex 272 para el cinc respecto de esos metales minoritarios es mejor que la del D2EHPA, siendo verdaderamente notable para el calcio, que es la impureza que más se coextrae con el D2EHPA. La coextracción de níquel y de cadmio es muy pequeña para ambos extractantes. Se considera la posibilidad del uso alternativo del Cyanex 272 en lugar del D2EHPA.

  6. RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas

    OpenAIRE

    Bao, Zhao-Shi; Chen, Hui-min; Yang, Ming-Yu; Zhang, Chuan-Bao; Yu, Kai; Ye, Wan-Lu; Hu, Bo-Qiang; Yan, Wei; Zhang, Wei; Akers, Johnny; Ramakrishnan, Valya; Li, Jie; Carter, Bob; Liu, Yan-Wei; HU, HUI-MIN

    2014-01-01

    Studies of gene rearrangements and the consequent oncogenic fusion proteins have laid the foundation for targeted cancer therapy. To identify oncogenic fusions associated with glioma progression, we catalogued fusion transcripts by RNA-seq of 272 gliomas. Fusion transcripts were more frequently found in high-grade gliomas, in the classical subtype of gliomas, and in gliomas treated with radiation/temozolomide. Sixty-seven in-frame fusion transcripts were identified, including three recurrent ...

  7. Apolipoprotein E4 (1–272 fragment is associated with mitochondrial proteins and affects mitochondrial function in neuronal cells

    Directory of Open Access Journals (Sweden)

    Michikawa Makoto

    2009-08-01

    Full Text Available Abstract Background Apolipoprotein E allele ε4 (apoE4 is a strong risk factor for developing Alzheimer's disease (AD. Secreted apoE has a critical function in redistributing lipids among central nervous system cells to maintain normal lipid homeostasis. In addition, previous reports have shown that apoE4 is cleaved by a protease in neurons to generate apoE4(1–272 fragment, which is associated with neurofibrillary tanglelike structures and mitochondria, causing mitochondrial dysfunction. However, it still remains unclear how the apoE fragment associates with mitochondria and induces mitochondrial dysfunction. Results To clarify the molecular mechanism, we carried out experiments to identify intracellular apoE-binding molecules and their functions in modulating mitochondria function. Here, we found that apoE4 binds to ubiquinol cytochrome c reductase core protein 2 (UQCRC2 and cytochrome C1, both of which are components of mitochondrial respiratory complex III, and cytochrome c oxidase subunit 4 isoform 1 (COX IV 1, which is a component of complex IV, in Neuro-2a cells. Interestingly, these proteins associated with apoE4(1–272 more strongly than intact apoE4(1–299. Further analysis showed that in Neuro-2a cells expressing apoE4(1–272, the enzymatic activities of mitochondrial respiratory complexes III and IV were significantly lower than those in Neuro-2a cells expressing apoE4(1–299. Conclusion ApoE4(1–272 fragment expressed in Neuro2a cells is associated with mitochondrial proteins, UQCRC2 and cytochrome C1, which are component of respiratory complex III, and with COX IV 1, which is a member of complex IV. Overexpression of apoE4(1–272 fragment impairs activities of complex III and IV. These results suggest that the C-terminal-truncated fragment of apoE4 binds to mitochondrial complexes and affects their activities, and thereby leading to neurodegeneration.

  8. ECG changes in factory workers exposed to 27.2  MHz radiofrequency radiation.

    Science.gov (United States)

    Chen, Qingsong; Xu, Guoyong; Lang, Li; Yang, Aichu; Li, Shilin; Yang, Liwen; Li, Chaolin; Huang, Hanlin; Li, Tao

    2013-05-01

    To research the effect of 27.2 MHz radiofrequency radiation on electrocardiograms (ECG), 225 female workers operating radiofrequency machines at a shoe factory were chosen as the exposure group and 100 female workers without exposure from the same factory were selected as the control group. The 6 min electric field strength that the female workers were exposed to was 64.0 ± 25.2 V/m (mean ± SD), which exceeded 61 V/m, the International Commission on Non-Ionizing Radiation Protection reference root mean square levels for occupational exposure. A statistical difference was observed between the exposed group and the control group in terms of the rate of sinus bradycardia (χ(2)  = 11.48, P = 0.003). When several known risk factors for cardiovascular disease were considered, including smoking, age, alcohol ingestion habit, and so on, the exposure duration was not an effective factor for ECG changes, sinus arrhythmia, or sinus bradycardia according to α = 0.05, while P = 0.052 for sinus arrhythmia was very close to 0.05. We did not find any statistical difference in heart rate, duration of the QRS wave (ventricular depolarization), or corrected QT intervals (between the start of the Q wave and end of the T wave) between the exposed and control groups. Occupational exposure to radiofrequency radiation was not found to be a cause of ECG changes after consideration of the confounding factors. PMID:23280584

  9. Two stage leaching of activated spent HDS catalyst and solvent extraction of aluminium using organo-phosphinic extractant, Cyanex 272

    International Nuclear Information System (INIS)

    Spent catalyst generally contains valuable metals like Mo, Co, Ni on a supporting material, such as γ-A12O3. In the present study, a two stage alkali/acid leaching process is proposed to selectively target molybdenum and cobalt/nickel separately to facilitate the downstream processing. Prior to the leaching, the spent catalyst was calcined at 500 deg. C to remove C and S; and to convert metal sulphides to metal oxides. 98% Mo, 93% Co and 90% Ni was effectively recovered by this process. The sulphuric acid leaching of spent catalyst, previously treated by alkali solutions to remove Mo, yielded a solution rich in Ni, Co and Al. In order to recover Co and Ni, the Al impurity must be eliminated. The extraction and stripping of Al has been carried out using the organo-phosphinic extractant, Cyanex 272 diluted in carbon tetrachloride. Quantitative Al extraction efficiency was achieved with 1.0 M Cyanex 272 in two stages at an aqueous:organic (A:O) phase ratio of 1:1 and equilibrium pH of 3.2. Complete stripping of Al from the loaded organic was carried out using 2 M H2SO4 at an A:O phase ratio of 1:1. The extraction reaction proceeded via the cation exchange mechanism and the extracted species was assumed to be AlA3.3HA. The extraction of Al was carried out in the presence of various ions to ascertain the tolerance limit of individual ions. The regenerated solvent was successfully used for 8 cycles without any significant loss of extraction efficiency, suggesting that Cyanex 272 is extremely stable under present experimental conditions

  10. Two stage leaching of activated spent HDS catalyst and solvent extraction of aluminium using organo-phosphinic extractant, Cyanex 272.

    Science.gov (United States)

    Park, Kyung Ho; Mohapatra, Debasish; Nam, Chul-Woo

    2007-09-01

    Spent catalyst generally contains valuable metals like Mo, Co, Ni on a supporting material, such as gamma-A1(2)O(3). In the present study, a two stage alkali/acid leaching process is proposed to selectively target molybdenum and cobalt/nickel separately to facilitate the downstream processing. Prior to the leaching, the spent catalyst was calcined at 500 degrees C to remove C and S; and to convert metal sulphides to metal oxides. 98% Mo, 93% Co and 90% Ni was effectively recovered by this process. The sulphuric acid leaching of spent catalyst, previously treated by alkali solutions to remove Mo, yielded a solution rich in Ni, Co and Al. In order to recover Co and Ni, the Al impurity must be eliminated. The extraction and stripping of Al has been carried out using the organo-phosphinic extractant, Cyanex 272 diluted in carbon tetrachloride. Quantitative Al extraction efficiency was achieved with 1.0M Cyanex 272 in two stages at an aqueous:organic (A:O) phase ratio of 1:1 and equilibrium pH of 3.2. Complete stripping of Al from the loaded organic was carried out using 2M H(2)SO(4) at an A:O phase ratio of 1:1. The extraction reaction proceeded via the cation exchange mechanism and the extracted species was assumed to be AlA(3).3HA. The extraction of Al was carried out in the presence of various ions to ascertain the tolerance limit of individual ions. The regenerated solvent was successfully used for 8 cycles without any significant loss of extraction efficiency, suggesting that Cyanex 272 is extremely stable under present experimental conditions. PMID:17363155

  11. Large Velocity Gradients in the Tidal Tails of the Interacting Galaxy AM 1353-272 ("The Dentist's Chair")

    CERN Document Server

    Weilbacher, P M; Duc, P A; Fricke, K J; Weilbacher, Peter M.; Alvensleben, Uta Fritze-v.; Duc, Pierre-Alain; Fricke, Klaus J.

    2002-01-01

    We present VLT observations of the interacting system AM 1353-272. Using the FORS2 instrument, we studied the kinematics of the ionized gas along its prominent tidal tails and discovered strikingly large velocity gradients associated with seven luminous tidal knots. These kinematical structures cannot be caused by streaming motion and most likely do not result from projection effects. More probably, instabilities in the tidal tails have lead to the formation of kinematically decoupled objects which could be the progenitors of self-gravitating Tidal Dwarf Galaxies.

  12. Solvent extraction studies on the behaviour of trivalent actinides and lanthanides from nitrate media by Cyanex-272

    International Nuclear Information System (INIS)

    Extraction of Am(III), La(III), Pm(III), Eu(III) and Lu(III) from aqueous nitrate medium using bis (2,4,4-trimethylpentyl) phosphinic acid (Cyanex-272) in dodecane as diluent has been investigated at 25 ± 1 degC under different experimental conditions. The composition of the extracted species was found to be M(NO3)(HY2)2. The equilibrium constants for the species found have been evaluated and the order of extraction is Lu(III) > Eu(III) > Am(III) > Pm(III) > La(III). (author). 4 refs., 2 tabs

  13. High-power continuous-wave tunable 544- and 272-nm beams based on a diode-oscillator fiber-amplifier for calcium spectroscopy

    Science.gov (United States)

    Ko, Kwang-Hoon; Kim, Yonghee; Park, Hyunmin; Cha, Yong-Ho; Kim, Taek-Soo; Lee, Lim; Lim, Gwon; Han, Jaemin; Ko, Kwang-Hee; Jeong, Do-Young

    2015-08-01

    Continuous-wave single-frequency tunable 544- and 272-nm beams have been demonstrated by the second- and fourth-harmonic conversions of a 1088-nm fundamental beam from a diode-oscillator fiber-amplifier. The single-pass second-harmonic generation with a MgO-doped periodically poled stoichiometric LiTaO3 crystal and the external-cavity frequency-doubling technique with a bulk BBO crystal were employed to achieve an approximately 6-W 544-nm beam and a 1.5-W 272-nm beam, respectively. We characterized the second- and fourth-harmonic generations and discussed their applications to calcium spectroscopy.

  14. 内镜金属支架姑息性治疗胆管远端恶性梗阻272例分析%272 cases of distal malignant biliary obstruction palliatively treated in endoscopic metal biliary stent

    Institute of Scientific and Technical Information of China (English)

    吴瑜; 秦鸣放; 王庆; 勾承月; 李宁

    2011-01-01

    [ Objective ] To explore the therapeutic effect and clinic value of distal malignant biliary obstruction in endoscopic metal biliary stent. [ Method ] The clinical data of 272 cases of distal malignant biliary obstruction unreseetable were retrospectively analyzed. The patients were treated in endoscopic metal biliary stent from December of 2000 to December of 2009. [ Result ] Endoscopic retrograde cholangio pancreatography were successfully performed in 258 cases (258/272, 94.8%). The levels of TBIL and DBIL were restored (73.3%) after stents were implanted two weeks later. Complications were cured including acute cholangititis in 13 patients (5.0%) and hyperamylascmia in 10 patients (3.9%). Follow-up observation was of 182 cases. Average survivng time was (24 ± 3.3) months (range: 3~37 months) after endoscopic metal biliary stent treatment. 1 year survival was 51.4% (94/182) and 2 year survival was 2.1% (40/182). [Conclusion] Metal stent implantation is safe and effective to relive obstruction for inoperable patients of malignant biliary obstruction with fewer invasive, fewer complication,better improvement of hepatic function and accord with physiology.%目的 探讨内镜金属支架对胆管远端恶性梗阻的治疗效果和临床应用价值.方法 回顾性分析该院2000年12月至~2009年12月内镜金属支架治疗272例无法手术根治性切除的胆管远端恶性梗阻患者的临床资料.结果 272例插管成功258例,失败14例,成功率为94.8%.术后2周胆红素降至正常189例(73.3%).术后并发急性胆管炎13例(5.0%),高淀粉酶血症10例(3.9%),均经保守治疗痊愈.随访182例,平均生存时间(24±3.3)个月(3~37个月),1年生存率为51.4%(94/182),2年生存率为22.1%(40/182).结论 对无法手术根治性切除的恶性胆管远端梗阻患者,内镜金属支架治疗可有效解除胆管梗阻,改善肝功能,同时具有创伤小、并发症少、符合生理等特点.该方法是安全、有效的.

  15. Separating Thulium Ytterbium Lutetium with Cyanex272 Impregnated Resin Using Extraction Chromatography%Cyanex272浸渍树脂萃取色层法分离铥、镱、镥

    Institute of Scientific and Technical Information of China (English)

    廖春发; 梁勇; 焦芸芬; 薛济来

    2007-01-01

    研究了不同温度、淋洗液酸度、稀土负载量、淋洗液流速及装柱树脂高度对Cyanex272浸渍树脂萃取色层法分离Tm, Yb, Lu的影响和柱参数. 结果表明, 在温度为30 ℃, 梯度淋洗酸度为0.5, 0.6, 1.5 mol·L-1, 稀土负载量为0.3%, 淋洗液流速为1.0 ml·cm-2·min-1,装柱树脂高度为480 mm(柱内径为16 mm)的条件下, 对Tm, Yb, Lu富集物分离效果较好.

  16. Solvent Extraction of Zr(IV) from Nitric Acid Solutions using CYANEX 272, CYANEX 301 and CYANEX 302

    International Nuclear Information System (INIS)

    The extraction of Zr(IV) from nitric acid solutions using CYANEX 272 (bis(2,4,4-trimethylpentyl) phosphinic acid), bis (2,4,4-trimethylpentyl) dithio phosphinic acid (CYANEX 301) or (bis(2,4,4-trimethylpentyl) mono phosphinic acid (CYANEX 302) in kerosene has been investigated. The various factors affecting the extraction process of Zr(IV) by each of the investigated extractants such as contact time, loading capacity, extractant, metal ion and nitric acid concentration as well as temperature, are separately investigated. The stripping of the extracted zirconium from loaded organic solutions is also carried out using different stripping reagents. The results are compared and the potential advantages of each extractant over the others are exploited in terms of higher loading capacity and selectivity, less nitric acid extraction, equilibration period and reagent concentration

  17. Separating of Thulium, Ytterbium, Lutetium by Cooperative Extraction Chromatography with Cyanex272-P507 Impregnated Resin%Cyanex272-P507浸渍树脂协同萃取色层分离铥镱镥的研究

    Institute of Scientific and Technical Information of China (English)

    廖春发; 焦芸芬; 邱定蕃; 薛济来

    2007-01-01

    以Cyanex272-P507浸渍树脂采用萃取色层法对铥镱镥富集物进行了吸附和淋洗分离研究,考察了淋洗剂浓度、稀土负载量、淋洗液流速等因素对分离铥镱镥富集物的影响.结果表明,在充填的树脂粒度为0.3~0.6 mm的色层柱中,以0.2 ml·cm-2·min-1进料流速时能得到较大的吸附率; 在稀土负载量为树脂重量的0.6%,淋洗液流速为1.0 ml·cm-2·min-1,温度为30 ℃,装柱树脂高度为400 mm(高径比为25:1)的条件下,用1.0,1.5,2.0 mol·L-1盐酸梯度淋洗Tm,Yb,Lu,可实现铥镱镥富集物三者的完全分离.

  18. Extraction of polonium from aqueous α-hydroxyisobutyric acid solutions using dioctyl sulphide, Cyanex 272, Cyanex 301 or Cyanex 302 in toluene

    International Nuclear Information System (INIS)

    A study of the extraction of polonium from aqueous solutions containing α-hydroxyisobutyric acid (α-HIBA) was performed with four different extractants, di-n-octyl sulphide (DOS), Cyanex 272, Cyanex 301 and Cyanex 302, dissolved in toluene. The extracted complex for DOS at low α-HIBA concentrations is most likely PoO(α-HIB)2 x 2DOS, while at higher α-HIBA concentrations there seems to be a solvating effect implicating an extracted complex of the type PoO(α-HIB)2(α-HIBA)2 x 2DOS. For the extraction of polonium with Cyanex 272 the results are inconclusive. The extracted complex is either PoOA2 or PoO(α-HIB)2 x 2HA. For extraction with Cyanex 301 or Cyanex 302 the major extracted species does not contain any α-HIBA molecules. The neutral species in both cases is PoOA2, extracted at low extractant concentrations, while at higher extractant concentrations a complex of the type PoOA2 x xHA is extracted. The extraction of polonium increases in the order Cyanex 272 < DOS < Cyanex 302 < Cyanex 301. (author)

  19. Final report on CCQM-K27.2: Second Subsequent study: determination of ethanol in aqueous media

    Science.gov (United States)

    Schantz, Michele M.; Parris, Reenie M.; May, Willie E.; Rosso, Adriana; Puglisi, Celia; Marques Rodrigues Caixeiro, Janaína; Massiff, Gabriela; Camacho Frías, Evangelina; Pérez Urquiza, Melina; Archer, Marcellé; Visser, M. S.; deVos, Betty-Jayne

    2013-01-01

    subsequent study (nominal concentrations of 0.2 mg/g, 1 mg/g, 3 mg/g and 60 mg/g). The three participants in the CCQM-K27-Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in the concentration range of 0.2 mg/g to 60 mg/g. A report on this project has been approved by the CCQM and can be found at the BIPM website. A second follow-on key comparison, CCQM-K27.2 Second Subsequent, was initiated in 2006 to accommodate laboratories that had not been ready to benchmark their methods in the previous two CCQM-K27 studies. Two levels of ethanol in water were used in the second subsequent study ranging in concentration between 0.5 mg/g and 4 mg/g. Four of the five participants in the CCQM-K27.2 Second Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in that concentration range. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCQM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  20. HDR syndrome: a follow-up genotype-phenotype analysis of a de novo missense Thr272Ile mutation in exon 4 of GATA3.

    Science.gov (United States)

    Gomes, T S; Gortner, L; Dockter, G; Leitner, D; Thakker, R V; Rohrer, T

    2012-11-01

    Hypoparathyroidism, sensorineural deafness and renal dysplasia (HDR) syndrome (MIM 146255) is a rare autosomal dominant disorder caused by mutations in the gene encoding GATA3, a dual zinc-finger transcription factor involved in vertebrate embryonic development. In this clinical case study we report on a follow-up of a phenotype associated with a GATA3 mutation. HDR syndrome was clinically diagnosed at age of 1.5 years in a boy with a de novo heterozygous missense (c.815C→T) mutation, Thr272Ile, in exon 4 of the GATA3 gene. Both parents were negative for Thr272Ile.At age of 17 months, the patient had a weight of 10.7, a body length of 78 cm, and a head circumference of 47.5 cm. By the age of 7 years, growth is age-appropriate, severe bilateral hearing loss (dB 60) was corrected by hearing aids. However, cognitive development (auditory sensory me-mory and language abilities) is at the lower ends of the test scores.In conclusion, a mildly impaired clinical course was achieved by the age of 7 years in a patient with HDR syndrome; this report adds to the body of data on genotype-phenotype analysis in HDR syndrome. · PMID:23203342

  1. Action spectrum for the induction of single-strand breaks in DNA buffered aqueous solution in the wavelength range from 150 to 272 nm: dual mechanism

    International Nuclear Information System (INIS)

    The induction of single-strand breaks by vacuum-u.v. and far-u.v. radiations (150 nm - 272 nm) in plasmid Col E1 DNA in buffered aqueous solution was studied by agarose gel electrophoresis. The results indicated that the mechanisms of DNA strand-break induction are different in the two u.v. regions: above 210 nm the direct excitation of DNA seemed to be the main cause; below 180 nm the photolysis of solvent water seemed to be essential. The demonstration of a systematic protection at 160 nm and not at 209 nm by OH scavengers, such as ethyl alcohol, potassium iodide and D-mannitol, supports the involvement of OH radicals in the vacuum-u.v. region. (author)

  2. Lithostratigraphy of Shell 272-1 and 273-1 Wells: implications as to depositional history of the Baltimore Canyon Trough, Mid- Atlantic OCS.

    Science.gov (United States)

    Libby-French, J.

    1981-01-01

    The Shell 272-1 and 273-1 wells, located c106km SE of Atlantic City, in the NW part of the Baltimore Canyon Trough penetrate strata from Cenozoic down to Upper Jurassic, and the lithology of each is described. 7 major lithologic units were established and correlated to the COST B-2 and B-3 wells. The depositional environments of the Upper Jurassic rocks range from an upper delta plain facies to a back-reef facies. The Lower Cretaceous strata, in a vertical sequence, consist of upper delta plain, lower delta plain, marginal marine, and distributary-mouth-bar deposits. A Cenomanian sandstone is the youngest indicator of deltaic deposition; marine strata dominate the remainder of the Upper Cretaceous and Cenozoic.-from Authors

  3. Human p53(264-272) HLA-A2 binding peptide is an immunodominant epitope in DNA-immunized HLA-A2 transgenic mice

    DEFF Research Database (Denmark)

    Petersen, T R; Bregenholta, S; Pedersen, L O;

    1999-01-01

    C57BL/10 mice transgenic for HLA-A2 were immunized with either a full-length DNA-construct of the tumor suppressor p53 or with a minigene encoding the p53-derived immunodominant peptide p53(264)LLGRNSFEV272 (L9V). Vaccination with the full-length p53 construct induced potent cytotoxic activity of...... concordance with this, immunization with L9V-pulsed dendritic cells also induced a potent and specific anti-L9V cytotoxic response in vitro. These data show that HLA-A2/peptide-specific cytotoxic immunity can be generated in vivo against the same immunodominant epitope by immunizing either with full...

  4. A Novel Melanocortin-4 Receptor Mutation MC4R-P272L Associated with Severe Obesity Has Increased Propensity To Be Ubiquitinated in the ER in the Face of Correct Folding

    Science.gov (United States)

    Granell, Susana; Serra-Juhé, Clara; Martos-Moreno, Gabriel Á.; Díaz, Francisca; Pérez-Jurado, Luis A.; Baldini, Giulia; Argente, Jesús

    2012-01-01

    Heterozygous mutations in the melanocortin-4 receptor (MC4R) gene represent the most frequent cause of monogenic obesity in humans. MC4R mutation analysis in a cohort of 77 children with morbid obesity identified previously unreported heterozygous mutations (P272L, N74I) in two patients inherited from their obese mothers. A rare polymorphism (I251L, allelic frequency: 1/100) reported to protect against obesity was found in another obese patient. When expressed in neuronal cells, the cell surface abundance of wild-type MC4R and of the N74I and I251L variants and the cAMP generated by these receptors in response to exposure to the agonist, α-MSH, were not different. Conversely, MC4R P272L was retained in the endoplasmic reticulum and had reduced cell surface expression and signaling (by ≈3-fold). The chemical chaperone PBA, which promotes protein folding of wild-type MC4R, had minimal effects on the distribution and signaling of the P272L variant. In contrast, incubation with UBE-41, a specific inhibitor of ubiquitin activating enzyme E1, inhibited ubiquitination of MC4R P272L and increased its cell surface expression and signaling to similar levels as wild-type MC4R. UBE41 had much less profound effects on MC4R I316S, another obesity-linked MC4R variant trapped in the ER. These data suggest that P272L is retained in the ER by a propensity to be ubiquitinated in the face of correct folding, which is only minimally shared by MC4R I316S. Thus, studies that combine clinical screening of obese patients and investigation of the functional defects of the obesity-linked MC4R variants can identify specific ways to correct these defects and are the first steps towards personalized medicine. PMID:23251400

  5. Recovery of Cd(II), Co(II) and Ni(II) from Chloride Medium by Solvent Extraction Using CYANEX 923 and CYANEX 272 I

    International Nuclear Information System (INIS)

    The paper aims to study the extraction and separation of Cd(II), Co(II) and Ni(II) from their mixtures in hydrochloric acid medium with CYANEX 923 in kerosene. Preliminary investigations showed that only Cd(II) is extracted with CYANEX 923 while Co(II) and Ni(II) are not extracted. Different parameters affecting the extraction of Cd(II) with CYANEX 923 such as hydrochloric acid, hydrogen ion, extractant and metal concentrations, temperature investigations were also investigated. The stoichiometry of the extracted metal species investigated was found to be HCdCl3. 2 CYANEX 923. The stripping of the extracted Cd(II) species is obtained with 0.1 M HCl solution. Co(II) was found to be extracted with CYANEX 272 at ph 5.8 leaving Ni(II) in the solution. A developed process for the sequential of Cd(II), Co(II) and Ni(II) from their mixture in hydrochloric acid medium is proposed

  6. Towards DIB mapping in galaxies beyond 100 Mpc. A radial profile of the $\\lambda$5780.5 diffuse interstellar band in AM 1353-272 B

    CERN Document Server

    Monreal-Ibero, Ana; Wendt, Martin; Selman, Fernando; Lallement, Rosine; Brinchmann, Jarle; Kamann, Sebastian; Sandin, Christer

    2015-01-01

    Diffuse Interstellar Bands (DIBs) are non-stellar weak absorption features of unknown origin found in the spectra of stars viewed through one or several clouds of Interstellar Medium (ISM). Research of DIBs outside the Milky Way is currently very limited. Specifically spatially resolved investigations of DIBs outside of the Local Group is, to our knowledge, inexistent. Here, we explore the capability of the high sensitivity Integral Field Spectrograph, MUSE, as a tool to map diffuse interstellar bands at distances larger than 100 Mpc. We use MUSE commissioning data for AM 1353-272 B, the member with highest extinction of the "The Dentist's Chair", an interacting system of two spiral galaxies. High signal-to-noise spectra were created by co-adding the signal of many spatial elements distributed in a geometry of concentric elliptical half-rings. We derived decreasing radial profiles for the equivalent width of the $\\lambda$5780.5 DIB both in the receding and approaching side of the companion galaxy up to distan...

  7. Editorial-27(2)-Eng

    OpenAIRE

    Yuri Morales López

    2013-01-01

    Editorial, Vol.27, N°2 (31 de Julio de 2013).En este número se da continuidad a los aportes en el área de Matemáticas. Los trabajos presentados refieren a la Enseñanza de las Matemáticas y Matemáticas Aplicadas.

  8. 7 CFR 27.2 - Terms defined.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...) Department. The United States Department of Agriculture. (c) Service. The Agricultural Marketing Service of...'s stead. (g) Marketing Services Office. A facility of the Cotton Division established under the...

  9. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  10. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  11. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  12. Dicty_cDB: SHG272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _sjs2-16-2G01-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682907 |CV682907.1 service43_H0...6_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682854 |CV682854.1 service30_G

  13. 40 CFR 60.272a - Standard for particulate matter.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for particulate matter. 60... Standard for particulate matter. (a) On and after the date of which the performance test required to be... control device and contain particulate matter in excess of 12 mg/dscm (0.0052 gr/dscf); (2) Exit from...

  14. 38 CFR 17.272 - Benefits limitations/exclusions.

    Science.gov (United States)

    2010-07-01

    ... procedures. (28) Services and supplies related to artificial insemination (including semen donors and semen... as payment-in-full. (Reference 42 CFR parts 489 and 1003). (3) An authorized provider of covered..., congenital anomalies, or disease, including, but not limited to: (A) Artificial limbs. (B) Voice...

  15. 7 CFR 272.1 - General terms and conditions.

    Science.gov (United States)

    2010-01-01

    ... applying for food stamp benefits, through the Systematic Alien Verification for Entitlements (SAVE) Program..., other eligibility criteria, such as work registration, resources, tax dependency, and alien status... 9, 1981. (30) Amendment 191. Areas subject to the photo ID card requirement must have issued...

  16. 50 CFR 216.272 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... novaeangliae)—110 (an average of 22 annually) (B) Fin whale (Balaenoptera physalus)—870 (an average of 174 annually) (C) Blue whale (Balaenoptera musculus)—3085 (an average of 617 annually) (D) Minke whale (Balaenoptera acutorostrata)—665 (an average of 133 annually) (E) Gray whale (Eschrichtius robustus)—27340...

  17. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  18. 29 CFR 1910.272 - Grain handling facilities.

    Science.gov (United States)

    2010-07-01

    ... selection and use of any personal protective equipment which is to be worn. Equally important is the... emergency action plan meeting the requirements contained in 29 CFR 1910.38. (e)Training. (1) The employer... limit, or if toxic agents are present in excess of the ceiling values listed in subpart Z of 29 CFR...

  19. 7 CFR 272.5 - Program informational activities.

    Science.gov (United States)

    2010-01-01

    ... Program informational activities. (a) Definition. “Program informational activities” are those activities... the socio-economic and demographic characteristics of the target population, types of media...

  20. 38 CFR 3.272 - Exclusions from income.

    Science.gov (United States)

    2010-07-01

    ... calendar year to an individual Indian from trust lands or restricted lands as defined in 25 CFR 151.2... course of business, except amounts received in excess of the sales price, for example, interest on...) Victims of Crime Act. Amounts received as compensation under the Victims of Crime Act of 1984 unless...

  1. 38 CFR 21.272 - Veteran-student services.

    Science.gov (United States)

    2010-07-01

    ... by the Chapter 30 rate; (2) Motivation of the veteran; and (3) Compatibility of the work assignment... out under the supervision of a VA employee; (2) Preparation and processing of necessary VA papers...

  2. 7 CFR 272.9 - Approval of homeless meal providers.

    Science.gov (United States)

    2010-01-01

    ....9 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM REQUIREMENTS FOR PARTICIPATING STATE... State or local governmental agency identified by the State food stamp agency, shall...

  3. Dicty_cDB: VSH272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y*qmviqy*pnkkr ymkrtkky*q*kkhlki**iyikqktv*ih*pl*mkeetnflekkvdkrtrlqnkn**qy qqe*kn*ei*igiyifl...ktqki*sqiiknqqtyp**nmh** Frame C: xgkyatepyleekhpqksrkke*thlakkgnerifrkfi*akcekcnkhrkksrsqsgsk r...astkepkkgvntfsekrk*kdfskiylgkm*ev**tqekk*eperqq ek**ikdgdih*qtmkyyf*qmyinqni*kdihfi**eeq*hh*q*lyh*dfly*iilg*...0.00 m_ : 0.00 36.0 %: endoplasmic reticulum 32.0 %: plasma membrane 12.0 %: mitochondrial 8.0 %: nuclear 4.0 %: vesicles of secret... *vqn*dy*sl*vvl*gd**ygr*v*ylivymixnihmk*ked**we**clsfqk*cfsfh ffghifisvyhqi*q*dvyghhmd*qyihiwdyhy*iqyyyyyleq

  4. Dicty_cDB: AFJ272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of HSP's gapped (non-prelim): 0 length of query: 115 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 98 effective length of database: 78,821,179 effective search space: 7724475542 effective...essful extensions: 0 Number of sequences better than 10.0: 0 length of query: 115 length of database: Z,831,660,665 effective... HSP length: 21 effective length of query: 94 effective length of database: Z,018,671,117 effective... search space: 3949755084998 effective search space used: 3949755084998 T: 0 A: 0 X1: 6 (11.9 bits)

  5. 7 CFR 272.10 - ADP/CIS Model Plan.

    Science.gov (United States)

    2010-01-01

    ..., resources and household size). Redetermine or revalidate eligibility and benefits based on notices of change...) of cases requiring Notices of: (A) Case Disposition, (B) Adverse Action and Mass Change, and (C... reporting and retrospective budgeting as required. (2) Issuance, reconciliation and reporting. (i)...

  6. 14 CFR 27.2 - Special retroactive requirements.

    Science.gov (United States)

    2010-01-01

    ... occupant must be protected from serious head injury by a safety belt plus a shoulder harness that will prevent the head from contacting any injurious object. (3) The safety belt and shoulder harness must meet... each rotorcraft manufactured after September 16, 1992, each applicant must show that each...

  7. 7 CFR 272.4 - Program administration and personnel requirements.

    Science.gov (United States)

    2010-01-01

    ... same non-English language and which do not contain adult(s) fluent in English as a second language; (2... which speak the same non-English language (a single-language minority), the State agency shall provide... households. (B) If notices are required in only one language other than English, notices may be printed...

  8. SEPARATION OF THORIUM FROM YTTERBIUM WITH CYANEX272 BY USING A HOLLOW FIBER MEMBRANE EXTRACTOR

    Institute of Scientific and Technical Information of China (English)

    F.J. Zhang; F. Luo; D.Q. Li; Y.L. Wu

    2001-01-01

    The based membrane extraction of Th(IV) and Yb(III) was studied with HBTMPP in heptane. The separation process of Th(IV) and Yb(HI) was proposed to be a kinetics competition one. The separation of mixture Th(IV) and Yb(III) was carried out by two successive extraction and stripping simultaneously. The concentration ratio of Th(IV) and Yb(III) is 16.74 in the stripping solution. The recovery of Th(IV) is 71.6%. The purity of Th(IV) is 95.74%. The separation factor of Th(IV) and yb(III)is 2.52× 106, which was obtained by interfacial kinetics.

  9. 75 FR 15679 - Foreign-Trade Zone 272-Lehigh Valley, Pennsylvania Application for Subzone Grundfos Pumps...

    Science.gov (United States)

    2010-03-30

    ... on the foreign components used in export production. The company anticipates that some 20 percent of... reduced on foreign status production equipment. The request indicates that the savings from FTZ procedures... Grundfos Pumps Manufacturing Corporation (Multi-Stage Centrifugal Pumps); Allentown, PA An application...

  10. Intravenous anti-D treatment of immune thrombocytopenic purpura: experience in 272 patients.

    Science.gov (United States)

    Scaradavou, A; Woo, B; Woloski, B M; Cunningham-Rundles, S; Ettinger, L J; Aledort, L M; Bussel, J B

    1997-04-15

    We report the results of intravenous anti-D (WinRho, WinRho SD) therapy in 261 non-splenectomized patients treated at the New York Hospital-Cornell Medical Center over the period from 1987 to 1994. Children (n = 124) and adult patients (n = 137) with classic immune thrombocytopenic purpura (ITP; n = 156) or human immunodeficiency virus (HIV) related thrombocytopenia (n = 105) and acute (n = 75) or chronic (n = 186) disease at the time of the initial anti-D treatment were studied. In addition, 11 previously splenectomized patients were treated as a separate group. Our objectives were to evaluate the following. (1) Efficacy of anti-D: The response after the initial infusion was analyzed according to clinical parameters, such as patient's age, HIV status, gender, disease duration, pretreatment platelet count, and hemoglobin value, as well as treatment-related factors, including the dose of anti-D, the solvent detergent treatment of the preparation, and the type of administration. (2) Use of anti-D as maintenance therapy: The duration of response after the initial infusion and the results of subsequent treatments were evaluated. (3) Safety/toxicity of anti-D: Postinfusion reactions and hemoglobin decrease after treatment were studied. Anti-D is a safe treatment providing a hemostatic platelet increase in greater than 70% of the Rh+ non-splenectomized patients. The group with the best results is HIV- children, but all patient groups respond and the effect lasts more than 21 days in 50% of the responders. Duration of response is not influenced by HIV status; furthermore, HIV+ patients show no adverse effects on hemoglobin decrease or HIV disease progression. Patients with chronic ITP after splenectomy have minimal or no response to intravenous anti-D. PMID:9108386

  11. Zirconium (IV) enrichment followed spectrophotometric determination using Amberlite XAD-2 impregnated with Cyanex 272

    International Nuclear Information System (INIS)

    Zirconium is extensively used in chemical industries due to its resistance to corrosion by many common acids, alkalis and other agents. It is also used in vacuum tubes, in steels as an alloying agents, surgical appliances, photoflash bulbs, explosive primers, rayon spinnerets, and lamp filaments. Thus, its separation and determination bears importance due to its industrial importance. The increased awareness towards the use and disposal of hazardous organic solvents has focused on the use of green methods. Solid phase is a clean separation method. The used liquid extraction impregnated on resinous solid material offer simple process for isolation of metals of interest

  12. 40 CFR 272.501 - Florida State-administered program: Final authorization.

    Science.gov (United States)

    2010-07-01

    .../92 Recycled Used Oil Management Standards (Checklist 112) 57 FR 41566: Amendments to 40 CFR Parts 260... Corrections I (Checklist 122) 58 FR 26420: Amendments to 40 CFR Parts 261, 264, and 265 5/3/93 (5) Memorandum...; Technical Amendments II (Checklist 96) 56 FR 42504 8/27/91 Coke Ovens Administrative Stay (Checklist 98)...

  13. Erratum: "Chemical Inhomogeneities in the Milky Way Stellar Halo" (2009, AJ, 137, 272)

    Science.gov (United States)

    Roederer, Ian U.

    2010-04-01

    We have been alerted that the angular momentum components listed for Galactic globular clusters in Table 4 of our original analysis are at odds with other recent determinations of these quantities (e.g., Smith et al. 2009), and we thank Martin C. Smith for pointing out this discrepancy. We have identified and corrected an error in our computation of the cluster coordinates that affected both the angular momentum components and the orbital parameters listed in Table 4. In this Erratum, we present a corrected version of Table 4, revised Figures 16-19, which relied on the data presented in Table 4, and a very brief description of the observed correlations. This material supersedes that presented in Section 7.2 of the original analysis. Orbital parameters are included in all cases where the cluster completed enough orbits to allow these quantities to settle to a constant value. We also include kinematic properties of two clusters (M13 and NGC 104) that did not meet this criterion in our original analysis. Using the kinematic criteria for inner and outer halo membership listed in Section 4 of our original study, three clusters fit the inner halo classification (M4, M22, and M55), and six clusters fit the outer halo classification (M3, M13, M68, NGC 5466, Pal 5, and Pal 12). Figures 16-19 display mean abundance ratios for these clusters using the corrected orbital parameters. There may be a hint that [Mg/Fe] in the outer halo clusters (lang[Mg/Fe]rang = +0.20 ± 0.09, σ= 0.15, N= 4) is slightly lower than in the inner halo clusters (lang[Mg/Fe]rang = +0.35 ± 0.07, σ= 0.10, N= 3), even if we exclude Pal 12, which shares the same low [α/Fe] abundance ratios as Sagittarius. The mean dispersions in [X/Fe] of the inner and outer halo clusters are comparable. The [Ba/Eu] ratio in the outer halo clusters (lang[Ba/Eu]rang = -0.32 ± 0.07, σ= 0.12, N= 4) is also lower than in the inner halo clusters (lang[Ba/Eu]rang = +0.00 ± 0.20, σ= 0.28, N= 3), again excluding Pal 12. The [Y/Fe] ratio may correlate with cluster orbital parameters in that only sub-solar [Y/Fe] ratios are found in clusters with R apogsim 10 kpc, |Z max| >~ 5 kpc, or V philsim 100 km s-1. These trends generally resemble those observed in metal-poor field stars. We stress that this error only affects the globular cluster kinematic properties discussed in Section 7.2 of the original analysis. All other sections of that work, including the kinematic properties for field halo stars listed in Table 1, are correct in the original version.

  14. N-(2-{[7-(2-Anilinoethoxy-3,6-dibromonaphthalen-2-yl]oxy}ethylaniline

    Directory of Open Access Journals (Sweden)

    Qian-Shou Zong

    2012-05-01

    Full Text Available In the title compound, C26H24Br2N2O2, the central naphthalene system carries two Br atoms and two –CH2CH2NHC6H5 substituents. The phenyl rings of the latter residues are inclined at 74.17 (17 and 51.4 (2° with respect to the naphthalene ring system. Each alkyl chain adopts a fully extended all-cis conformation with respect to the naphthalene and phenyl rings [N—C—C—O torsion angles = 68.6 (4 and 60.5 (4°]. In the crystal, one of the N—H groups forms bifurcated N—H...(Br,O hydrogen bonds, which link the molecules into inversion-related dimers. The centrosymmetric dimers are aggregated via pairs of C—H...π interactions into sheets parallel to (110.

  15. People and things. CERN Courier, Mar 1987, v. 27(2)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A symposium to celebrate the sixtieth birthday of T. D. Lee and to commemorate the thirtieth anniversary of the discovery of parity (left-right symmetry) nonconservation was held at Columbia in November. Last year's traditional annual summer Workshop on High Energy Physics and Field Theory was held in Protvino near Serpukhov, USSR, under the sponsorship of the Institute for High Energy Physics. A special symposium at the University of Timisoara, Roumania, in November marked the 50th anniversary of the landmark contributions to the physics of vector fields by the Roumanian theoretician Alexandru Proca (1897-1955). The Computer Applications in Nuclear and Plasma Sciences Technical Committee of the Nuclear and Plasma Physics Society, US Institute of Electrical and Electronics Engineers, has set up a new individual award 'for outstanding professional contributions to the profession of using computers in nuclear and/or plasma scientific research', regardless of nationality

  16. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  17. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  18. 42 CFR 423.272 - Review and negotiation of bid and approval of plans submitted by potential Part D sponsors.

    Science.gov (United States)

    2010-10-01

    ... risk plans. There is no limit on the number of full risk plans that CMS approves under paragraph (b) of... financial risk. (3) Limited exercise of authority. CMS approves only the minimum number of limited risk... sufficiently below the national average monthly bid to result in a negative premium. In the event of a...

  19. 25 CFR 1000.272 - Do Tribes/Consortia need to be aware of areas which FTCA does not cover?

    Science.gov (United States)

    2010-04-01

    ... workmen's compensation; (3) Claims for breach of contract rather than tort claims; or (4) Claims resulting from activities performed by an employee which are outside the scope of employment. (c) What remedies..., or interference with contract rights, unless otherwise authorized by 28 U.S.C. 2680(h). (b)...

  20. SU-E-J-272: Auto-Segmentation of Regions with Differentiating CT Numbers for Treatment Response Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Yang, C; Noid, G; Dalah, E; Paulson, E; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States); Gilat-Schmidt, T [Marquette University, Milwaukee, WI (United States)

    2015-06-15

    Purpose: It has been reported recently that the change of CT number (CTN) during and after radiation therapy (RT) may be used to assess RT response. The purpose of this work is to develop a tool to automatically segment the regions with differentiating CTN and/or with change of CTN in a series of CTs. Methods: A software tool was developed to identify regions with differentiating CTN using K-mean Cluster of CT numbers and to automatically delineate these regions using convex hull enclosing method. Pre- and Post-RT CT, PET, or MRI images acquired for sample lung and pancreatic cancer cases were used to test the software tool. K-mean cluster of CT numbers within the gross tumor volumes (GTVs) delineated based on PET SUV (standard uptake value of fludeoxyglucose) and/or MRI ADC (apparent diffusion coefficient) map was analyzed. The cluster centers with higher value were considered as active tumor volumes (ATV). The convex hull contours enclosing preset clusters were used to delineate these ATVs with color washed displays. The CTN defined ATVs were compared with the SUV- or ADC-defined ATVs. Results: CTN stability of the CT scanner used to acquire the CTs in this work is less than 1.5 Hounsfield Unit (HU) variation annually. K-mean cluster centers in the GTV have difference of ∼20 HU, much larger than variation due to CTN stability, for the lung cancer cases studied. The dice coefficient between the ATVs delineated based on convex hull enclosure of high CTN centers and the PET defined GTVs based on SUV cutoff value of 2.5 was 90(±5)%. Conclusion: A software tool was developed using K-mean cluster and convex hull contour to automatically segment high CTN regions which may not be identifiable using a simple threshold method. These CTN regions were reasonably overlapped with the PET or MRI defined GTVs.

  1. SU-E-J-272: Auto-Segmentation of Regions with Differentiating CT Numbers for Treatment Response Assessment

    International Nuclear Information System (INIS)

    Purpose: It has been reported recently that the change of CT number (CTN) during and after radiation therapy (RT) may be used to assess RT response. The purpose of this work is to develop a tool to automatically segment the regions with differentiating CTN and/or with change of CTN in a series of CTs. Methods: A software tool was developed to identify regions with differentiating CTN using K-mean Cluster of CT numbers and to automatically delineate these regions using convex hull enclosing method. Pre- and Post-RT CT, PET, or MRI images acquired for sample lung and pancreatic cancer cases were used to test the software tool. K-mean cluster of CT numbers within the gross tumor volumes (GTVs) delineated based on PET SUV (standard uptake value of fludeoxyglucose) and/or MRI ADC (apparent diffusion coefficient) map was analyzed. The cluster centers with higher value were considered as active tumor volumes (ATV). The convex hull contours enclosing preset clusters were used to delineate these ATVs with color washed displays. The CTN defined ATVs were compared with the SUV- or ADC-defined ATVs. Results: CTN stability of the CT scanner used to acquire the CTs in this work is less than 1.5 Hounsfield Unit (HU) variation annually. K-mean cluster centers in the GTV have difference of ∼20 HU, much larger than variation due to CTN stability, for the lung cancer cases studied. The dice coefficient between the ATVs delineated based on convex hull enclosure of high CTN centers and the PET defined GTVs based on SUV cutoff value of 2.5 was 90(±5)%. Conclusion: A software tool was developed using K-mean cluster and convex hull contour to automatically segment high CTN regions which may not be identifiable using a simple threshold method. These CTN regions were reasonably overlapped with the PET or MRI defined GTVs

  2. Karvainen 3D-hahmo Blenderillä : Blender 2.72 ja tulevaisuuden näkymiä

    OpenAIRE

    Wallenius, Jarmo

    2015-01-01

    Opinnäytetyöni tavoitteena on tutkia, miten hyvin avoimen lähdekoodin 3D-ohjelmisto Blender soveltuu karvaisen, suhteellisen realistisen hahmon luomiseen tällä hetkellä. Suunnittelen ja toteutan antropomorfisen rottahahmon ja selvitän kahden lyhyen animaation avulla, miten uskottavan lopputuloksen pystyn saamaan aikaan ja millaisia haasteita kohtaan matkalla. Ensimmäinen animaatio on yksinkertainen kävelyanimaatio ja toisessa animaatiossa hahmo haukottelee. Käytän renderöintiin Blenderin Cycl...

  3. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  4. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  5. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  6. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  7. Swift J0513.4-6547 = LXP 27.2 : a new Be/X-ray binary system in the Large Magellanic Cloud

    CERN Document Server

    Coe, M J; Bartlett, E S; Udalski, A

    2014-01-01

    An exceptionally bright new X-ray source in the Large Magellanic Cloud was discovered by the Swift/BAT telescope on MJD 54923 (2 April 2009), and shown to have a pulse period of 27s using follow-up observations by RXTE/PCA. We report here on detailed timing observations taken over the following weeks using Fermi/GBM which reveal an excellent orbital solution and indicate that the source flux peaked at $\\sim10^{38}$ erg s$^{-1}$. In addition, we report on follow-up optical observations (spectroscopic and photometric) which permit a classification of the mass donor star as B1Ve, and furthermore reveal a strong optical modulation at a period consistent with the binary period found from the Fermi/GBM data - 27.4 d. The dynamical mass estimate for the Be star is not in agreement with that expected for a B1V star - a mismatch similar to this has been previously reported for the few other Magellanic Cloud stars that also have dynamical mass estimates. In addition, the neutron star magnetic field determination from t...

  8. SU-E-T-272: Radiation Damage Comparison Between Intensity Modulated Radiotherapy and Field-In-Field Technique in Breast Cancer Treatments

    International Nuclear Information System (INIS)

    Purpose: To compare normal tissue complications between IMRT and FIF treatment in breast cancer. Methods: 16 patients treated with IMRT plan and 20 patients treated with FIF plan were evaluated in this study. Both kinds of plans were generated using Eclipse treatment planning system by dosimetrist following clinical radiotherapy treatment guidelines. The plans were reviewed and approved by radiation oncologist. The average survival fraction (SF) for three different normal tissue cells of each concerned structure can be calculated from differential dose volume histogram (DVH) using linear quadratic model. The three types of normal tissues include radiosensitive, moderately radiosensitive and radio-resistant that represents 70%, 50% and 30% survival fractions, respectively, for a 2-Gy open field. Equivalent uniform doses (EUD) for corresponding normal tissues of each structure were calculated. Results: The EUDs of the lungs, heart, healthy breast and spinal cord with both IMRT and FIF treatments were calculated. Considering the average value of all IMRT plans, the lung of treated side absorbed 16.0% of dosage prescribed to the tumor if the radiosensitivity of the lung is similar to the radiosensitive cell line. For moderately radiosensitive and radio-resistant lung tissue, the average EUDs can be 18.9% and 22.4% of prescription. In contrast, patients treated with FIF plans were delivered 6.0%, 7.5% and 10.3% of prescribed dose for radiosensitive, moderately radiosensitive and radio-resistant lung tissue, respectively. Comparing heart EUDs between IMRT and FIF plans, average absorbed doses in IMRT treatment were 7.7%, 8.7% and 9.7% of prescription for three types of heart normal tissue cell lines while FIF treatments delivered only 1.3%, 1.5% and 1.6% of prescription dose. For the other organs, the results were similar. Conclusion: The results indicated that breast cancer treatment using IMRT technique had more normal tissue damage than FIF treatment. FIF demonstrated more effective normal tissue dose reduction in breast cancer treatment

  9. Catherine Ceniza Choy, Empire of Care: Nursing and Migration in Filipino American History, Durham, N.C. : Duke University Press, 2003, 272 p.

    OpenAIRE

    Debonneville, Julien

    2015-01-01

    Une immersion dans l’« Empire du care ». Telle est l’ambition de Catherine Ceniza Choy en interrogeant l’histoire de la migration des infirmières philippines vers les États-Unis au cours du XXe siècle. L’auteure interroge plus spécifiquement les ressorts du dispositif colonial états-unien afin de jeter un éclairage nouveau sur la période contemporaine. Elle cherche à comprendre comment « la migration internationale contemporaine des infirmières philippines est inextricablement liée à la pério...

  10. ABC 27-2 General bat activity measured with an ultrasound detector in a fragmented tropical landscape in Los Tuxtlas, Mexico

    OpenAIRE

    Estrada, A.; Jímemez, C.; A. Rivera; Fuentes, E.

    2004-01-01

    Bat tolerance to neotropical forest fragmentation may be related to ability by bats to use available habitats in the modified environmental matrix. This paper presents data on general bat activity (for three hours starting at dusk) measured with an ultrasound detector in a fragmented landscape in the region of Los Tuxtlas, Mexico. Bat activity was measured in continuous forests, forests fragments, forest-pasture edges, forest corridors, linear strips of vegetation, citrus groves, pastures and...

  11. SU-E-T-272: Radiation Damage Comparison Between Intensity Modulated Radiotherapy and Field-In-Field Technique in Breast Cancer Treatments

    Energy Technology Data Exchange (ETDEWEB)

    Ai, H [IU School of Medicine, Indianapolis, IN (United States); Zhang, H [Northwestern Memorial Hospital, Chicago, IL (United States)

    2014-06-01

    Purpose: To compare normal tissue complications between IMRT and FIF treatment in breast cancer. Methods: 16 patients treated with IMRT plan and 20 patients treated with FIF plan were evaluated in this study. Both kinds of plans were generated using Eclipse treatment planning system by dosimetrist following clinical radiotherapy treatment guidelines. The plans were reviewed and approved by radiation oncologist. The average survival fraction (SF) for three different normal tissue cells of each concerned structure can be calculated from differential dose volume histogram (DVH) using linear quadratic model. The three types of normal tissues include radiosensitive, moderately radiosensitive and radio-resistant that represents 70%, 50% and 30% survival fractions, respectively, for a 2-Gy open field. Equivalent uniform doses (EUD) for corresponding normal tissues of each structure were calculated. Results: The EUDs of the lungs, heart, healthy breast and spinal cord with both IMRT and FIF treatments were calculated. Considering the average value of all IMRT plans, the lung of treated side absorbed 16.0% of dosage prescribed to the tumor if the radiosensitivity of the lung is similar to the radiosensitive cell line. For moderately radiosensitive and radio-resistant lung tissue, the average EUDs can be 18.9% and 22.4% of prescription. In contrast, patients treated with FIF plans were delivered 6.0%, 7.5% and 10.3% of prescribed dose for radiosensitive, moderately radiosensitive and radio-resistant lung tissue, respectively. Comparing heart EUDs between IMRT and FIF plans, average absorbed doses in IMRT treatment were 7.7%, 8.7% and 9.7% of prescription for three types of heart normal tissue cell lines while FIF treatments delivered only 1.3%, 1.5% and 1.6% of prescription dose. For the other organs, the results were similar. Conclusion: The results indicated that breast cancer treatment using IMRT technique had more normal tissue damage than FIF treatment. FIF demonstrated more effective normal tissue dose reduction in breast cancer treatment.

  12. ABC 27-2 General bat activity measured with an ultrasound detector in a fragmented tropical landscape in Los Tuxtlas, Mexico

    Directory of Open Access Journals (Sweden)

    Estrada, A.

    2004-12-01

    Full Text Available Bat tolerance to neotropical forest fragmentation may be related to ability by bats to use available habitats in the modified environmental matrix. This paper presents data on general bat activity (for three hours starting at dusk measured with an ultrasound detector in a fragmented landscape in the region of Los Tuxtlas, Mexico. Bat activity was measured in continuous forests, forests fragments, forest-pasture edges, forest corridors, linear strips of vegetation, citrus groves, pastures and the vegetation present in local villages. The highest bat activity rates were recorded in the villages, in the forest fragments and in linear strips of vegetation. The lowest activity rates were detected in pasture habitats. Data suggest that native and man-made arboreal vegetation may be important for sustaining bat activity in fragmented landscapes.

  13. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    International Nuclear Information System (INIS)

    Several reactions producing odd-Z transactinide compound nuclei were studied with the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus at or near the same excitation energy with similar values of angular momentum via different nuclear reactions. In doing so, it can be determined if there is a preference in entrance channel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' model is nearly identical for the two reactions. Additionally, because the same compound nucleus is produced, the exit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs; cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrance channel in these paired reactions. Charge equilibration immediately prior to fusion leading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35 ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki, Siwek-Wilcznska, and Wilczynski's 'Fusion By Diffusion' theory

  14. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  15. Michał Głuszkowski, Socjologia w badaniach dwujęzyczności, Toruń: Wydawnictwo Naukowe Uniwersytetu Mikołaja Kopernika, 2013, 272 ss.

    Directory of Open Access Journals (Sweden)

    Anna Zielińska

    2015-12-01

    Full Text Available Review The basic aim of the book of Michał Głuszkowski Socjologia w badaniach dwujęzyczności (Eng. Sociology in Bilingualism Research, is to describe theoretical reasons for the use of sociology in bilingualism research. The author proposes several of sociological theories which are adequate for language contact research. RecenzjaKsiążka Michała Głuszkowskiego Socjologia w badaniach dwujęzyczności, wydana przez Wydawnictwo Naukowe Uniwersytetu Mikołaja Kopernika w roku 2013 jest pierwszą w Polsce teoretyczną rozprawą omawiającą kierunki i rozwój badań nad dwujęzycznością w językoznawstwie światowym. Autor skoncentrował się na aspektach socjologicznych, dokonując przeglądu literatury światowej pod kątem uwzględniania wpływu czynników pozajęzykowych na strukturę języków funkcjonujących w kontakcie. Książka składa się z trzech głównych rozdziałów (rozdział I: „Teoretyczne podstawy dla wykorzystania teorii socjologicznych w badaniach dwujęzyczności”, rozdział II: „Socjologiczne uzupełnienie teorii kontaktów językowych”, rozdział III: „Teoria a praktyka. Przykłady zastosowania teorii socjologicznych w badaniach nad dwujęzycznością”, wstępu, zakończenia, streszczeń w językach rosyjskim i angielskim oraz bibliografii.

  16. Julge pealehakkamine on pool võitu : Maailmakirjandus. 1. osa. Keskajast valgustuseni. Koostanud J. Talvet. Tallinn : Koolibri, 1995. 272 lk ; Maailmakirjandus. 2. osa. Romantismist postmodernismini. Koostanud J. Talvet. Tallinn : Koolibri, 1999. 38

    Index Scriptorium Estoniae

    Puhvel, Heino

    2000-01-01

    Rets. : Maailmakirjandus. 1. osa, Keskajast valgustuseni : õpik keskkoolile / koostanud Jüri Talvet. - Tallinn : Koolibri, 1995 ([Tartu] : Greif) ; Maailmakirjandus. 2. osa, Romantismist postmodernismini : õpik keskkoolile / koostanud Jüri Talvet. - Tallinn : Koolibri, 1999 ([Tartu] : Greif)

  17. Multibeam collection for TN272: Multibeam data collected aboard Thomas G. Thompson from 2011-11-05 to 2011-12-17, departing from Honolulu, HI and returning to Apra, Guam

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Segio Federowsky. El medioambiente no le importa a nadie. Bestialidades ecológicas en la Argentina: del Riachuelo a las Papeleras : Editorial Planeta, Buenos Aires, 2007, 272 páginas

    OpenAIRE

    Tram[p]as de la Comunicación y la Cultura

    2008-01-01

    Desde un enfoque más genérico y no abocado exclusivamente a sus vínculos con el proceso comunicacional, el biólogo y periodista Sergio Federovisky publicó El medio ambiente no le importa a nadie. Bestialidades ecológicas en la Argentina: del Riachuelo a las Papeleras. Tras un prólogo del jurista Daniel Sabsay, titular de la Fundación Ambiente y Recursos Naturales (FARN), el autor se interroga: “¿Cómo es posible que todo el mundo diga que hay que cuidar el medio ambiente, que hay que proteger ...

  19. Interaction between ADH1C Arg272Gln and alcohol intake in relation to breast cancer risk suggests that ethanol is the causal factor in alcohol related breast cancer

    DEFF Research Database (Denmark)

    Benzon Larsen, Signe; Vogel, Ulla Birgitte; Christensen, Jane;

    2010-01-01

    Alcohol is a risk factor for breast cancer. We wanted to determine if ADH polymorphisms which modify the rate of ethanol oxidation to acetaldehyde, were associated with breast cancer risk. We matched 809 postmenopausal breast cancer cases with 809 controls, nested within the prospective Diet...

  20. Philippe Ariès. Morir en Occidente: desde la Edad Media hasta nuestros días : Adriana Hidalgo Editora. Buenos Aires, 2007, 272 págs.

    OpenAIRE

    Bruzzone, Daiana

    2008-01-01

    Ligadas cada una a su contexto, las concepciones de la muerte configuran modos de convivencia social. A pesar de ello, las ciencias sociales son cómplices de su época, sostiene el autor, y hacen del tema uno de los mayores tabúes de nuestra sociedad contemporánea. En esta era postindustrial la muerte se encuentra prohibida en las prácticas cotidianas, de manera que detenerse allí puede resultar trivial para los intelectuales –dice Ariès-, quienes se ven mejor seducidos por su aspecto demográf...

  1. Olivier BLANC, Marie-Olympe de Gouges. Une humaniste à la fin du xviiie siècle, Cahors, Éditions René Viénet, 2003, 272 p.

    OpenAIRE

    Brouard-Arends, Isabelle

    2006-01-01

    L’ouvrage comprend une annexe qui présente un document inédit relatif à la fête du 23 mai 1792, en l’honneur du maire d’Étampes, rédigé par Olympe de Gouges et communiqué aux acteurs et actrices de la Comédie française afin d’ordonner le cortège des femmes. Il propose un panorama très complet des éditions des œuvres de madame de Gouges, à laquelle succède une bibliographie critique sur cette auteure ainsi que la liste de ses œuvres présentées par ordre chronologique, avec des commentaires, un...

  2. 36 CFR 261.22 - Unauthorized use of “Smokey Bear” and “Woodsy Owl” symbol.

    Science.gov (United States)

    2010-07-01

    ... “Woodsy Owl” symbol. (a) Manufacture, importation, reproduction, or use of “Smokey Bear” except as... of “Woodsy Owl” except as provided under §§ 272.2, 272.3, or 272.4 is prohibited....

  3. El Ayadi Mohammed, Rachik Hassan, Tozy Mohamed, L’Islam au quotidien. Enquête sur les valeurs et les pratiques religieuses au Maroc, Casablanca, Prologues, coll : Religion et société, 2007, 272 p.

    Directory of Open Access Journals (Sweden)

    Katia Boissevain

    2010-06-01

    Full Text Available Une enquête sociologique au Maroc, sur une thématique religieuse, fondée sur des questionnaires proposés dans l’ensemble du Royaume, n’était pas une mince affaire à organiser. Il a fallu vaincre les réticences des autorités et des enquêtés pour assurer le bon déroulement de l’entreprise. Hassan Rachik et Mohamed Tozy, qui examinent les développements de la société marocaine depuis vingt ans, se sont associés à Mohammed El Ayadi, qui vient compléter, par son regard de sociologue et d’historien...

  4. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  5. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  6. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  7. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  8. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  9. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  11. Genetic and bibliographic information: TRPV2 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available al Diseases (C06.405.469) > Colonic Diseases (C06.405.469.158) > Colonic Diseases, Functional (C06.405.469.158.272) > Irritable Bowel Syndrome (C06.405.469.158.272.608) 05A0781424 ...

  12. Genetic and bibliographic information: TRPV4 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available al Diseases (C06.405.469) > Colonic Diseases (C06.405.469.158) > Colonic Diseases, Functional (C06.405.469.158.272) > Irritable Bowel Syndrome (C06.405.469.158.272.608) 05A0781424 ...

  13. Review: Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity (2013)

    OpenAIRE

    Tinashe Nyamunda; Centre for Africa Studies, University of the Free State

    2014-01-01

    Review of the monograph:Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity, New York and Oxford: Berghahn Books, 2013, ISBN 978-0-85745-951-0, 272 pages Besprechung der Monographie:Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity, New York und Oxford: Berghahn Books, 2013, ISBN 978-0-85745-951-0, 272 Seiten

  14. Drug: D08462 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08462 Drug Quinisocaine (INN); Dimethisoquin C17H24N2O 272.1889 272.3853 D08462.gi...INES, ANESTHETICS, ETC. D04AB Anesthetics for topical use D04AB05 Quinisocaine D08462 Quinisocai

  15. Mechanisms and timing of replacement dental lamina regression

    Czech Academy of Sciences Publication Activity Database

    Dosedělová, H.; Dumková, J.; Lesot, H.; Glocová, K.; Hampl, A.; Tucker, A.; Buchtová, Marcela

    2013-01-01

    Roč. 296, special feature (2013), s. 272-272. ISSN 1932-8486. [International Congress of Vertebrate Morphology /10./. 08.07.2013-12.07.2013, Barcelona] Institutional support: RVO:67985904 Keywords : dental lamina Subject RIV: FF - HEENT, Dentistry

  16. 76 FR 24880 - Agency Information Collection Activities: Proposed Collection Renewals; Comment Request

    Science.gov (United States)

    2011-05-03

    ... may be hand-delivered to the guard station at the rear of the 17th Street Building (located on F..., including whether the information has practical utility; (b) the accuracy of the estimates of the burden of... Recordkeeping Hours: 1 hour x 5,272 hours = 5,272. Estimated Total Annual Reporting and Recordkeeping...

  17. Vibrio cholerae O1 isolated in Kenya.

    OpenAIRE

    Iwanaga, M; Mori, K.; Kaviti, J N

    1982-01-01

    Biological and serological analyses of 272 isolates of Vibrio cholerae O1 from six epidemics and from a few sporadic cases in Kenya were carried out. All of the isolates were identified as V. cholerae biotype E1 Tor, and 210 out of 272 isolates were hemolytic as examined by Feeley's method.

  18. AcEST: DK951672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available %) Frame = +3 Query: 93 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN 272 MVL NDIDLL+PPAE+EK+KHKLKRLVQSPNS+FMDV...KCQGCF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVV...= 78/84 (92%) Frame = +3 Query: 93 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN 272 MVL NDID...LLHPP E+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDV...tities = 70/84 (83%), Positives = 79/84 (94%) Frame = +3 Query: 93 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQG

  19. Drug: D05949 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05949 Drug Sulfadiazine ... sodium (USP); Sulfadiazine ... sodium (TN) C10H9N4O2S. Na 272.0344 272.2588 ... RIM J01EC Intermediate-acting sulfonamides J01EC02 Sulfadiazine ... D05949 Sulfadiazine ... sodium (USP) USP drug classifi ... cation [BR:br08302] Antibacterials Sulfonamides Sulfadiazine ... D05949 Sulfadiazine ... sodium (USP) Antiinfectives [B ...

  20. Dicty_cDB: Contig-U16352-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available discoideum cDNA clone:dds42b09, 3' ... 329 1e-91 2 ( AU074830 ) Dictyostelium discoideum slug...... 127 5e-69 4 ( AU074098 ) Dictyostelium discoideum slug cDNA, clone SSJ512. 272 1e-68 1 ( AU074090 ) Dictyostelium discoideum slug... cDNA, clone SSJ494. 272 1e-68 1 ( AU074011 ) Dictyostelium discoideum slug cDNA, c...lone SSJ246. 272 1e-68 1 ( AU073144 ) Dictyostelium discoideum slug cDNA, clone S...SG250. 272 1e-68 1 ( AU039142 ) Dictyostelium discoideum slug cDNA, clone SSM440. 272 1e-68 1 ( AU076393 ) D

  1. HLA-B27-Homodimer-Specific Antibody Modulates the Expansion of Pro-Inflammatory T-Cells in HLA-B27 Transgenic Rats.

    Directory of Open Access Journals (Sweden)

    Osiris Marroquin Belaunzaran

    Full Text Available HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA. HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272 and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS patients and HLA-B27 transgenic rats. We characterized a novel B272-specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorders.The monoclonal HD5 antibody was selected from a phage library to target cell-surface B272 homodimers and characterized for affinity, specificity and ligand binding. The immune modulating effect of HD5 was tested in HLA-B27 transgenic rats. Onset and progression of disease profiles were monitored during therapy. Cell-surface B272 and expansion of pro-inflammatory cells from blood, spleen and draining lymph nodes were assessed by flow cytometry.HD5 bound B272 with high specificity and affinity (Kd = 0.32 nM. HD5 blocked cell-surface interaction of B272 with immune regulatory receptors KIR3DL2, LILRB2 and Pirb. In addition, HD5 modulated the production of TNF from CD4+ T-cells by limiting B272 interactions in vitro. In an HLA-B27 transgenic rat model repetitive dosing of HD5 reduced the expansion of pro-inflammatory CD4+ T-cells, and decreased the levels of soluble TNF and number of cell-surface B272 molecules.HD5 predominantly inhibits early TNF production and expansion of pro-inflammatory CD4+ T-cells in HLA-B27 transgenic rats. Monoclonal antibodies targeting cell-surface B272 propose a new concept for the modulation of inflammatory responses in HLA-B27 related disorders.

  2. Structural analysis of an HLA-B27 functional variant: identification of residues that contribute to the specificity of recognition by cytolytic T lymphocytes.

    OpenAIRE

    Vega, M A; Ezquerra, A.; S Rojo; Aparicio, P.; Bragado, R; López de Castro, J. A.

    1985-01-01

    The structure of a variant HLA-B27 antigen, B27.2, that is distinguished from the HLA-B27.1 and HLA-B27.3 subgroups by specific cytolytic T lymphocytes has been established by comparative peptide mapping and sequence analysis. There are only three amino acid substitutions between B27.1 and B27.2: aspartate-77, threonine-80, and leucine-81 in HLA-B27.1 are changed to asparagine-77, isoleucine-80, and alanine-81 in HLA-B27.2. These changes account for their single charge difference detectable b...

  3. HLA-B27-homodimer-specific antibody modulates the expansion of pro-inflammatory T-cells in HLA-B27 transgenic rats

    OpenAIRE

    Osiris Marroquin Belaunzaran; Sascha Kleber; Stefan Schauer; Martin Hausmann; Flora Nicholls; Maries Van den Broek; Sravan Payeli; Adrian Ciurea; Simon Milling; Frank Stenner; Jackie Shaw; Simon Kollnberger; Paul Bowness; Ulf Petrausch; Christoph Renner

    2015-01-01

    Objectives: HLA-B27 is a common genetic risk factor for the development of Spondyloarthritides (SpA). HLA-B27 can misfold to form cell-surface heavy chain homodimers (B272) and induce pro-inflammatory responses that may lead to SpA pathogenesis. The presence of B272 can be detected on leukocytes of HLA-B27+ Ankylosing spondylitis (AS) patients and HLA-B27 transgenic rats. We characterized a novel B272–specific monoclonal antibody to study its therapeutic use in HLA-B27 associated disorder...

  4. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  5. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  6. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  7. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  8. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  9. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  10. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  11. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  12. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  13. Disease: H00134 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available o LJ Characterization of point mutations in patients with X-linked ichthyosis. Effects on the structure and function of the steroid sulfatase protein. J Biol Chem 272:20756-63 (1997) ...

  14. Recent approaches to the total synthesis of phytoprostanes, isoprostanes and neuroprostanes as important products of lipid oxidative stress and biomarkers of disease

    Czech Academy of Sciences Publication Activity Database

    Jahn, Emanuela; Durand, T.; Galano, J. M.; Jahn, Ullrich

    2014-01-01

    Roč. 108, č. 4 (2014), s. 301-319. ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : lipids * oxidative stress * phytoprostanes * isoprostanes * neuroprostanes * total synthesis Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  15. Increased presence of the thermophilic mosquitoes and potential vectors Anopheles hyrcanus (Pallas, 1771) and Culex modestus Ficalbi 1889 in Central Europe’s lower Dyje River basin (South Moravia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Šebesta, O.; Gelbič, Ivan

    2015-01-01

    Roč. 51, č. 3 (2015), s. 272-280. ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : Anopheles hyrcanus * Culex modestus * vector Subject RIV: EH - Ecology, Behaviour Impact factor: 0.513, year: 2014

  16. Význam kapra v rybničním hospodářství

    Czech Academy of Sciences Publication Activity Database

    Matěna, Josef; Flajšhans, Martin

    2013-01-01

    Roč. 61, č. 6 (2013), s. 272-274. ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour

  17. San Antonio Bay 1986-1989

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The effect of salinity on utilization of shallow-water nursery habitats by aquatic fauna was assessed in San Antonio Bay, Texas. Overall, 272 samples were collected...

  18. Is Rorty a linguistic idealist?

    Czech Academy of Sciences Publication Activity Database

    Marvan, Tomáš

    2011-01-01

    Roč. 21, č. 3 (2011), s. 272-279. ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion

  19. Alzheimer's Project

    Medline Plus

    Full Text Available ... 272.3900 Find your chapter: search by state Home > News & Events > Upcoming Events > HBO Alzheimer’s Project In the News Walk to End Alzheimer's Upcoming Events AAIC Advocacy Forum Rita ...

  20. Zelená kapalinová chromatografie pro jednoduché aplikace

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Kahle, Vladislav

    2015-01-01

    Roč. 109, č. 6 (2015), s. 470-474. ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : green analytical chemistry * green liquid chromatography * nanocolumns Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.272, year: 2014

  1. Chemicky aktivované a roubované substráty a jejich analýza

    Czech Academy of Sciences Publication Activity Database

    Benkocká, M.; Knapová, T.; Braborec, Jakub; Matoušek, J.; Černá, H.; Londesborough, Michael Geoffrey Stephen; Švorčík, V.; Kolská, Z.

    2015-01-01

    Roč. 109, č. 12 (2015), s. 960-964. ISSN 0009-2770 Institutional support: RVO:61388980 Keywords : surface activation * piranha solution * surface grafting Subject RIV: CA - Inorganic Chemistry Impact factor: 0.272, year: 2014

  2. Grammaticalization and lexicalization effects in participial morphology. A Construction Grammar approach to language change

    Czech Academy of Sciences Publication Activity Database

    Fried, Mirjam

    Amsterdam : Benjamins, 2010 - (Van Linden, A.; Verstraete, J.; Davidse, K.), s. 191-223 ISBN 978-90-272-0675-6 Institutional research plan: CEZ:AV0Z90610518 Keywords : grammaticalization * morphology * construction grammar Subject RIV: AI - Linguistics

  3. Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef

    2014-01-01

    Roč. 108, č. 4 (2014), s. 394-397. ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  4. Metody štěpení proteinů využitelné v proteomické analýze

    Czech Academy of Sciences Publication Activity Database

    Čmelík, Richard; Bobálová, Janette

    2016-01-01

    Roč. 110, č. 3 (2016), s. 174-178. ISSN 0009-2770 Institutional support: RVO:68081715 Keywords : proteins * proteomics Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.272, year: 2014

  5. 2012 USACE Post Hurricane Sandy Topographic LiDAR: Rhode Island and Massachusetts Coast

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This topographic elevation point data derived from multiple return light detection and ranging (LiDAR) represents 354.272 square miles of coastline for Rhode Island...

  6. Procedura per la nomina dei vescovi. Evoluzione dal Codice del 1917 al Codice del 1983. [Reseña

    OpenAIRE

    Le-Tourneau, D. (Dominique)

    2006-01-01

    Reseña de: Tkhorovskyy, Mykhaylo, Procedura per la nomina dei vescovi. Evoluzione dal Codice del 1917 al Codice del 1983, Editrice Pontificia Università Gregoriana, Tesi Gregoriana, Serie Diritto Canonico 67, Roma 2004, 272 pp.

  7. Valerian

    Science.gov (United States)

    ... Events Multimedia (Video, Images, and Audio) NCCIH Clinical Digest A monthly newsletter with evidence-based information on ... require a viewer such as the free Adobe Reader . NCCIH Publication No.: D272 Created: May 2006 Updated: ...

  8. Caustic addition system operability test procedure

    International Nuclear Information System (INIS)

    This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

  9. Nízkomolekulární inhibitory replikace enterovirů

    Czech Academy of Sciences Publication Activity Database

    Nencka, Radim; Hřebabecký, Hubert; Šála, Michal; Dejmek, Milan

    2014-01-01

    Roč. 108, č. 4 (2014), s. 326-334. ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : enteroviruses * antivirals * inhibitors of virus replication Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  10. mos114_0402c.tif -- Side scan sonar image from survey effort HMPR-114-2004-02c in the Olympic Coast National Marine Sanctuary.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in August 2004 onboard the NOAA vessel Tatoosh. An EG&G 272 side scan system was...

  11. Fishery Management Plan : St. Vincent National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The aquatic habitat available for sportfishing on St. Vincent National Wildlife Refuge consists of six fresh water lakes totaling 272 acres of water. Fishery...

  12. O použití Einsteinových rovnic v kosmologii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2015-01-01

    Roč. 60, č. 3 (2015), s. 255-272. ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144419

  13. WHO-defined Classification of Myeloproliferative Neoplasms: Morphological Reproducibility and Clinical Correlations - The Danish Experience

    DEFF Research Database (Denmark)

    Madelung, AB; Stamp, IMH; Nielsen, SL;

    2013-01-01

    We examined inter- and intraobserver reproducibility and concordance between histological diagnosis and independently collected clinical findings in a large series of patients with the major subtypes of myeloproliferative neoplasms (MPNs) and controls. Seven hematopathologists reviewed 272 bone...

  14. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  15. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  17. Anonymous Agencies, Backstreet Businesses and Covert Collectives

    DEFF Research Database (Denmark)

    Krause Hansen, Hans; Schoeneborn, Dennis

    2015-01-01

    Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381......Book review of: Anonymous Agencies, Backstreet Businesses and Covert Collectives: rethinking Organizations in the 21st Century, C. R. Scott. Stanford, CA: Stanford University Press, 2013. 272 pp. £45.90. ISBN 9780804781381...

  18. AcEST: DK959735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0005_I01 659 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_I01. 5' end seq ... 29/168 (76%) Frame = +3 Query: 93 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 272 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +3 Query: 93 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 272 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  19. Multiset consequence relations for substructural logics

    Czech Academy of Sciences Publication Activity Database

    Běhounek, Libor; Cintula, Petr

    Rio de Janeiro : ECEME - Escola de Comando e Estado -Maior do Exército, 2013 - (Béziau, J.; Buchsbaum, A.; Costa-Leite, A.; Altair, A.). s. 272-272 [UniLog 2013. World Congress and School on Universal Logic /4./. 29.03.2013-07.04.2013, Rio de Janeiro] Institutional support: RVO:67985807 Keywords : consequence relation * local consequence * substructural logics * relace dusledku * lokální důsledek * substrukturální logiky Subject RIV: BA - General Mathematics

  20. Structural Investigation of SBGESE Glasses by High Resolution X-Ray Photoelectron Spectroscopy

    Directory of Open Access Journals (Sweden)

    R. Golovchak

    2011-01-01

    Full Text Available The evolution of the structure of Sb8Ge32Se60 (Z=2.72 and Sb20Ge20Se60 (Z=2.60 chalcogenide glasses is determined by high resolution X-ray photoelectron spectroscopy. Glasses with Z=2.60 the structure consists of deformed tetrahedra and pyramids, in which at least one Se atom is substituted by Ge or Sb atom. For the Z=2.72 structure consisting of shared pyramids and tetrahedra with two or more Se atoms substituted by the cations. At the same time, Se-Se dimers are present in both compositions.

  1. Isolation and characterization of antibacterial compound from a mangrove-endophytic fungus, Penicillium chrysogenum MTCC 5108

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Rodrigues, C.; Naik, C.G.; DeSouza, L.

    ″, C-3″, C-3″a and C-7″a). The presence of two secondary amide groups were inferred from signals at 165.5 and 159.6 ppm from its 13C NMR spectra (CDCl3), sharp and strong IR absorptions at 3350 cm-1 and 1676 cm- 1 (Fig. 4), and also from... shift appropriate for tertiary alkyl group substitution [25]. Four new signals (27.2, 39, 113 and 144.2 ppm) have appeared in the spectrum of compound 1. The intensity of the signal at δ27.2 is suggestive of two similar carbons. These new carbon...

  2. AcEST: DK957696 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LGLDDA+E R +SQGMVGQ +R+AAG+IL+ Sbjct: 2 AAQVATTKVPEVRDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGLILE 61 Query: 273 MIKDGKIAGRA...KAAGIILQ 272 A A K+PEI+++TRIERIGAHSHIRGLGLDDA+E R SQGMVGQ AR+AAG++L+ Sbjct: 2 ATVAATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRA...DA+E R SQGMVGQ AR+AAG++L+ Sbjct: 2 ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLE 61 Query: 273 MIKDGKIAGRA...Q 272 A A K+PEI+++TRIERIGAHSHIRGLGLDDA+E R SQGMVGQ AR+AAG++L+ Sbjct: 2 ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLE...GLDDA+E R +SQGMVGQ AR+AAG+IL+M Sbjct: 2 ATMATTKVPEVRDVTRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILE

  3. 7个经典 Ramsey 数 R(k, l) 的新下界%NEW LOWER BOUNDS FOR SEVEN CLASSICAL RAMSEY NUMBERS R(k, l)

    Institute of Scientific and Technical Information of China (English)

    苏文龙; 罗海鹏; 李乔

    2000-01-01

    By a constructive method new lower bounds for sevenclassical Ramsey numbers are obtained:R(3,≥29) 174, R(4,≥23) 272, R(5,≥24) 488, R(7,≥12) 312, R(8,≥18) 728, R(8,≥20) 860, R(9,≥21) 1278.%利用构造性的方法,得到 7 个经典 Ramsey 数的新下界: R(3,≥29) 174, R(4,≥23) 272, R(5,≥24) 488, R(7,≥12) 312, R(8,≥18) 728, R(8,≥20) 860,≥R(9, 21) 1278.

  4. Tank farms essential drawing plan

    International Nuclear Information System (INIS)

    The purpose of this document is to define criteria for selecting Essential Drawings, Support Drawings, and Controlled Print File (CPF) drawings and documents for facilities that are part of East and West Tank Farms. Also, the drawings and documents that meet the criteria are compiled separate listings. The Essential Drawing list and the Support Drawing list establish a priority for updating technical baseline drawings. The CPF drawings, denoted by an asterisk (*), defined the drawings and documents that Operations is required to maintain per the TWRS Administration Manual. The Routing Boards in Buildings 272-WA and 272-AW are not part of the CPF

  5. Level density parameters for the back-shifted Fermi gas model in the mass range 24 ≤ A ≤ 250

    International Nuclear Information System (INIS)

    The parameters a and δeff for the back-shifted Fermi gas model are determined for 1224 nuclei. For 272 nuclei the parameters are determined from experimental data on cumulative numbers of low-lying levels and the average spacings between neutron resonances. For the rest of the nuclei the δeff parameter was determined from cumulative numbers of low-lying levels and values of the a parameter obtained by interpolation using the data for the 272 nuclei. A formula is suggested to account for damping of the shell effect at high excitation energies. A comparison is made with previous results and different experimental data on level densities. (author)

  6. AcEST: DK955358 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1NGRL0022_O05, 5' (272 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total lett...ype prothallia with plantlets Developmental stage gametophytes with sporophytes C...K955358|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_O05, 5' (272 letters) Datab..................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9ZU52|ALFC3_ARATH Probable...14779|CPXB_BACME Bifunctional P-450/NADPH-P450 reductase OS=... 29 8.4 >sp|Q9ZU52|ALFC3_ARATH Probable

  7. Book review: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics by Alexander Lerch

    DEFF Research Database (Denmark)

    Sturm, Bob L.

    2013-01-01

    A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00......A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00...

  8. CLOCK 3111 T/C SNP Interacts with Emotional Eating Behavior for Weight-Loss in a Mediterranean Population

    OpenAIRE

    López Guimerà, Gemma; Dashti, Hassan S.; Smith, Caren E.; Sánchez Carracedo, David; Ordovas, José M.; Garaulet Aza, Marta

    2014-01-01

    Objective: The goals of this research was (1) to analyze the role of emotional eating behavior on weight-loss progression during a 30-week weight-loss program in 1,272 individuals from a large Mediterranean population and (2) to test for interaction between CLOCK 3111 T/C SNP and emotional eating behavior on the effectiveness of the weight-loss program. Design and Methods: A total of 1,272 overweight and obese participants (BMI: 31±5 kg/m2), aged 20 to 65 years, attending outpatient weight-lo...

  9. Experiments with Superheavy Nuclei

    Science.gov (United States)

    Hofmann, S.

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α -α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  10. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO3, HReO4) ΔHads(ReO3) = -190 ± 10 kJ/mol; ΔSads(ReO3) = -179±30 J/mol K; ΔHads(HReO4) = -77 ± 5 kJ/mol; ΔSads(HReO4) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176Re, 152-155Er, 151-154Ho, 218Po, and 214Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  11. Experiments with superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author) 34 refs, 7 figs

  12. Chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Schaedel, M. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan). Advanced Science Research Center; GSI Helmholtz Center for Heavy Ion Research, Darmstadt (Germany)

    2012-07-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  13. New elements produced at GSI

    Science.gov (United States)

    Hofmann, Sigurd

    1998-12-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  14. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A. [Paul-Scherrer-Inst., Villigen (Switzerland); Gaeggeler, H.W. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Paul-Scherrer-Inst., Villigen (Switzerland)

    1999-07-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) {r_reversible} X(ads) (X = ReO{sub 3}, HReO{sub 4}) {delta}H{sub ads}(ReO{sub 3}) = -190 {+-} 10 kJ/mol; {delta}S{sub ads}(ReO{sub 3}) = -179{+-}30 J/mol K; {delta}H{sub ads}(HReO{sub 4}) = -77 {+-} 5 kJ/mol; {delta}S{sub ads}(HReO{sub 4}) = -187{+-}50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes {sup 169,170,174,176}Re, {sup 152-155}Er, {sup 151-154}Ho, {sup 218}Po, and {sup 214}Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  15. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, J.C.; Mizel, A.; Cote, M.; Cohen, M.L.; Louie, S.G. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States))

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (B[sub o]), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (B[sub o]). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated B[sub o] for Hs is comparable to that of diamond. [copyright] [ital 1999] [ital The American Physical Society

  16. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  17. Experiments with superheavy nuclei

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  18. Synthesis of heavy and superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. (Gesellschaft fur Schwerionenforshung (GSI), Darmstadt (Germany))

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-de-excitation channels. The isotopes were ambiguously identified by means of [alpha]-[alpha] correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on this results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reaction using [sup 208]Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use the neutron deficient projectile isotopes and use of actinide targets is discussed.

  19. New elements produced at GSI

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed

  20. Rational inattention to discrete choices: a new foundation for the multinomial logit model

    Czech Academy of Sciences Publication Activity Database

    Matějka, Filip; McKay, A.

    2015-01-01

    Roč. 105, č. 1 (2015), s. 272-298. ISSN 0002-8282 Institutional support: PRVOUK-P23 Keywords : discrete choice behavior * rational inattention * multinomial logit model Subject RIV: AH - Economics Impact factor: 3.673, year: 2014

  1. Rational inattention to discrete choices: a new foundation for the multinomial logit model

    Czech Academy of Sciences Publication Activity Database

    Matějka, Filip; McKay, A.

    2015-01-01

    Roč. 105, č. 1 (2015), s. 272-298. ISSN 0002-8282 R&D Projects: GA ČR(CZ) GPP402/11/P236 Institutional support: RVO:67985998 Keywords : discrete choice behavior * rational inattention * multinomial logit model Subject RIV: AH - Economics Impact factor: 3.673, year: 2014

  2. Thermodynamic study of selected monoterpenes II

    Czech Academy of Sciences Publication Activity Database

    Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.

    2014-01-01

    Roč. 79, Dec (2014), 272-279. ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal-gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014

  3. Ratio negativa - The Popperian Challenge

    Czech Academy of Sciences Publication Activity Database

    Parusniková, Zuzana

    Doetinchem: Springer, 2009 - (Parusnikova, Z.; Cohen, R.), s. 31-47. (Boston Studies in the Philosophy of Science. 272). ISBN 978-1-4020-9337-1 Institutional research plan: CEZ:AV0Z90090514 Keywords : Reason * justification * criticism * postmodernism * truth Subject RIV: AA - Philosophy ; Religion

  4. Ratio negativa - The Popperian Challenge

    Czech Academy of Sciences Publication Activity Database

    Parusniková, Zuzana

    Doetinchem: Springer, 2009 - (Parusnikova, Z.; Cohen, R.), s. 31-45. (Boston Studies in the Philosophy of Science. 272). ISBN 978-1-4020-9337-1. [Rethinking Popper. Praha (CZ), 10.09.2007-14.09.2007] Institutional research plan: CEZ:AV0Z90090514 Keywords : Reason * justification * criticism * postmodernism * truth Subject RIV: AA - Philosophy ; Religion

  5. Možnosti a perspektivy st?íbrného amalgámu v elektroanalytické chemii

    Czech Academy of Sciences Publication Activity Database

    Daňhel, Aleš; Josypčuk, Bohdan; Barek, J.; Fojta, Miroslav

    2016-01-01

    Roč. 110, č. 3 (2016), s. 215-221. ISSN 0009-2770 R&D Projects: GA ČR GBP206/12/G151 Institutional support: RVO:61388955 ; RVO:68081707 Keywords : electrochemistry * silver amalgam * senzors Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

  6. Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array

    DEFF Research Database (Denmark)

    Eeles, Rosalind A; Olama, Ali Amin Al; Benlloch, Sara;

    2013-01-01

    Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...

  7. Úvod do statistiky

    Czech Academy of Sciences Publication Activity Database

    Hurt, K.; Zvárová, Jana

    Praha: Galén, 2004 - (Halaška, M.), s. 183-186 ISBN 80-7262-272-2 Source of funding: V - iné verejné zdroje Keywords : urogynekologie * statistika * epidemiologie Subject RIV: BB - Applied Statistics, Operational Research

  8. Palmyra Atoll Site 9P-B 3/29/2004 18-19M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 18 and 19 meters along a permanent transect.

  9. Palmyra Atoll Site 9P-B 3/29/2004 26-27M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 26 and 27 meters along a permanent transect.

  10. Palmyra Atoll Site 9P-B 3/29/2004 30-31M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 30 and 31 meters along a permanent transect.

  11. Palmyra Atoll Site 9P-B 3/29/2004 29-30M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 29 and 30 meters along a permanent transect.

  12. Palmyra Atoll Site 9P-B 3/29/2004 25-26M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 25 and 26 meters along a permanent transect.

  13. Palmyra Atoll Site 9P-B 3/29/2004 48-49M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 48 and 49 meters along a permanent transect.

  14. Palmyra Atoll Site 9P-B 3/29/2004 13-14M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 13 and 14 meters along a permanent transect.

  15. Palmyra Atoll Site 9P-B 3/29/2004 0-1M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 0 and 1 meters along a permanent transect.

  16. Palmyra Atoll Site 9P-B 3/29/2004 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 10 and 11 meters along a permanent transect.

  17. Palmyra Atoll Site 9P-B 3/29/2004 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 8 and 9 meters along a permanent transect.

  18. Palmyra Atoll Site 9P-B 3/29/2004 9-10M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 9 and 10 meters along a permanent transect.

  19. Palmyra Atoll Site 9P-B 3/29/2004 49-50M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 49 and 50 meters along a permanent transect.

  20. Palmyra Atoll Site 9P-B 3/29/2004 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 2 and 3 meters along a permanent transect.

  1. Palmyra Atoll Site 9P-B 3/29/2004 5-6M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 5 and 6 meters along a permanent transect.

  2. Palmyra Atoll Site 9P-B 3/29/2004 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 1 and 2 meters along a permanent transect.

  3. Palmyra Atoll Site 9P-B 3/29/2004 40-41M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 40 and 41 meters along a permanent transect.

  4. Palmyra Atoll Site 9P-B 3/29/2004 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 4 and 5 meters along a permanent transect.

  5. Palmyra Atoll Site 9P-B 3/29/2004 45-46M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 45 and 46 meters along a permanent transect.

  6. Palmyra Atoll Site 9P-B 3/29/2004 28-29M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 28 and 29 meters along a permanent transect.

  7. Palmyra Atoll Site 9P-B 3/29/2004 19-20M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 19 and 20 meters along a permanent transect.

  8. Palmyra Atoll Site 9P-B 3/29/2004 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 27 and 28 meters along a permanent transect.

  9. Palmyra Atoll Site 9P-B 3/29/2004 31-32M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 31 and 32 meters along a permanent transect.

  10. Palmyra Atoll Site 9P-B 3/29/2004 22-23M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 22 and 23 meters along a permanent transect.

  11. Palmyra Atoll Site 9P-B 3/29/2004 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 47 and 48 meters along a permanent transect.

  12. Palmyra Atoll Site 9P-B 3/29/2004 50-51M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 50 and 51 meters along a permanent transect.

  13. Palmyra Atoll Site 9P-B 3/29/2004 32-33M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 32 and 33 meters along a permanent transect.

  14. Palmyra Atoll Site 9P-B 3/29/2004 24-25M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 24 and 25 meters along a permanent transect.

  15. Palmyra Atoll Site 9P-B 3/29/2004 20-21M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 20 and 21 meters along a permanent transect.

  16. Palmyra Atoll Site 9P-B 3/29/2004 42-43M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 42 and 43 meters along a permanent transect.

  17. Palmyra Atoll Site 9P-B 3/29/2004 39-40M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 39 and 40 meters along a permanent transect.

  18. Palmyra Atoll Site 9P-B 3/29/2004 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 11 and 12 meters along a permanent transect.

  19. Palmyra Atoll Site 9P-B 3/29/2004 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 37 and 38 meters along a permanent transect.

  20. Palmyra Atoll Site 9P-B 3/29/2004 14-15M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 14 and 15 meters along a permanent transect.

  1. Palmyra Atoll Site 9P-B 3/29/2004 15-16M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 15 and 16 meters along a permanent transect.

  2. Palmyra Atoll Site 9P-B 3/29/2004 34-35M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 34 and 35 meters along a permanent transect.

  3. Palmyra Atoll Site 9P-B 3/29/2004 41-42M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 41 and 42 meters along a permanent transect.

  4. Palmyra Atoll Site 9P-B 3/29/2004 35-36M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 35 and 36 meters along a permanent transect.

  5. Palmyra Atoll Site 9P-B 3/29/2004 16-17M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 16 and 17 meters along a permanent transect.

  6. Palmyra Atoll Site 9P-B 3/29/2004 43-44M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 43 and 44 meters along a permanent transect.

  7. Palmyra Atoll Site 9P-B 3/29/2004 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 38 and 39 meters along a permanent transect.

  8. Palmyra Atoll Site 9P-B 3/29/2004 3-4M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 3 and 4 meters along a permanent transect.

  9. Palmyra Atoll Site 9P-B 3/29/2004 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 23 and 24 meters along a permanent transect.

  10. Palmyra Atoll Site 9P-B 3/29/2004 36-37M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 36 and 37 meters along a permanent transect.

  11. Palmyra Atoll Site 9P-B 3/29/2004 17-18M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 17 and 18 meters along a permanent transect.

  12. Palmyra Atoll Site 9P-B 3/29/2004 33-34M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 33 and 34 meters along a permanent transect.

  13. Palmyra Atoll Site 9P-B 3/29/2004 21-22M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 21 and 22 meters along a permanent transect.

  14. Palmyra Atoll Site 9P-B 3/29/2004 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 9P-B (05 52.056N, 162 05.272W), between 7 and 8 meters along a permanent transect.

  15. Metody zápisu nanostruktur rastrovací sondou

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Michal; Krátký, Stanislav; Matějka, Milan; Kolařík, Vladimír; Horáček, Miroslav

    2014-01-01

    Roč. 108, č. 10 (2014), s. 937-941. ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LO1212 Keywords : scanning probe lithography * local anodic oxidation * nanoscratching * atomic force microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.272, year: 2014

  16. 41 CFR 101-27.207-3 - Marking material to show extended shelf life.

    Science.gov (United States)

    2010-07-01

    ... extended shelf life. 101-27.207-3 Section 101-27.207-3 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-3 Marking material to show extended shelf life. When the shelf-life period of Type II material (except for critical end-use items...

  17. 41 CFR 101-27.209 - Utilization and distribution of shelf-life items.

    Science.gov (United States)

    2010-07-01

    ... distribution of shelf-life items. 101-27.209 Section 101-27.209 Public Contracts and Property Management... PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.209 Utilization and distribution of shelf-life items. Where it is determined that specified quantities of both Type I and Type...

  18. Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics

    Science.gov (United States)

    Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.

    2015-01-01

    The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

  19. Brassica greens herbicide screening

    Science.gov (United States)

    The objective of this study was to screen herbicides for potential use in brassica greens. Plots were in a RBD with 4 replications. The study was direct seeded on May 19, 2009 with a seeding rate of 272,000 seeds/acre (‘Savanna’ mustard). Treatments included trifluralin PPI + DCPA pre-emergence ap...

  20. Understanding Oral Reading Fluency among Adults with Low Literacy: Dominance Analysis of Contributing Component Skills

    Science.gov (United States)

    Mellard, Daryl F.; Anthony, Jason L.; Woods, Kari L.

    2012-01-01

    This study extends the literature on the component skills involved in oral reading fluency. Dominance analysis was applied to assess the relative importance of seven reading-related component skills in the prediction of the oral reading fluency of 272 adult literacy learners. The best predictors of oral reading fluency when text difficulty was…

  1. Transformation of lignin and humic acids by extracellular enzymes of saprotrophic basidiomycetes

    Czech Academy of Sciences Publication Activity Database

    Šnajdr, Jaroslav; Steffen, K. T.; Hofrichter, M.; Baldrian, Petr

    Gent : Universiteit Gent, 2009, s. 271-272. ISBN 978-90-813924-1-9. [International Conference on Textile and Polymer Biotechnology /6./. Gent (BE), 23.09.2009-25.09.2009] R&D Projects: GA MŠk OC 155 Institutional research plan: CEZ:AV0Z50200510 Keywords : soil * fungi * enzyme Subject RIV: EE - Microbiology, Virology

  2. Diagnostic utility of candidate definitions for demonstrating axial spondyloarthritis on magnetic resonance imaging of the spine

    DEFF Research Database (Denmark)

    Weber, Ulrich; Zhao, Zheng; Rufibach, Kaspar;

    2015-01-01

    patients with nonspecific back pain. A threshold of ≥6 CILs had moderate to substantial diagnostic utility (positive LR 13.26 and 6.74 in cohorts A and B, respectively) in nonradiographic axial SpA, while ≥4 CILs showed small diagnostic utility (positive LR 3.83 and 2.72 in cohorts A and B, respectively...

  3. Vote Points to Kyrgyzstan's Future

    Institute of Scientific and Technical Information of China (English)

    LIU GUILING

    2010-01-01

    @@ @@ On June 27, a constitutional referendum was held in Kyrgyzstan. The Central Election Commission announced two days later a new Constitution had been approved. Some 2.72 million people were eligible to vote and the turnout was more than 70 percent. Of those who cast ballots, some 90 percent voted for the new Constitution and only 8 percent voted against it.

  4. The Teaching of Leadership on UK MBA Programmes. A Critical Analysis from an International Perspective.

    Science.gov (United States)

    Mellahi, Kamel

    2000-01-01

    A survey of 272 Asian, African, and Arab master of business administration graduates from British business schools showed that schools had an ethnocentric approach to leadership teaching. Possible causes were lack of alternative theories, lack of non-U.S. research, and a low level of faculty expertise and interest in international dimensions of…

  5. 33 CFR 230.5 - Responsible officials.

    Science.gov (United States)

    2010-07-01

    ... policy issues. The Assistant Chief Counsel for Environmental Law and Regulatory Programs, HQUSACE (CECC-E... district commander also provides agency views on other agencies' environmental impact statements (EIS). The Office of Environmental Policy HQUSACE (CECW-RE) WASH DC 20314-1000 (phone number 202-272-0166) is...

  6. Solid State Field-Assisted Diffusion of Copper in Multi-Component Tellurite Glass

    Czech Academy of Sciences Publication Activity Database

    Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.; Chigirinsky, Y.

    2011-01-01

    Roč. 94, č. 7 (2011), 1986-1988. ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Solid state diffusion * Secondary Ion Mass Spectrometry * Tellurite glass Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

  7. Solid-State Field-Assisted Ag Diffusion in Ge-Ga-Sb-S Glasses

    Czech Academy of Sciences Publication Activity Database

    Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.

    2011-01-01

    Roč. 94, č. 6 (2011), s. 1756-1760. ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Ag diffusion * Diffusion method * Diffusion temperature Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

  8. Use of Sindbis virus-mediated RNA interference to demonstrate a conserved role of Broad-Complex in insect metamorphosis

    Czech Academy of Sciences Publication Activity Database

    Uhlířová, Miroslava; Foy, B. D.; Beaty, B. J.; Olson, K. E.; Riddiford, L. M.; Jindra, Marek

    2003-01-01

    Roč. 100, č. 26 (2003), s. 15607-15612. ISSN 0027-8424 R&D Projects: GA AV ČR IAA5007305 Institutional research plan: CEZ:AV0Z5007907 Keywords : Green fluorescent protein-steroid-hormone ecdysone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.272, year: 2003

  9. Nanodiamanty - fluorescenční a zobrazovací nanosondy

    Czech Academy of Sciences Publication Activity Database

    Šlegerová, Jitka; Cígler, Petr

    2014-01-01

    Roč. 108, č. 4 (2014), s. 387-393. ISSN 0009-2770 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027 Institutional support: RVO:61388963 Keywords : nanodiamond * fluorescence * biocompatibility Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  10. Self-Efficacy Beliefs as Shapers of Children's Aspirations and Career Trajectories.

    Science.gov (United States)

    Bandura, Albert; Barbaranelli, Claudio; Caprara, Gian Vittorio; Pastorelli, Concetta

    2001-01-01

    Tested a structural model of the network of sociocognitive influences shaping children's career aspirations and trajectories among 272 early adolescents. Found that subjects' perceived efficacy rather than their actual academic achievement was the key determinant of their perceived occupational self-efficacy and preferred choice of worklife.…

  11. 46 CFR 282.22 - Maintenance (upkeep) and repairs.

    Science.gov (United States)

    2010-10-01

    ... eligible for subsidy under the ODSA and the regulations in 46 CFR part 272, shall be used for determining...) Calculation. The appropriate U.S.-foreign cost differential shall be applied to the subsidizable and audited... OPERATORS OPERATING-DIFFERENTIAL SUBSIDY FOR LINER VESSELS ENGAGED IN ESSENTIAL SERVICES IN THE...

  12. Bjudzhet obrazovanija na novõi god / Mailis Reps

    Index Scriptorium Estoniae

    Reps, Mailis, 1975-

    2006-01-01

    Ülevaade haridus- ja teadusministeeriumi 2007. aasta eelarvest. Kokku on haridus- ja teadustegevusele riigieelarvest eraldatud 8,272 miljardit krooni, mis on 1,45 miljardit krooni rohkem kui 2006. aastal. Tabel: Haridus- ja teadusministeeriumi finantseerimine aastate lõikes

  13. Protective double-layer coatings prepared by plasma enhanced chemical vapor deposition on tool steel

    Czech Academy of Sciences Publication Activity Database

    Muresan, M.; Charvátová Campbell, A.; Ondračka, P.; Buršíková, V.; Peřina, Vratislav; Polcar, T.; Reuter, S.; Hammer, M. U.; Valtr, M.; Zajíčková, L.

    2015-01-01

    Roč. 272, JUN (2015), s. 229-238. ISSN 0257-8972 R&D Projects: GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : PECVD * DLC * amorphous carbon * hardness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.998, year: 2014

  14. Photoluminescence spectroscopy of chromium doped Cd.sub.2./sub.Nb.sub.2./sub.O.sub.7./sub..

    Czech Academy of Sciences Publication Activity Database

    Bryknar, Z.; Trepakov, V.; Potůček, Zdeněk; Jastrabík, Lubomír; Kapphan, S.

    2002-01-01

    Roč. 272, - (2002), s. 363-368. ISSN 0015-0193 R&D Projects: GA ČR GA202/00/1425 Institutional research plan: CEZ:AV0Z1010914 Keywords : cadmium pyroniobate * Cr 3+ * luminescence * phase transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.408, year: 2002

  15. Preaggregation Functions: Construction and an Application

    Czech Academy of Sciences Publication Activity Database

    Lucca, G.; Sanz, J. A.; Dimuro, G. P.; Bedregal, B.; Mesiar, Radko; Kolesárová, A.; Bustince, H.

    2016-01-01

    Roč. 24, č. 2 (2016), s. 260-272. ISSN 1063-6706 Institutional support: RVO:67985556 Keywords : aggregation * Choquet integral * fuzzy measures Subject RIV: BA - General Mathematics Impact factor: 8.746, year: 2014 http://library.utia.cas.cz/separaty/2016/E/mesiar-0458801. pdf

  16. Reasoning about Family Honour among Two Generations of Hindu Indian-Americans

    Science.gov (United States)

    Kay, Adam

    2012-01-01

    To investigate reasoning about family honour, 128 first generation (mean age = 27.2 years) and second generation Hindu Indian-American adults (mean age = 24.7 years) were presented hypothetical scenarios in which male or female protagonists defied common Hindu customs (e.g., arranged marriage, intra-religion marriage and premarital sexual…

  17. Ploidy levels and reproductive patterns of Carassius auratus gibelio as revealed by means of artificial hybridization and flow cytometry

    Czech Academy of Sciences Publication Activity Database

    Flajšhans, M.; Rodina, M.; Halačka, Karel; Vetešník, Lukáš; Papoušek, Ivo; Gela, D.; Lusková, Věra; Lusk, Stanislav

    Elsevier. Roč. 272, Supplement 1 (2007), S256. ISSN 0044-8486. [International Symposium on Genetics in Aquaculture /9./. 26.06.2006-30.06.2006, Montpellier] R&D Projects: GA ČR GA206/05/2159 Institutional research plan: CEZ:AV0Z60930519 Keywords : silver crucian carp Subject RIV: EB - Genetics ; Molecular Biology

  18. VYUŽITÍ ELEKTROCHEMICKÉ IMPEDANČNÍ SPEKTROSKOPIE PRO OBJASNĚNÍ ELEKTROCHEMICKÝCH VLASTNOSTÍ SMĚSÍ LECITINU A CHOLESTEROLU V MODELOVÝCH FOSFOLIPIDOVÝCH MEMBRÁNÁCH

    Czech Academy of Sciences Publication Activity Database

    Nováková, Kateřina; Navrátil, Tomáš; Šestáková, Ivana; Mareček, Vladimír; Chýlková, J.

    2014-01-01

    Roč. 108, č. 3 (2014), s. 219-225. ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP208/12/1645; GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : lecitine * cholesterol * biological membranes Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

  19. Jak může sociologie přispět k pochopení změny klimatu?

    Czech Academy of Sciences Publication Activity Database

    Lyons, Pat

    Praha : Sociologický ústav AV ČR, v. v. i., 2015 - (Lyons, P.; Kindlerová, R.), s. 262-272 ISBN 978-80-7330-280-1 R&D Projects: GA ČR GB14-36154G Institutional support: RVO:68378025 Keywords : climate change * economic activity * Selectorate Theory Subject RIV: AO - Sociology, Demography

  20. 75 FR 23565 - Food Stamp Program: Eligibility and Certification Provisions of the Farm Security and Rural...

    Science.gov (United States)

    2010-05-04

    ... Farm Security and Rural Investment Act of 2002, which was published on January 29, 2010 (75 FR 4912... / Tuesday, May 4, 2010 / Rules and Regulations#0;#0; ] DEPARTMENT OF AGRICULTURE Food and Nutrition Service 7 CFR Parts 272 and 273 RIN 0584-AD30 Food Stamp Program: Eligibility and Certification...

  1. Goal Priming and the Emotional Experience of Students with and without Attention Problems: An Application of the Emotional Stroop Task

    Science.gov (United States)

    Sideridis, Georgios; Vansteenkiste, Maarten; Shiakalli, Maria; Georgiou, Maria; Irakleous, Ioanna; Tsigourla, Ioanna; Fragioudaki, Eirini

    2009-01-01

    The primary purpose of the present study is to evaluate the emotional experience of students with (n = 52) and without attention problems (n = 272) during an achievement task. A secondary purpose of the present study is to compare students' emotional response to various stimuli, when motivated by various achievement goals. Participants were…

  2. The EN171101 bolide - the deepest ever photographed fireball

    Czech Academy of Sciences Publication Activity Database

    Spurný, Pavel; Porubčan, V.

    Noordwijk : ESA Publication Division, 2002 - (Warmbein, B.), s. 269-272 [Asteroids, comets, meteors 2002. Berlin (DE), 29.07.2002-02.08.2002] R&D Projects: GA AV ČR IPP2046110; GA ČR GA205/00/1727 Institutional research plan: CEZ:AV0Z1003909 Keywords : bolide * trajectory * orbit Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  3. 40 CFR 721.10094 - Decene, branched and linear.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Decene, branched and linear. 721.10094... Substances § 721.10094 Decene, branched and linear. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as decene, branched and linear (PMN P-03-272;...

  4. 77 FR 14023 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-08

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272,...

  5. 77 FR 26770 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-05-07

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis....271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272,...

  6. Multi-Quasiparticle Structure and Magnetic Rotation Band in 85Zr

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Nucleus 85Zr, with neutron number 45, lies in the transitional region. This nucleus has been studiedthrough 56Fe(35Cl, αpn) 85Zr reaction by A.Juagclaus et al. A level scheme was established with spin upto 33/2+ and 27/2-, but all spins and parities were assigned tentatively. The present work is interested in

  7. Measuring Student Graduateness: Reliability and Construct Validity of the Graduate Skills and Attributes Scale

    Science.gov (United States)

    Coetzee, Melinde

    2014-01-01

    This study reports the development and validation of the Graduate Skills and Attributes Scale which was initially administered to a random sample of 272 third-year-level and postgraduate-level, distance-learning higher education students. The data were analysed using exploratory factor analysis. In a second study, the scale was administered to a…

  8. The Role of Academic Self-Efficacy as a Mediator Variable between Perceived Academic Climate and Academic Performance

    Science.gov (United States)

    Abd-Elmotaleb, Moustafa; Saha, Sudhir K.

    2013-01-01

    This study examines the mediating influence of academic self-efficacy on the link between perceived academic climate and academic performance among university students. The participants in the study consist of 272 undergraduate students at the University of Assiut, Assiut, Egypt. A scale to measure perceived academic climate, was developed. To…

  9. Adaptive Behavior among Adults with Intellectual Disabilities and Its Relationship to Community Independence

    Science.gov (United States)

    Woolf, Steve; Woolf, Christine Merman; Oakland, Thomas

    2010-01-01

    This study examined relationships between general adaptive behavior and the degree of community independence displayed by 272 adults with intellectual disabilities. Specifically, the Adaptive Behavior Assessment System-Second Edition (ABAS-II; Harrison & Oakland, 2003) was completed for each participant and compared with actual levels of work and…

  10. Solid Waste Management: Abstracts From the Literature - 1964.

    Science.gov (United States)

    Connolly, John A.; Stainback, Sandra E.

    The Solid Waste Disposal Act of 1965 (Public Law 89-272, Title II) and its amending legislation, the Resource Recovery Act of 1970 (Public Law 91-512, Title I), authorize collection, storage, and retrieval of information relevant to all aspects of solid-waste management. As part of this effort, the U.S. Environmental Protection Agency's…

  11. Lesson study - Could it work for you?

    Czech Academy of Sciences Publication Activity Database

    Doing, B.; Groves, S.; Macháčková, Jana

    Praha : Pedagogická fakulta UK, 2009 - (Novotná, J.; Moraová, H.), s. 271-272 ISBN 978-80-7290-398-6. [SEMT'09 - International Symposium, Elementary Maths Teaching. Praha (CZ), 23.08.2009-28.08.2009] Institutional research plan: CEZ:AV0Z10190503 Keywords : lesson study - research lesson * elementary level * mathematics education Subject RIV: AM - Education

  12. Boundary singularity of Poisson and harmonic Bergman kernels

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav

    2015-01-01

    Roč. 429, č. 1 (2015), s. 233-272. ISSN 0022-247X R&D Projects: GA AV ČR IAA100190802 Institutional support: RVO:67985840 Keywords : harmonic Bergman kernel * Poisson kernel * pseudodifferential boundary operators Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022247X15003170

  13. Howland Island Site 5P 1/21/2004 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 00 48.340 N, 176 37.272 W, between 47 and 48 meters along a permanent transect.

  14. De Alto, Bruno Pedro, Autonomía tecnológica: La audacia de la División Electrónica de FATE

    OpenAIRE

    José A. Borello

    2014-01-01

    De Alto, Bruno Pedro, Autonomía tecnológica: La audacia de la División Electrónica de FATE, Buenos Aires, Ediciones CICCUS, Exi2 y UTN-Facultad Regional General Pacheco, 2013 (272 págs.), ISBN 978-987-693-019-2.

  15. De Alto, Bruno Pedro, Autonomía tecnológica: La audacia de la División Electrónica de FATE

    Directory of Open Access Journals (Sweden)

    José A. Borello

    2014-07-01

    Full Text Available De Alto, Bruno Pedro, Autonomía tecnológica: La audacia de la División Electrónica de FATE, Buenos Aires, Ediciones CICCUS, Exi2 y UTN-Facultad Regional General Pacheco, 2013 (272 págs., ISBN 978-987-693-019-2.

  16. A Study of Methods for Estimating Distributions of Test Scores.

    Science.gov (United States)

    Cope, Ronald T.; Kolen, Michael J.

    This study compared five density estimation techniques applied to samples from a population of 272,244 examinees' ACT English Usage and Mathematics Usage raw scores. Unsmoothed frequencies, kernel method, negative hypergeometric, four-parameter beta compound binomial, and Cureton-Tukey methods were applied to 500 replications of random samples of…

  17. mos116_0501n.tif -- Side scan sonar image from survey effort HMPR-116-2005-01n in the Olympic Coast National Marine Sanctuary.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in July 2005 onboard the NOAA vessel Tatoosh. An EG&G 272 side scan system was used...

  18. AcEST: DK951951 [AcEST

    Lifescience Database Archive (English)

    Full Text Available =Populus alba x Populus bolleana PE=2 SV=1 Length = 272 Score = 123 bits (308), E...DYRSIQEYLKDSSAAAASCCSSVATTPATS 174 >tr|B7FET9|B7FET9_9ROSI Dehydration responsive element binding protein OS

  19. Elektrochemická oxidace přírodních barviv používaných na uměleckých památkách

    Czech Academy of Sciences Publication Activity Database

    Ramešová, Šárka; Sokolová, Romana

    2014-01-01

    Roč. 108, č. 5 (2014), s. 507-512. ISSN 0009-2770 Grant ostatní: Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR M200401201 Institutional support: RVO:61388955 Keywords : flavonoids * spectroelectrochemistry * oxidation Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

  20. Sigmund Freud a první aplikace psychoanalýzy na literární dílo

    Czech Academy of Sciences Publication Activity Database

    Švanda, Martin

    2005-01-01

    Roč. 49, č. 3 (2005), s. 272-279. ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

  1. Collective motion in hot superheavy nuclei

    NARCIS (Netherlands)

    Tveter, TS; Gaardhoje, JJ; Maj, A; Ramsoy, T; Atac, A; Bacelar, J; Bracco, A; Buda, A; Camera, F; Herskind, B; Korten, W; Krolas, W; Menthe, A; Million, B; Nifenecker, H; Pignanelli, M; Pinston, JA; vanderPloeg, H; Schussler, F; Sletten, G

    1996-01-01

    The superheavy nucleus (272)(108)Hs and its evaporation daughters have been produced using the reaction Th-232(Ar-40,gamma xn) with beam energies 10.5 and 15.0 MeV/A. The Giant Dipole Resonance gamma-radiation from the hot conglomerate system prior to fission has been isolated using a differential m

  2. HOT SUPERHEAVY NUCLEI SEEN WITH THE GDR GAMMA-DECAY

    NARCIS (Netherlands)

    MAJ, A; TVETER, TS; GAARDHOJE, JJ; HERSKIND, B; SLETTEN, G; RAMSOY, T; ATAC, A; KORTEN, W; BRACCO, A; CAMERA, F; MATTIUZZI, M; MILLION, B; PIGNANELLI, M; BACELAR, J; BUDA, A; PLOEG, HVD; KROLAS, W; NIFENECKER, H; SCHUSSLER, F; PINSTON, JA; MENTHE, A; PAUL, P; HOFMAN, DJ; DIOSZEGI, [No Value; SCHADMAND, S

    1995-01-01

    The GDR gamma decay of highly excited (272)Hs and (269)Ns nuclei and their evaporation daughters was studied in coincidence with fission fragments. A difference technique was used to isolate the pre-fission component. Strong dipole collectivity was observed. The lifetime of the hot superheavy nuclei

  3. Delinquent Behavior and Emerging Substance Use in the MTA at 36 Months: Prevalence, Course, and Treatment Effects

    Science.gov (United States)

    Molina, Brooke S. G.; Flory, Kate; Hinshaw, Stephen P.; Greiner, Andrew R.; Arnold, L. Eugene; Swanson, James M.; Hechtman, Lily; Jensen, Peter S.; Vitiello, Benedetto; Hoza, Betsy; Pelham, William E.; Elliott, Glen R.; Wells, Karen C.; Abikoff, Howard B.; Gibbons, Robert D.; Marcus, Sue; Conners, C. Keith; Epstein, Jeffery N.; Greenhill, Laurence L.; March, John S.; Newcorn, Jeffrey H.; Severe, Joanne B.; Wigal, Timothy

    2007-01-01

    Objective: To compare delinquent behavior and early substance use between the children in the Multimodal Treatment Study of Children With ADHD (MTA; N = 487) and those in a local normative comparison group (n = 272) at 24 and 36 months postrandomization and to test whether these outcomes were predicted by the randomly assigned treatments and…

  4. The role of prosody in a Czech talk-show

    Czech Academy of Sciences Publication Activity Database

    Havlík, Martin

    Amsterdam : Benjamins, 2012 - (Lorda, C.; Zabalbeascoa, P.), s. 143-160 ISBN 978-90-272-1032-6. - (Dialogue Studies. 15) R&D Projects: GA AV ČR KJB900610701; GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : prosody * TV talk-show * conversation analysis Subject RIV: AI - Linguistics

  5. Intertextuality as a means of positioning in a talk-show

    Czech Academy of Sciences Publication Activity Database

    Čmejrková, Světla; Hoffmannová, Jana

    Amsterdam : Benjamins, 2012 - (Lorda, C.; Zabalbeascoa, P.), s. 161-172 ISBN 978-90-272-1032-6. - (Dialogue Studies. 15) R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : positioning * intertextuality * talk-show * reported speech Subject RIV: AI - Linguistics

  6. Chemie fosfonátových analogů nukleotidů a oligonukleotidů - stručná reminiscence a současnost

    Czech Academy of Sciences Publication Activity Database

    Rosenberg, Ivan

    2014-01-01

    Roč. 108, č. 4 (2014), s. 375-386. ISSN 0009-2770 R&D Projects: GA ČR GA13-26526S Institutional support: RVO:61388963 Keywords : oligonucleotides * phosphonates * RNase H * RNase L Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  7. Methods for Determination of Bioaccessibility and Bioavailability of Hydrophobic Organic Pollutants

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Cajthaml, Tomáš

    2015-01-01

    Roč. 109, č. 4 (2015), s. 254-268. ISSN 0009-2770 R&D Projects: GA TA ČR TE01020218; GA ČR GA13-28283S Institutional support: RVO:61388971 Keywords : bioremediation * bioaccumulation * environmental risk assessment Subject RIV: EE - Microbiology, Virology Impact factor: 0.272, year: 2014

  8. Influence of stress on the permeability of coal and sedimentary rocks of the Upper Silesian Basin

    Czech Academy of Sciences Publication Activity Database

    Konečný, Pavel; Kožušníková, Alena

    2011-01-01

    Roč. 48, č. 2 (2011), s. 347-352. ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : permeability * triaxial test * coal and sedimentary rocks Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.272, year: 2011 http://www.sciencedirect.com/science/article/pii/S1365160910002194

  9. Drug: D08689 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08689 Drug Zoledronic acid (INN); Zometa (TN); Reclast (TN) C5H10N2O7P2 271.9963 272.0896 D0868 ... 900(2224) Terpenoid backbone biosynthesis map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  10. Howland Island Site 5P 1/21/2004 17-18M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 00 48.340 N, 176 37.272 W, between 17 and 18 meters along a permanent transect.

  11. Experimental Device for Electron Beam Micromachining

    Czech Academy of Sciences Publication Activity Database

    Dupák, Libor; Zobač, Martin; Dupák, Jan; Vlček, Ivan

    2006-01-01

    Roč. 41, 5-6 (2006), s. 272-275. ISSN 0861-4717. [EBT 2006 - International Conference on Electron Beam Technologies /8./. Varna, 05.06.2006-10.06.2006] Institutional research plan: CEZ:AV0Z20650511 Keywords : electron beam drilling * quartz glass Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  12. Vitamin and mineral intake of twelve adolescent male Kalenjin runners in western Kenya

    DEFF Research Database (Denmark)

    Christensen, Dirk Lund; Jakobsen, Jette; Friis, H

    2005-01-01

    , and niacin all met RSDI by 208%, 107%, and 131%, respectively. Similarly, the intakes of magnesium, iron, and zinc were 272%, 404%, and 122% of RSDI, respectively, while calcium and selenium were below, 47% and 49%, respectively. The daily intakes of phosphorous, copper, and chromium were estimated to...

  13. 45 CFR 1356.60 - Fiscal requirements (title IV-E).

    Science.gov (United States)

    2010-10-01

    ... the child; (iv) Development of the case plan; (v) Case reviews; (vi) Case management and supervision..., FOSTER CARE MAINTENANCE PAYMENTS, ADOPTION ASSISTANCE, AND CHILD AND FAMILY SERVICES REQUIREMENTS.... L. 96-272, the Adoption Assistance and Child Welfare Act of 1980; (ii) Adoption assistance...

  14. 45 CFR 1356.20 - State plan document and submission requirements.

    Science.gov (United States)

    2010-10-01

    ... HUMAN DEVELOPMENT SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON CHILDREN, YOUTH AND FAMILIES, FOSTER CARE MAINTENANCE PAYMENTS, ADOPTION ASSISTANCE, AND CHILD AND FAMILY SERVICES... section 102 of Pub. L. 96-272, the Adoption Assistance and Child Welfare Act of 1980, as it amends...

  15. Time bound changes (in 24 h in human sperm motility and level of calcium and magnesium in seminal plasma

    Directory of Open Access Journals (Sweden)

    J. Valsa

    2016-09-01

    Level of calcium (27.2 mg/dl and magnesium (13.54 mg/dl in seminal plasma did not show any significant changes during study period from that of at ½ h. The study concluded that electrolytes under study were not responsible for the decrease in motility during study period.

  16. Test Procedure - pumping system for caustic addition project

    International Nuclear Information System (INIS)

    This test procedure provides the requirements for sub-system testing and integrated operational testing of the submersible mixer pump and caustic addition equipment by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

  17. Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23

    Czech Academy of Sciences Publication Activity Database

    Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.

    2005-01-01

    Roč. 36, - (2005), s. 272-273. ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005

  18. Bubble Size Distribution and Two-Phase Pressure Drop in Thin-Gap Microchannel.

    Czech Academy of Sciences Publication Activity Database

    Křišťál, Jiří; Havlica, Jaromír; Jiřičný, Vladimír

    - : Norhaven Book , 2007 - (Gani, R.; Dam-Johansen, K.), s. 271-272 ISBN 978-87-91435-56-0. [European Congress of Chemical Engineering ECCE-6. Copenhagen (DK), 16.09.2007-20.09.2007] Institutional research plan: CEZ:AV0Z40720504 Keywords : rectangular microchannel * bubble size distribution * pressure drop Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  19. Fluorované fosfonáty jako činidla pro zavedení fluorovaných funkčních skupin

    Czech Academy of Sciences Publication Activity Database

    Beier, Petr; Opekar, Stanislav

    2014-01-01

    Roč. 108, č. 10 (2014), s. 926-936. ISSN 0009-2770 R&D Projects: GA ČR GP203/08/P310 Institutional support: RVO:61388963 Keywords : phosphonate * fluorine * nucleophilic addition Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  20. 21 CFR 558.265 - Halofuginone hydrobromide.

    Science.gov (United States)

    2010-04-01

    ... lakes, ponds, or streams. (ii) Amount per ton. Halofuginone 2.72 grams (0.0003 percent) plus... arsenic; do not feed to layers; avoid contact with skin, eyes, or clothing; keep out of lakes, ponds, or... layers; avoid contact with skin, eyes, or clothing; keep out of lakes, ponds, or streams. (vii)...

  1. QTL Information Table: 16 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Spl1 Others Others spotted leaf CAPS A)Physical F2,F3 IR24 and CO39 IR36mutant OSJN... G.L., and He, C. (2004). Physical mapping of a rice lesion mimic gene, Spl1 , to a 70-kb segment of rice chromosome 12. Mol Genet Genomics 272, 108-115. ...

  2. Personality and Performance in Intercollegiate Football.

    Science.gov (United States)

    Garland, Daniel J.; Barry, John R.

    The present study, based on Chelladurai and Carron's (1978) multidimensional theory of leadership, sought to determine if selected personality traits and specific leader behaviors are predictive of performance in collegiate football. Prior to regular season competition, collegiate football players (N=272) from three southeastern United States…

  3. Reference: CMSRE1IBSPOA [PLACE

    Lifescience Database Archive (English)

    Full Text Available nsgenic tobacco. Mol Genet Genomics. 272:690-699 (2005) PubMed: 15654621 ... ...is-acting regulatory elements are involved in the sucrose-inducible expression of the sporamin gene promoter from sweet potato in tra...CMSRE1IBSPOA Morikami A, Matsunaga R, Tanaka Y, Suzuki S, Mano S, Nakamura K. Two c

  4. A new species of the Oligocene pomfret fish Paucaichthys (Perciformes; Bramidae) from Iran

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Bannikov, A. F.

    2014-01-01

    Roč. 272, č. 3 (2014), s. 325-330. ISSN 0077-7749 R&D Projects: GA ČR GP13-19250P Institutional support: RVO:67985831 Keywords : Bramidae * Iran * Oligocene * Paucaichthys elamensis sp. nov. * Perciformes * Teleostei Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.519, year: 2014

  5. Females solicit sneakers to improve fertilization success in the bitterling fish (Rhodeus sericeus)

    Czech Academy of Sciences Publication Activity Database

    Smith, C.; Reichard, Martin

    2005-01-01

    Roč. 272, č. 1573 (2005), s. 1683-1688. ISSN 0962-8452 R&D Projects: GA AV ČR(CZ) KJB600930501 Institutional research plan: CEZ:AV0Z60930519 Keywords : extra-pair copulations * bitterling * strategic ejaculation Subject RIV: EG - Zoology Impact factor: 3.510, year: 2005

  6. Výuka chemie pro nechemické obory na vysokých školách

    Czech Academy of Sciences Publication Activity Database

    Jaklová Dytrtová, Jana; Dytrtová, R.; Jakl, M.; Navrátil, Tomáš; Petr, M.; Šteffl, M.

    2014-01-01

    Roč. 108, č. 12 (2014), s. 1172-1178. ISSN 0009-2770 Institutional support: RVO:61388963 ; RVO:61388955 Keywords : teaching methods * study forms * syllabus * attention * efficiency Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

  7. Efektivita přeměn energie - Možnosti dokonalejší přeměny

    Czech Academy of Sciences Publication Activity Database

    Luxa, Martin; Synáč, J.

    2013-01-01

    Roč. 92, č. 5 (2013), s. 272-275. ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics http://www.vesmir.cz/clanek/efektivita-premen-energie

  8. 4D gravity - fluids monitoring in reservoirs

    Czech Academy of Sciences Publication Activity Database

    Mrlina, Jan

    Doha : IPTC, 2009, s. 1-6. ISBN 978-1-55563-272-4. [International Petroleum Technology Conference /4./. Doha (QA), 07.12.2009-09.12.2009] R&D Projects: GA AV ČR IAA300120905 Institutional research plan: CEZ:AV0Z30120515 Keywords : fluids monitoring * hydrocarbon fields * Arabian-type reservoir Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  9. Anorexigenní neuropeptid CART v regulaci příjmu potravy

    Czech Academy of Sciences Publication Activity Database

    Nagelová, Veronika; Železná, Blanka; Maletínská, Lenka

    2014-01-01

    Roč. 108, č. 4 (2014), s. 354-357. ISSN 0009-2770 R&D Projects: GA ČR GAP303/10/1368 Institutional support: RVO:61388963 Keywords : CART * cocaine and amphetamine regulated transcript * anorexigenic neuropeptide Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

  10. Simulation of interaction of circular clusters C7, C12, C13 with nanographene

    International Nuclear Information System (INIS)

    Interaction of circular carbon clusters C7, C12 and C13 with graphene consisting of 272 atoms has been studied by computer simulation based on the Monte Carlo method. The mutual arrangement of the cluster atoms and graphene and their cohesive energy before and after their interaction have been investigated. (author)

  11. Irregular morphology in regular syntactic patterns: A case of constructuional re-alignment

    Czech Academy of Sciences Publication Activity Database

    Fried, Mirjam

    Amsterdam: Benjamins, 2015 - (Barddal, J.; Smirnova, E.; Sommerer, L.; Gildea, S.), s. 139-172 ISBN 978-90-272-0440-0 R&D Projects: GA ČR GAP406/11/2021 Keywords : irregular morphology * construction grammar * constructionalization * constructional mismatch * grammatical change Subject RIV: AI - Linguistics

  12. Strigolaktony - Struktura a funkce v rostlinách

    Czech Academy of Sciences Publication Activity Database

    Dvořáková, Marcela; Vaněk, Tomáš

    2015-01-01

    Roč. 109, č. 10 (2015), s. 762-769. ISSN 0009-2770 R&D Projects: GA MŠk LD14127 Institutional support: RVO:61389030 Keywords : strigolactones * fytohormones * arbuscular mycorrhizal fungi Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2015_10_762-769.pdf

  13. Burn-out, Circumferential Film Flow Distribution and Pressure Drop for an Eccentric Annulus with Heated Rod

    DEFF Research Database (Denmark)

    Andersen, P. S.; Jensen, A.; Mannov, G.;

    1974-01-01

    Measurements of (1) burn-out, (2) circumferential film flow distribution, and (3) pressure drop in a 17 × 27.2 × 3500 mm concentric and eccentric annulus geometry are presented. The eccentric displacement was varied between 0 and 3 mm. The working fluid was water. Burn-out curves at 70 bar...... flow variation on burn-out is discussed....

  14. 34 CFR Appendix C to Part 682 - Procedures for Curing Violations of the Due Diligence in Collection and Timely Filing of Claims...

    Science.gov (United States)

    2010-07-01

    ... loans. Public Law 99-272 established new default periods of 180 and 240 days (as set out in 34 CFR 682... limitations set out in 34 CFR 682.209(a)(7), along with (ii) a collection letter indicating in strong terms... Student Loan Program (FISLP) shall be understood to include the Federal PLUS Program. The...

  15. Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Kopanica, M.; Krista, J.

    2003-01-01

    Roč. 48, č. 2 (2003), s. 265-272. ISSN 0009-2223 Grant ostatní: GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003

  16. RETARDANTY HOŘENÍ, JEJICH POUŽITÍ A VLIV NA ŽIVOTNÍ PROSTŘEDÍ

    Czech Academy of Sciences Publication Activity Database

    Petrová, Šárka; Soudek, Petr; Vaněk, Tomáš

    2015-01-01

    Roč. 109, č. 9 (2015), s. 679-686. ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LD13028 Institutional support: RVO:61389030 Keywords : pollution * bioaccumulation Subject RIV: DJ - Water Pollution ; Quality Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2015_09_679-686.pdf

  17. 41 CFR 101-27.206-2 - Identification and shipping requirements.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Identification and shipping requirements. 101-27.206-2 Section 101-27.206-2 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.206-2 Identification and...

  18. High-resolution magnetic measurements of HTSC

    Czech Academy of Sciences Publication Activity Database

    Janů, Zdeněk; Novák, Miloslav; Tsoi, G.

    272-276, - (2004), e1099-e1101. ISSN 0304-8853 R&D Projects: GA ČR GA102/02/0994; GA AV ČR IAA1010104 Institutional research plan: CEZ:AV0Z1010914 Keywords : superconductivity * low-dimensional systems * resonance scattering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

  19. Plazmochemické leptání křemíku v zařízení Diener nano

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Michal; Krátký, Stanislav; Matějka, Milan; Kolařík, Vladimír; Horáček, Miroslav

    2014-01-01

    Roč. 108, č. 6 (2014), s. 592-595. ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LO1212 Keywords : plasmochemical etching * silicon * etching rate * selectivity Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.272, year: 2014

  20. On the periphery of the Magdalenian World. An open-air site in Klementowice (Lublin Upland, Eastern Poland)

    Czech Academy of Sciences Publication Activity Database

    Wisniewski, T.; Mroczek, P.; Rodzik, J.; Zagórski, P.; Wilczyński, J.; Nývltová Fišáková, Miriam

    2012-01-01

    Roč. 272, č. 2012 (2012), s. 308-321. ISSN 1040-6182 Institutional research plan: CEZ:AV0Z80010507 Keywords : Magdalénien * Seasonality * open-air site Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.962, year: 2012

  1. Sun Exposure and Reduced Risk of Multiple Sclerosis

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2008-09-01

    Full Text Available The association between red hair color (RHC melanocortin 1 receptor genotype, past environmental sun exposure, and risk of multiple sclerosis (MS was investigated in a population-based case-control study in Tasmania, Australia, involving 136 cases with MS and 272 controls.

  2. Mother-Child Attachment Patterns and Different Types of Anxiety Symptoms: Is There Specificity of Relations?

    Science.gov (United States)

    Brumariu, Laura E.; Kerns, Kathryn A.

    2010-01-01

    The purpose of this study was to test Manassis' proposal (Child-parent relations: Attachment and anxiety disorders, 255-272, 2001) that attachment patterns (secure, ambivalent, avoidant, and disorganized) may relate to different types of anxiety symptoms, and that behavioral inhibition may moderate these relations. Using a story stem interview to…

  3. Manipulating the autolytic pathway of a Bacillus protease

    NARCIS (Netherlands)

    VandenBurg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G; HopsuHavu, VK; Jarvinen, M; Kirschke, H

    1997-01-01

    Autolytic degradation of Bacillus subtilis thermolysin-like proteinase (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously, we reported five autolysis sites in B. subtilis neutral protease (Van den Burg et al., 1990, Biochem. J. 272:93-97). I

  4. Palmyra Atoll Site 9P-B 3/29/2004 44-45M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Palmyra Atoll, site 9PB 05 52.056N, 162 05.272W, between 44 and 45 meters along a permanent transect.

  5. Odkaz díla Václava Machka soudobé slavistice

    Czech Academy of Sciences Publication Activity Database

    Janyšková, Ilona; Karlíková, Helena

    2014-01-01

    Roč. 50, č. 4 (2014), s. 63-69. ISSN 0557-272X. [Zilele culturilor slave in Romania. Bucuresti, 02.10.2014-04.10.2014] R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavistics * Slavonic languages * etymology * Václav Machek Subject RIV: AI - Linguistics

  6. Population dynamics of major insect and mite pests and control on sweet pepper grown in net house in Egypt

    Czech Academy of Sciences Publication Activity Database

    El-laithy, A. Y. M.; Elseedy, E. M. A.; El-kholi, M. Y.; Abou-Ellela, M. M.; Svobodová, Zdeňka

    Vol. 93. Darmstad : Federal Research Center for Cultivated Plants, 2013, s. 31-38. ISBN 978-92-9067-272-2. [Proceedings of the Third Working Group Meeting. Český Krumlov (CZ), 13.09.2011-16.09.2011] Institutional support: RVO:60077344 Keywords : sweet pepper * insect and mite pests * net house Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  7. Jsem z tebe celá bez sebe: Lévinas a Proust

    Czech Academy of Sciences Publication Activity Database

    Fulka, Josef

    Praha : UK-FHS, 2006 - (Kružík, J.; Novotný, K.), s. 272-284 ISBN 80-239-8833-6 Institutional research plan: CEZ:AV0Z90090514 Keywords : Lévinas Proust relation * the others Subject RIV: AA - Philosophy ; Religion

  8. Pokroky ve studiu interakce inzulinu s jeho receptorem

    Czech Academy of Sciences Publication Activity Database

    Žáková, Lenka; Jiráček, Jiří

    2014-01-01

    Roč. 108, č. 4 (2014), s. 368-374. ISSN 0009-2770 R&D Projects: GA ČR GPP207/11/P430 Institutional support: RVO:61388963 Keywords : insulin * insulin receptor * crystal structure * NMR structure * complex * diabetes Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

  9. Das Minoriten- und Klarissenkloster in Znaim und seine mittelalterliche Gestalt

    Czech Academy of Sciences Publication Activity Database

    Benešovská, Klára

    Prag: Philosophische Fakultät der Karlsuniversität, 1998 - (Bláhová, M.; Hlaváček, I.), s. 249-272 ISBN 80-85899-42-6. [Böhmisch-österreichische Beziehungen im 13. Jahrhundert. Znojmo (CZ), 26.09.1996-27.09.1996] Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Rodiče, prarodiče, sourozenci

    Czech Academy of Sciences Publication Activity Database

    Dvořáčková-Malá, Dana

    Praha: Gallery, 2010 - (Benešovská, K.), s. 272-300 ISBN 978-80-86990-55-2 Institutional research plan: CEZ:AV0Z80150510 Keywords : Přemyslid * Wenceslas II. * Prague court Subject RIV: AB - History

  11. Howland Island Site 5P 3/17/2000 78-79M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 00 48.340 N, 176 37.272 W, between 78 and 79 meters along a permanent transect.

  12. Howland Island Site 5P 2/7/2001 32-33M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 0 48.340 N, 176 37.272 W, between 32 and 33 meters along a permanent transect.

  13. An evaluation of palaeogeography and palaeoecology in the Most Basin (Czech Republic) and Saxony (Germany) from the late Oligocene to the early Miocene

    Czech Academy of Sciences Publication Activity Database

    Mach, K.; Teodoridis, V.; Matys Grygar, Tomáš; Kvaček, Z.; Suhr, P.; Standke, G.

    2014-01-01

    Roč. 272, č. 1 (2014), s. 13-45. ISSN 0077-7749 R&D Projects: GA ČR(CZ) GAP210/11/1357 Institutional support: RVO:61388980 Keywords : palaeogeography * geochemistry * floras * Most Basin Subject RIV: DD - Geochemistry Impact factor: 0.519, year: 2014

  14. Strouhal - vědec, pedagog a organizátor

    Czech Academy of Sciences Publication Activity Database

    Těšínská, Emilie; Valenta, J.

    Praha : Academia, 2012, s. 229-272 ISBN 978-80-200-2061-1. - (Paměť. 50) Institutional research plan: CEZ:AV0Z80630520 Keywords : Čeněk Strouhal (1850-1922) * biografie * experimentální fyzika Subject RIV: AB - History

  15. Urological Surgeons' Section of Oncology; UK ProtecT (Prostate testing for cancer and Treatment) Study

    DEFF Research Database (Denmark)

    Olumi, Aria F; Nordestgaard, Børge G.

    2014-01-01

    Prostate cancer is the most frequently diagnosed cancer in males in developed countries. To identify common prostate cancer susceptibility alleles, we genotyped 211,155 SNPs on a custom Illumina array (iCOGS) in blood DNA from 25,074 prostate cancer cases and 24,272 controls from the internationa...

  16. Archivace sociálněvědních dat: principy, technologie, standardy

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich; Vávra, Martin; Čížek, Tomáš

    2011-01-01

    Roč. 61, č. 3 (2011), s. 245-272. ISSN 0004-0398 R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : archiving social science data * data management * Nesstar software Subject RIV: AO - Sociology, Demography

  17. Examining Participation of University Students in Recreational Entertainment Marketing Activities

    Science.gov (United States)

    Pala, Adem

    2016-01-01

    The aim of this study was to examine participation of university students in recreational entertainment marketing activities. The survey population consisted of university student in Marmara University Province of Istanbul. The sample constituted a total of 272 students (150 male and 122 female), determined by circumstantial method. The survey…

  18. Dispersal in Mastomys natalensis mice

    DEFF Research Database (Denmark)

    Van Hooft, Pim; Cosson, J F; Vibe-Petersen, Solveig;

    2008-01-01

    Mastomys natalensis is the major pest rodent in sub-Saharan Africa. In this study, population genetic techniques were used to gain new insights into its dispersal behaviour, a critical parameter in pest management. Using 11 microsatellites, 272 individuals from a 300 ha area in Tanzania were geno...

  19. Gang Membership, School Violence, and the Mediating Effects of Risk and Protective Behaviors in California High Schools

    Science.gov (United States)

    Estrada, Joey Nuñez, Jr.; Gilreath, Tamika D.; Astor, Ron Avi; Benbenishty, Rami

    2014-01-01

    There is insufficient empirical evidence exploring associations between gang membership and school violence behaviors. Using a sample of 272,863 high school students, this study employs a structural equation model to examine how school risk and protective behaviors and attitudes mediate effects of gang members' involvement with school…

  20. The Estimation of the Joint Angles of Upper Limb During Walking Using Fuzzy Logic Systems and Relation Maps

    Czech Academy of Sciences Publication Activity Database

    Škoda, D.; Kutílek, P.; Socha, V.; Schlenker, J.; Štefek, A.; Kalina, Jan

    Budapest: IEEE Hungary Section, 2015, s. 267-272. ISBN 978-1-4799-8220-2. [SAMI 2015. International Symposium on Applied Machine Intelligence and Informatics /13./. Herl'any (SK), 22.01.2015-24.01.2015] Institutional support: RVO:67985807 Keywords : fuzzy logic * upper extremities * human gait * rhythmical movement * joint ahgles * relation maps Subject RIV: FI - Traumatology, Orthopedics

  1. Molecular mobility of poly(vinylidene fluoride) in the anisotropic state

    Czech Academy of Sciences Publication Activity Database

    Dmitriev, I.; Gladchenko, S. V.; Afanasyeva, N. V.; Lavrentyev, V. K.; Bukošek, V.; Baldrian, Josef; Elyashevich, G. K.

    2008-01-01

    Roč. 50, č. 3 (2008), s. 265-272. ISSN 0965-545X Institutional research plan: CEZ:AV0Z40500505 Keywords : poly(vinylidene fluoride) * orientation * molecular mobility Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.543, year: 2008

  2. 75 FR 54093 - New England Fishery Management Council; Public Meeting

    Science.gov (United States)

    2010-09-03

    ...; fax: (401) 272-1416. Council address: New England Fishery Management Council, 50 Water Street, Mill 2... National Oceanic and Atmospheric Administration RIN: 0648-XY76 New England Fishery Management Council... Council (Council) is scheduling a public meeting of its Scallop Committee, in September, 2010, to...

  3. 76 FR 62389 - Request for Comments and Notice of Public Hearings on the Study of International Patent...

    Science.gov (United States)

    2011-10-07

    ... submitted by postal mail addressed to: Saurabh Vishnubhakat, Attorney Advisor, Office of Chief Economist... Economist, located in the Madison West Building, Tenth Floor, 600 Dulany Street, Alexandria, Virginia 22314... Vishnubhakat, Office of Chief Economist, by telephone 571-272-3427; by e-mail at...

  4. Relationships between Culture and Health Status: A Multi-Site Study of the Older Chinese in Canada

    Science.gov (United States)

    Lai, Daniel W. L.; Tsang, Ka Tat; Chappell, Neena; Lai, David C. Y.; Chau, Shirley B. Y.

    2007-01-01

    This study examined the relationships between culture and the health status of older Chinese in Canada. Data were collected through face-to-face interviews with a cross-sectional, randomly selected sample of 2,272 older Chinese between 55 and 101 years of age in seven Canadian cities. Health status was assessed by the number of chronic illnesses,…

  5. Plasma-enabled sensing of urea and related amides on polyaniline

    Czech Academy of Sciences Publication Activity Database

    Puliyalil, H.; Slobodian, P.; Sedlacik, M.; Benlikaya, R.; Říha, Pavel; Ostrikov, K.; Cvelbar, U.

    2016-01-01

    Roč. 10, č. 2 (2016), s. 265-272. ISSN 2095-0179 Grant ostatní: Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504 Institutional support: RVO:67985874 Keywords : gas sensing * urea * PANI * amides * plasma Subject RIV: BK - Fluid Dynamics

  6. Howland Island Site 5P 3/17/2000 60-61M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 00 48.340 N, 176 37.272 W, between 60 and 61 meters along a permanent transect.

  7. Review of Raffaele Simone and Francesca Masini: Word classes: Nature, typology and representations

    DEFF Research Database (Denmark)

    Shibuya, Yoshikata; Jensen, Kim Ebensgaard

    2016-01-01

    Review of Raffaele Simone and Francesca Masini (eds.). Word classes: Nature, typology and representations. Current Issues in Linguistic Theory [CILT] 332. Amsterdam/ Philadelphia: John Benjamins Publishing Company, 2014, 293 + vii pp., ISBN: 1978-90-272-4851-0. Hardback and E-book 99.00 EUR / 149.......00 USD....

  8. Laboratoř experimentální analýzy napětí (LEAN) V ÚT AV ČR - její současný stav, možnosti i perspektivy

    Czech Academy of Sciences Publication Activity Database

    Trnka, Jan

    Praha : Ústav termomechaniky AV ČR, 2003 - (Dobiáš, I.), s. 267-272 ISBN 80-85918-81-1. [Colloquium dynamics of machines. Praha (CZ), 09.02.1999-10.02.1999] Institutional research plan: CEZ:AV0Z2076919 Keywords : dynamic photoelasticity * highspeed cinematography * optical topography Subject RIV: BH - Optics, Masers, Lasers

  9. Self-Oriented Perfectionism and Self-Assessment as Predictors of Adolescents? Subjective Well-Being

    Science.gov (United States)

    Çelik, Eyüp

    2014-01-01

    The aim of the present study is to examine whether subjective well-being is predicted by self-oriented perfectionism and self-assessment. The self-oriented perfectionism scale, self-assessment scale and subjective well-being scale (SWB) were administrated to a sample of voluntary 272 eight-grade students from three secondary schools in Sultangazi,…

  10. Automatic identification of microcracks observed on microscopic images of coarse-grained sandstone

    Czech Academy of Sciences Publication Activity Database

    Obara, B.; Kožušníková, Alena; Ščučka, Jiří

    2011-01-01

    Roč. 48, č. 4 (2011), s. 681-686. ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : image analysis * microcracks * optical fluorescence microscopy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.272, year: 2011 http://www. science direct.com/ science /article/pii/S136516091100030X

  11. Particle velocity generated by rockburst during exploitation of the longwall and its impact on the workings

    Czech Academy of Sciences Publication Activity Database

    Holub, Karel; Rušajová, Jana; Holečko, J.

    2011-01-01

    Roč. 48, č. 6 (2011), s. 942-949. ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : Ostrava-Karviná Coal Basin * rockburst * particle velocity * working damage Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.272, year: 2011 http://www. science direct.com/ science /article/pii/S1365160911000876

  12. Physicochemical properties and amylopectin chain profiles of cowpea, chickpea and yellow pea starches

    NARCIS (Netherlands)

    Huang, J.; Schols, H.A.; Soest, van J.J.G.; Jin, Z.; Sulmann, E.; Voragen, A.G.J.

    2007-01-01

    Starches from cowpea and chickpea seeds were isolated and their properties were compared with those of commercial yellow pea starch. Amylose contents were 25.8%, 27.2%, and 31.2%, and the volume mean diameter of granules, determined in the dry state, were 15.5, 17.9, and 33.8 ¿m for cowpea, chickpea

  13. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

    Czech Academy of Sciences Publication Activity Database

    Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta

    2004-01-01

    Roč. 69, č. 4 (2004), s. 267-272. ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak-point pressure Subject RIV: FK - Gynaecology, Childbirth

  14. Howland Island Site 5P 1/21/2004 6-7M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Howland Island, site 5P (00 48.340 N, 176 37.272 W), between 6 and 7 meters along a permanent transect.

  15. Howland Island Site 5P 1/21/2004 40-41M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Howland Island, site 5P (00 48.340 N, 176 37.272 W), between 40 and 41 meters along a permanent transect.

  16. Howland Island Site 5P 1/21/2004 43-44M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Howland Island, site 5P (00 48.340 N, 176 37.272 W), between 43 and 44 meters along a permanent transect.

  17. Howland Island Site 5P 1/21/2004 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Howland Island, site 5P (00 48.340 N, 176 37.272 W), between 7 and 8 meters along a permanent transect.

  18. Howland Island Site 5P 1/21/2004 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Howland Island, site 5P 00 48.340 N, 176 37.272 W, between 11 and 12 meters along a permanent transect.

  19. 75 FR 69126 - Proposed Information Collection Request (ICR) for the Workforce Investment Act Random Assignment...

    Science.gov (United States)

    2010-11-10

    ... vary by population subgroup? Is there variation by sex, age, race/ethnicity, unemployment insurance (UI.... OMB Number: Affected Public: WIA Customers and Staff at 30 One-Stop Career Centers Cite/Reference/Form... 13 minutes..... 14,733 106,817 ] Staff 270 Once 13 minutes per 14,733 272,567 customer, with...

  20. Syntetické modely metaloenzymů katalyzující štěpení fosfodiesterové vazby

    Czech Academy of Sciences Publication Activity Database

    Bím, Daniel; Rulíšek, Lubomír; Hodačová, J.

    2015-01-01

    Roč. 109, č. 9 (2015), s. 658-665. ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : synthetic models of phosphodiesterases * metalloenzymes * phosphate ester bond cleavage Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

  1. Prospective First-Generation College Students: A Social-Cognitive Perspective

    Science.gov (United States)

    Gibbons, Melinda M.; Borders, L. DiAnne

    2010-01-01

    The authors investigated differences in college-going expectations of middle school students who would be the 1st in their families to attend college. Social-cognitive career theory (SCCT; R. W. Lent, S. D. Brown, & G. Hackett, 1994) was used to examine college-related expectations in 272 seventh-grade students. Differences were found between…

  2. Subsidiary divestiture and acquisition in a financial crisis: operational focus, financial constraints, and ownership

    Czech Academy of Sciences Publication Activity Database

    Zhou, Y. M.; Li, X.; Švejnar, Jan

    2011-01-01

    Roč. 17, č. 2 (2011), s. 272-287. ISSN 0929-1199 R&D Projects: GA ČR GAP402/10/2130; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : divestiture * corporate restructuring * financial constraints Subject RIV: AH - Economics Impact factor: 1.447, year: 2011

  3. 76 FR 34203 - Foreign-Trade Subzone 78A Application for Expansion of Manufacturing Authority Nissan North...

    Science.gov (United States)

    2011-06-13

    ... pickup trucks at the NNA plant located at 983 Nissan Drive in Smyrna, Tennessee (Board Order 190, 47 FR... minivans, engines, and transmissions in 1984 (Board Order 272, 49 FR 35395, 9-7-1984). In 1993, the subzone... overall production capacity at the plant (Board Order 632, 58 FR 18850, 3-30-1993). The subzone...

  4. Katepsinové proteasy v patologii

    Czech Academy of Sciences Publication Activity Database

    Horn, Martin; Jílková, Adéla; Mareš, Michael

    2014-01-01

    Roč. 108, č. 4 (2014), s. 358-363. ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP302/11/1481 Institutional support: RVO:61388963 Keywords : cathepsins * proteases * proteolysis Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

  5. PŘÍRODNÍ LÁTKY KYSELÉ CHUTI

    Czech Academy of Sciences Publication Activity Database

    Lapčík, O.; Wimmer, Zdeněk; Opletal, L.; Moravcová, J.; Čopíková, J.; Drašar, P.

    2015-01-01

    Roč. 109, č. 7 (2015), s. 488-491. ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : natural compound * sour taste/ perception * food supplement Subject RIV: GM - Food Processing Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2015_07_488-491.pdf

  6. Brief Report: Symptom Onset Patterns and Functional Outcomes in Young Children with Autism Spectrum Disorders

    Science.gov (United States)

    Shumway, Stacy; Thurm, Audrey; Swedo, Susan E.; Deprey, Lesley; Barnett, Lou Ann; Amaral, David G.; Rogers, Sally J.; Ozonoff, Sally

    2011-01-01

    This study examined the relationship between onset status and current functioning using a recently proposed onset classification system in 272 young children with autism spectrum disorder (ASD). Participants were classified into one of the following groups, based on parent report using the Autism Diagnostic Interview-Revised: Early Onset (symptoms…

  7. The Role of Family Functioning in Bipolar Disorder in Families

    Science.gov (United States)

    Du Rocher Schudlich, Tina D.; Youngstrom, Eric A.; Calabrese, Joseph R.; Findling, Robert L.

    2008-01-01

    Investigated the association between family functioning and conflict and their links with mood disorder in parents and with children's risk for bipolar disorder. Participants were 272 families with a child between the ages of 5-17 years. Parents' history of psychiatric diagnoses and children's current diagnoses were obtained via semi-structured…

  8. Introduction. From instances of change to explanations of change

    Czech Academy of Sciences Publication Activity Database

    Fried, Mirjam

    Amsterdam: Benjamins, 2010 - (Fried, M.; Östman, J.; Verschueren, J.), s. 1-16 ISBN 978-90-272-0783-8 Institutional research plan: CEZ:AV0Z90610518 Keywords : change * diachrony * grammar * historical linguistics Subject RIV: AI - Linguistics

  9. Sociolinguistic Bibliography of European Countries for 2008: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr

    2010-01-01

    Roč. 24, č. 1 (2010), s. 267-272. ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistic s * bibliography * Czech Republic Subject RIV: AI - Linguistics

  10. Thomas Hacker: Portfolio: Ein Entwicklungsinstrument für selbstbestimmtes Lernen. Schneider Verlag Hohengehren, 2006. [...] [Sammelrezension

    OpenAIRE

    Sacher, Werner

    2007-01-01

    Sammelrezension von: 1. Thomas Hacker: Portfolio: Ein Entwicklungsinstrument für selbstbestimmtes Lernen. Schneider Verlag Hohengehren, 2006 (333 Seiten). 2. Ilse Brunner, Thomas Hacker & Thomas Winter (Hrsg.): Das Handbuch Portfolioarbeit. Schneider Verlag Hohengehren, Baldmannsweiler. Kallmeyer Verlag, Seelze-Velber (272 Seiten)

  11. NtGNL1a ARF-GEF acts in endocytosis in tobacco cells

    Czech Academy of Sciences Publication Activity Database

    Jelínková, Adriana; Müller, Karel; Pařezová, Markéta; Petrášek, Jan

    2015-01-01

    Roč. 15, NOV 5 (2015), s. 272. ISSN 1471-2229 R&D Projects: GA ČR GPP305/11/P797 Institutional support: RVO:61389030 Keywords : Endocytosis * PIN1 protein trafficking * Inhibitors of endomembrane trafficking Subject RIV: EA - Cell Biology Impact factor: 3.813, year: 2014

  12. Radikálová syntéza nukleových bází z formamidu v impaktním plazmatu

    Czech Academy of Sciences Publication Activity Database

    Ferus, Martin; Knížek, Antonín; Šponer, Jiří; Šponer, Judit E.; Civiš, Svatopluk

    2015-01-01

    Roč. 109, č. 6 (2015), s. 406-414. ISSN 0009-2770 Institutional support: RVO:61388955 ; RVO:68081707 Keywords : Formamide * Laser-induced dielectric breakdown * Nucleobases Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

  13. Příkop středověkého opevnění města Plzně. Archeologický a environmentální výzkum v prostoru zaniklé Pražské brány

    Czech Academy of Sciences Publication Activity Database

    Široký, R.; Kočár, P.; Hlaváč, Jaroslav; Kaštovská, K.; Kostrouch, F.; Kyncl, J.; Militký, J.; Pokorný, Petr; Postránecká, K.; Schneiderwinklová, P.

    2008-01-01

    Roč. 5, - (2008), s. 272-311. ISSN 1803-1749. [Forum urbes medii aevi /5./. Hainburg, 08.05.2006-11.05.2006] Institutional research plan: CEZ:AV0Z80020508; CEZ:AV0Z30130516 Keywords : archaeobotany * bioarchaeology * urban deposits Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Assessing the Psychological Changes of Gifted Students Attending a Residential High School with an Outcome Measurement

    Science.gov (United States)

    Rollins, Marlon R.; Cross, Tracy L.

    2014-01-01

    This study examined the psychological changes that 272 students experienced while attending a residential school for gifted adolescents in the Midwest. This article shares the quantitative portion of a mixed-methods study. Outcome measurement data from the Youth Outcome Questionnaire Self-Report 2.0 (YOQ-SR) tracked students' level of…

  15. PŘÍRODNÍ LÁTKY SVÍRAVÉ A TRPKÉ CHUTI

    Czech Academy of Sciences Publication Activity Database

    Čopíková, J.; Wimmer, Zdeněk; Lapčík, O.; Cahlíková, L.; Opletal, L.; Moravcová, J.; Drašar, P.

    2014-01-01

    Roč. 108, č. 11 (2014), s. 1053-1057. ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : OBJECTIVE EVALUATION * PHENOLIC- COMPOUNDS * TASTE INTENSITIES Subject RIV: GM - Food Processing Impact factor: 0.272, year: 2014 http://www.chemicke-listy.cz/docs/full/2014_11_1053-1057.pdf

  16. Children's and Adolescents' Developing Perceptions of Gender Inequality

    Science.gov (United States)

    Neff, Kristin D.; Cooper, Carey E.; Woodruff, Althea L.

    2007-01-01

    Two studies examined children's and adolescents' developing perceptions of gender inequality. The first study examined perceptions of inequality among 272 early, middle, and late adolescents, focusing on the spheres of politics, business, and the home. Results indicated an age-related increase in perceptions of male dominance. Men were seen to…

  17. College Endowments Up 26.9 Percent in 1985-86, Buoyed by Strong Performance of Stock Market.

    Science.gov (United States)

    Desruisseaux, Paul

    1987-01-01

    A national study of 272 funds that gathered information on investments' market gains as well as interest and dividend income shows last year's increase in the value of the average endowment was the second-highest 1-year return recorded in the last 12 years. (MSE)

  18. 75 FR 61148 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2010-10-04

    ... Sterilization, Paper Carrier 14-272 USP 32:2009 Biological Indicator for Contact person Ethylene Oxide... oxide with newer version sterilizers and ethylene oxide sterilant sources intended for use in health... requirements. In a notice published in the Federal Register of February 25, 1998 (63 FR 9561), FDA...

  19. Integrase of Mason-Pfizer monkey virus

    Czech Academy of Sciences Publication Activity Database

    Snášel, Jan; Krejčík, Zdeněk; Jenčová, Věra; Rosenberg, Ivan; Ruml, Tomáš; Alexandratos, J.; Gustchina, A.; Pichová, Iva

    2005-01-01

    Roč. 272, č. 1 (2005), s. 203-216. ISSN 1742-464X R&D Projects: GA AV ČR(CZ) IAA4055304 Institutional research plan: CEZ:AV0Z4055905 Keywords : integrase * Mason-Pfizer monkey virus * HIV-1 Subject RIV: CE - Biochemistry

  20. Dicty_cDB: Contig-U05606-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available odium falciparum 3D7 chromosome 13. 34 8.3 17 ( FG295791 ) 1108770741540 New World Screwworm Larvae 9387 EST...... 42 8.3 2 ( FG293345 ) 1108770669958 New World Screwworm Larvae 9387 EST... 42 8.3 2 ( GO218251 ) CAGB272