
Sample records for bohrium 272

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: ...

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU


    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 40 CFR 272.2000-272.2049 - [Reserved (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false 272.2000-272.2049 Section 272.2000-272.2049 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS Rhode Island §§ 272.2000-272.2049 ...

  4. 12 CFR 272.1 - Authority. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 272.1 Section 272.1 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE § 272.1 Authority. This part is issued by the Federal Open Market Committee (the Committee) pursuant to the...

  5. 40 CFR 35.272 - Funding coordination. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Funding coordination. 35.272 Section 35.272 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE....272 Funding coordination. Recipients must use the lead-based paint program funding in a way that...

  6. 43 CFR 27.2 - Application. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 27.2 Section 27.2 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN ACTIVITIES CONDUCTED UNDER... II OF PUBLIC LAW 93-153 § 27.2 Application. This part applies to all activities, including...

  7. 36 CFR 272.4 - Commercial use. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial use. 272.4 Section... OWLâ SYMBOL § 272.4 Commercial use. (a) General. The Chief may authorize the Commercial manufacture... charge, royalty charge, or payment in kind which is reasonably related to the commercial value has been...

  8. 27 CFR 26.272 - General requirements. (United States)


    ... § 26.272 General requirements. Except as provided in § 26.273, every person, other than a tourist... under this part with respect of liquors while in customs custody. (Approved by the Office of Management...

  9. 46 CFR 272.3 - Definitions. (United States)


    ... General § 272.3 Definitions. For the purposes of this part: (a) Act means the Merchant Marine Act, 1936... pursuant to section 809 of the Act. (n) Spare parts means such items as spare propellers and tailshafts and...

  10. 32 CFR 272.1 - Purpose (United States)


    ... AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.1 Purpose This part implements the: (a) Policy on the support of scientific research in Executive Order 10521, “Administration of...

  11. 28 CFR 2.72 - Hearing procedure. (United States)


    ..., YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Code: Prisoners and Parolees § 2.72... victim of a crime, or a representative of the immediate family of a victim if the victim has died, shall have the right: (1) To be present at the parole hearings of each offender who committed the crime, and...

  12. 32 CFR 272.4 - Policy. (United States)


    ... AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.4 Policy. It is DoD policy that: (a... DoD Component laboratories; and (2) Support high quality basic research done by institutions of... industrial research laboratories. (c) The DoD Components' conduct and support of basic research shall be...

  13. 32 CFR 272.5 - Responsibilities. (United States)


    ... ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.5 Responsibilities. (a) The... purpose. (b) The Directors of the Defense Agencies supporting basic research and the Secretaries of the... DoD basic research. (2) Recommend approval, modification, or disapproval of the DoD Components' basic...

  14. 27 CFR 25.272 - Application. (United States)


    ... OF THE TREASURY LIQUORS BEER Pilot Brewing Plants § 25.272 Application. (a) Form of application. Any person desiring to establish a pilot brewing plant under the subpart shall file an application with the... operation of a pilot brewing plant if it is determined that the plant will be operated solely for one or...

  15. 46 CFR 272.23 - Examples of ineligible expenses. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Examples of ineligible expenses. 272.23 Section 272.23... REPAIR SUBSIDY Eligibility Criteria for M&R Subsidy; Substantiation of M&R Expenses § 272.23 Examples of... following examples: (a) Specialized improvements. Any expenditure or Improvement required to alter, outfit...

  16. 4 CFR 27.2 - The Chair, Vice Chair. (United States)


    ... 4 Accounts 1 2010-01-01 2010-01-01 false The Chair, Vice Chair. 27.2 Section 27.2 Accounts...; ORGANIZATION § 27.2 The Chair, Vice Chair. The members of the Board shall select from among its membership a Chairperson, hereinafter the Chair, who shall serve as the chief executive and administrative officer of the...

  17. 32 CFR 272.3 - Definition of basic research. (United States)


    ...) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.3 Definition of basic research. Basic research is systematic study directed toward greater knowledge or understanding of... 32 National Defense 2 2010-07-01 2010-07-01 false Definition of basic research. 272.3 Section 272...

  18. 7 CFR 272.9 - Approval of homeless meal providers. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Approval of homeless meal providers. 272.9 Section 272... AGENCIES § 272.9 Approval of homeless meal providers. The State food stamp agency, or another appropriate... does in fact serve meals to homeless persons. Where the State food stamp agency identifies another...

  19. 40 CFR 52.272 - Research operations exemptions. (United States)


    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Research operations exemptions. 52.272 Section 52.272 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.272 Research operations...

  20. 27 CFR 46.272 - Issuance of summons. (United States)


    ... liability for floor stocks tax; (b) Any person liable for the floor stocks tax or having possession of books of account or other data; and (c) Any other appropriate person in connection with the books or tax....272 Section 46.272 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU...

  1. Protein expression of Myt272-3 recombinant clone and in silico ...

    African Journals Online (AJOL)

    Purpose: To investigate the expression of Myt272-3 recombinant protein and also to predict a possible protein vaccine candidate against Mycobacterium tuberculosis. Methods: Myt272-3 protein was expressed in pET30a+-Myt272-3 clone. The purity of the protein was determined using Dynabeads® His-Tag Isolation ...

  2. Phenotype-gene: 272 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 272 delayed whole ...plant flowering stage for AT3G48430 Noh Bosl et al. 2004 Oct. Plant Cell 16(10):2601-13. delayed whole plant flowering stage AT3G48430

  3. NixWO2.72 nanorods as an efficient electrocatalyst for oxygen evolution reaction


    Zheng Xi; Adriana Mendoza-Garcia; Huiyuan Zhu; MiaoFang Chi; Dong Su; Daniel P. Erdosy; Junrui Li; Shouheng Sun


    NixWO2.72 nanorods (NRs) are synthesized by a one-pot reaction of Ni(acac)2 and WCl4. In the rod structure, Ni(II) intercalates in the defective perovskite-type WO2.72 and is stabilized. The NixWO2.72 NRs show the x-dependent electrocatalysis for the oxygen evolution reaction (OER) in 0.1 M KOH with Ni0.78WO2.72 being the most efficient, even outperforming the commercial Ir-catalyst. The synthesis is not limited to NixWO2.72 but can be extended to MxWO2.72 (M = Co, Fe) as well, providing a ne...

  4. Incidence of Canine Hip Dysplasia : A Survey of 272 Cases

    Directory of Open Access Journals (Sweden)

    G. D. Rao


    Full Text Available A total of 272 cases of hip dysplasia were reviewed. A review of clinical cases presented with the clinical signs of hip dysplasia were referred to Radiology Unit of Madras Veterinary College, from May 2007-April 2009 was taken for this study.The incidence was highest in young animals of age group over three months to one year (52.94 percent. The breed-wise incidence was more common in Labrador Retriever (36.76 percent. Male dogs were found to be more affected (59.55 percent than female dogs. Bilateral hip dysplasia was found to be more (88.60 percent than unilateral. Among the unilateral hip dysplasia, left side was found to be more (54.83 percent than right. [Vet. World 2010; 3(5.000: 219-220

  5. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    The periodic table of elements, the basic and most important component of research in chemistry and physics is growing continu- ously. It is interesting to note that until the. 16th century, only a handful of elements have been known to mankind (10, to be pre- cise) and during the 18th century, 10 more elements have been ...

  6. 26 CFR 1.272-1 - Expenditures relating to disposal of coal or domestic iron ore. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Expenditures relating to disposal of coal or... TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.272-1 Expenditures relating to disposal of coal or domestic iron ore. (a) Introduction. Section 272 provides special treatment...

  7. 37 CFR 2.72 - Amendments to description or drawing of the mark. (United States)


    ... drawing of the mark. 2.72 Section 2.72 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND....72 Amendments to description or drawing of the mark. (a) In an application based on use in commerce under section 1(a) of the Act, the applicant may amend the description or drawing of the mark only if...

  8. 32 CFR Appendix A to Part 272 - Principles for the Conduct and Support of Basic Research (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Principles for the Conduct and Support of Basic... SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE Pt. 272, App. A Appendix A to Part 272—Principles for the Conduct and Support of Basic...

  9. Dendritic cell activation and maturation induced by recombinant calreticulin fragment 39-272. (United States)

    Li, Yue; Zeng, Xiaoli; He, Lijuan; Yuan, Hui


    Dendritic cells (DC) are the most potent antigen-presenting cells for initiating immune responses. DC maturation can be induced by exposing of immature DC to pathogen products or pro-inflammatory factor, which dramatically enhances the ability of DC to activate Ag-specific T cells. In this study, a recombinant calreticulin fragment 39-272 (rCRT/39-272) covering the lectin-like N domain and partial P domain of murine CRT has been expressed and purified in Escherichia coli. Functional analysis studies revealed that rCRT/39-272 has potent immunostimulatory activities in both activating human monocytes and B cells to secrete cytokines. rCRT/39-272 can drive the activation of bone marrow derived DC in TLR4/CD14 dependent way, as indicated by secretion of cytokines IL-12/IL-23 (p40) and IL-1β. Exposure of DC to rCRT/39-272 induces P-Akt, suggesting that rCRT/39-272 induces maturation of DC through PI3K/Akt signaling pathway. The results suggest that soluble rCRT/39-272 is a potent stimulatory agent to DC maturation in TLR4/CD14 and PI3K/Akt dependent pathway. It may play important roles in initiating cellular immunity in vivo and the T cell response in vitro. Thus it could be used for study of DC-based tumor vaccines.

  10. Solvent extraction of thorium from nitrate medium by TBP, Cyanex272 and their mixture

    International Nuclear Information System (INIS)

    Mostaan Shaeri; Ahmad Rahbar Kelishami; Meisam Torab-Mostaedi


    The extraction behavior of thorium(IV) has been investigated with tri-butyl phosphate (TBP) and bis(2,4,4-trimethylpentyl) phosphinic acid (Cyanex272) in kerosene from nitrate medium. The effect of operating variables including time, aqueous phase acidity (pH), extractant concentration and temperature were investigated. This study also examined the synergistic enhancement of the extraction of thorium(IV) from nitrate medium by mixtures of TBP and Cyanex272 for the first time. The optimum synergistic enhancement factor of 3.86 was obtained at a Cyanex272/TBP molar ratio of 1:4. (author)

  11. 20 CFR 404.272 - Indexes we use to measure the rise in the cost-of-living. (United States)


    ... cost-of-living. 404.272 Section 404.272 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.272 Indexes we use to measure the rise in the cost-of-living. (a) The bases. To measure...

  12. The quassinoid derivative NBT-272 targets both the AKT and ERK signaling pathways in embryonal tumors. (United States)

    Castelletti, Deborah; Fiaschetti, Giulio; Di Dato, Valeria; Ziegler, Urs; Kumps, Candy; De Preter, Katleen; Zollo, Massimo; Speleman, Frank; Shalaby, Tarek; De Martino, Daniela; Berg, Thorsten; Eggert, Angelika; Arcaro, Alexandre; Grotzer, Michael A


    The quassinoid analogue NBT-272 has been reported to inhibit MYC, thus warranting a further effort 7to better understand its preclinical properties in models of embryonal tumors (ET), a family of childhood malignancies sharing relevant biological and genetic features such as deregulated expression of MYC oncogenes. In our study, NBT-272 displayed a strong antiproliferative activity in vitro that resulted from the combination of diverse biological effects, ranging from G(1)/S arrest of the cell cycle to apoptosis and autophagy. The compound prevented the full activation of both eukaryotic translation initiation factor 4E (eIF4E) and its binding protein 4EBP-1, regulating cap-dependent protein translation. Interestingly, all responses induced by NBT-272 in ET could be attributed to interference with 2 main proproliferative signaling pathways, that is, the AKT and the MEK/extracellular signal-regulated kinase pathways. These findings also suggested that the depleting effect of NBT-272 on MYC protein expression occurred via indirect mechanisms, rather than selective inhibition. Finally, the ability of NBT-272 to arrest tumor growth in a xenograft model of neuroblastoma plays a role in the strong antitumor activity of this compound, both in vitro and in vivo, with its potential to target cell-survival pathways that are relevant for the development and progression of ET.

  13. Liquid-liquid extraction of uranium (VI) using Cyanex 272 in kerosene from sodium salicylate medium

    International Nuclear Information System (INIS)

    Kamble, Pravin N.; Mohite, Baburao S.; Suryavanshi, Vishal J.; Salunkhe, Suresh T.


    Liquid-liquid extraction of uranium (VI) from sodium salicylate media using Cyanex 272 in kerosene has been carried out. Uranium (VI) was quantitatively extracted from 1x10 -4 M sodium salicylate with 5x10 -4 M Cyanex 272 in kerosene. It was stripped quantitatively from the organic phase with 4M HCl and determined spectrophotometrically with arsenazo(III) at 600 nm. The effects of concentrations of sodium salicylate, metal ions and strippants have been studied. Separation of uranium (VI) from other elements was achieved from binary as well as from multicomponent mixtures. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)

  14. Anti-proliferative activity of the quassinoid NBT-272 in childhood medulloblastoma cells. (United States)

    von Bueren, André O; Shalaby, Tarek; Rajtarova, Julia; Stearns, Duncan; Eberhart, Charles G; Helson, Lawrence; Arcaro, Alexandre; Grotzer, Michael A


    With current treatment strategies, nearly half of all medulloblastoma (MB) patients die from progressive tumors. Accordingly, the identification of novel therapeutic strategies remains a major goal. Deregulation of c-MYC is evident in numerous human cancers. In MB, over-expression of c-MYC has been shown to correlate with anaplasia and unfavorable prognosis. In neuroblastoma--an embryonal tumor with biological similarities to MB--the quassinoid NBT-272 has been demonstrated to inhibit cellular proliferation and to down-regulate c-MYC protein expression. To study MB cell responses to NBT-272 and their dependence on the level of c-MYC expression, DAOY (wild-type, empty vector transfected or c-MYC transfected), D341 (c-MYC amplification) and D425 (c-MYC amplification) human MB cells were used. The cells were treated with different concentrations of NBT-272 and the impact on cell proliferation, apoptosis and c-MYC expression was analyzed. NBT-272 treatment resulted in a dose-dependent inhibition of cellular proliferation (IC50 in the range of 1.7-9.6 ng/ml) and in a dose-dependent increase in apoptotic cell death in all human MB cell lines tested. Treatment with NBT-272 resulted in up to 90% down-regulation of c-MYC protein, as demonstrated by Western blot analysis, and in a significant inhibition of c-MYC binding activity. Anti-proliferative effects were slightly more prominent in D341 and D425 human MB cells with c-MYC amplification and slightly more pronounced in c-MYC over-expressing DAOY cells compared to DAOY wild-type cells. Moreover, treatment of synchronized cells by NBT-272 induced a marked cell arrest at the G1/S boundary. In human MB cells, NBT-272 treatment inhibits cellular proliferation at nanomolar concentrations, blocks cell cycle progression, induces apoptosis, and down-regulates the expression of the oncogene c-MYC. Thus, NBT-272 may represent a novel drug candidate to inhibit proliferation of human MB cells in vivo.

  15. 40 CFR 272.1601 - New Mexico State-Administered Program: Final Authorization. (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false New Mexico State-Administered Program... (CONTINUED) SOLID WASTES (CONTINUED) APPROVED STATE HAZARDOUS WASTE MANAGEMENT PROGRAMS New Mexico § 272.1601 New Mexico State-Administered Program: Final Authorization. (a) Pursuant to section 3006(b) of RCRA...

  16. 7 CFR 272.11 - Systematic Alien Verification for Entitlements (SAVE) Program. (United States)


    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Systematic Alien Verification for Entitlements (SAVE... FOR PARTICIPATING STATE AGENCIES § 272.11 Systematic Alien Verification for Entitlements (SAVE... and Naturalization Service (INS), in order to verify the validity of documents provided by aliens...

  17. 75 FR 29975 - Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1679] Expansion of Foreign-Trade Zone 272; Lehigh Valley, Pennsylvania Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the Foreign-Trade Zones Board (the Board) adopts the...

  18. 47 CFR 53.201 - Services for which a section 272 affiliate is required. (United States)


    ... activities described in section 271(f) of the Act, a BOC shall comply with the following: (1) A BOC shall... section 272 affiliate no later than February 8, 1997. (2) A BOC shall provide previously authorized inter... the AT&T Consent Decree that authorized such services. (b) InterLATA information services. A BOC shall...

  19. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  20. Preformulation stability study of the EGFR inhibitor HKI-272 (Neratinib) and mechanism of degradation. (United States)

    Lu, Qinghong; Ku, Mannching Sherry


    The stability in solution of HKI-272 (Neratinib) was studied as a function of pH. The drug is most stable from pH 3 to 4, and degradation rate increases rapidly around pH 6 and appears to approach a maximum asymptotic limit in the range of pH 812. Pseudo first-order reaction kinetics was observed at all pH values. The structure of the major degradation product indicates that it is formed by a cascade of reactions within the dimethylamino crotonamide group of HKI-272. It is assumed that the rate-determining step is the initial isomerization from allyl amine to enamine functionality, followed by hydrolysis and subsequent cyclization to a stable lactam. The maximum change in degradation rate as a function of pH occurs at about pH 6, which corresponds closely to the theoretical pKa value of the dimethylamino group of HKI-272 when accounting for solvent/temperature effects. The observed relationship between pH and degradation rate is discussed, and a self-catalyzed mechanism for the allylamine-enamine isomerization reaction is proposed. The relevance of these findings to other allylamine drugs is discussed in terms of the relative stability of the allylic anion intermediate through which, the isomerization occurs.


    Directory of Open Access Journals (Sweden)



    Full Text Available Discarded cell phones contribute significantly to the amount of electronic waste generation whilst some of its components are toxic and recoverable. Also, due to the increasing demand for Cu(II in building/construction, electrical and as chemical tool in freshwater, it is imperative to develop low cost and ecofriendly technique as a substitute for the conventional treatments such as reduction-roasting route at elevated temperatures. In the present study, the hydrometallurgical operations involving leaching, solvent extraction and precipitation for the recovery of Cu(II by Cyanex® 272 in kerosene was examined. Various parameters affecting the extraction of Cu(II such as pH, extractant concentration and phase ratio were optimized. At optimal conditions, about 96.3 % Cu(II was extracted into the organic phase by 0.2 mol/L Cyanex® 272 at equilibrium pH 5.0 and aqueous to organic phase ratio 1:1. The stripping of the loaded organic was carried out by 0.1 mol/L HCl solution and stripping efficiency of 98 % was obtained. By McCabe Thiele diagram, four stages are required for complete extraction of Cu(II.

  2. Extraction and Separation of Cobalt and Nickel with Extractants Cyanex 302, Cyanex 272 and Their Mixture

    Directory of Open Access Journals (Sweden)

    Lenhard, Z.


    Full Text Available The extraction and separation of cobalt(II and nickel(II from sulphate solutions with different initial volume fractions of commercial organophosphorus extractants Cyanex 302, Cyanex 272 and their mixture, in kerosene as diluent, were investigated. Prepared samples contained the mixture of cobalt(II and nickel(II in mass concentrations chosen to approximate the mass concentrations of the two metals in solutions obtained by leaching typical low-grade ores or waste materials with sulphuric acid. The experiments were carried out at two concentration ratios of nickel to cobalt(ζNi/Co, 25 and 125. The latter ratio was chosen as model for the solutions of naturally occurring ores and other materials in which the concentration of nickel is much higher than that of cobalt. In all cases, the concentration of cobalt was approximately y= 0.15 g L–1, and the concentration of nickel was approximately g= 3.80 g L–1 (at ζNi/Co = 25 and 18.80 g L–1 (at ζNi/Co = 125. Other initial values were based on conditions found to be optimal in previous investigations, and kept constant in all experiments: pH0= 8, θ0 = 25 °C, phase volume ratio organic to aqueous ψ = 1 and 0.5, contact time 2 minutes.The tested fractions of extractants (Cyanex 302 or Cyanex 272, diluted in kerosene, were j = 2.5, 5.0, 7.5 and φ = 10 %. The studies of the mixture of extractants were carried out at two sets of fractions. In the first set, the fraction of Cyanex 302 was kept at φ = 10 %, and Cyanex 272 was varied in the range φ = 2.5 –10 %. In the second set, the mass concentration of each of the two extractants was varied in the range φ = 2.5–10 % so that the total fraction of the two extractants always added up to φ= 10 %.The obtained results describe the influences of type and initial volume fraction of extractant on the separation and extraction of cobalt and nickel. Under the investigated range of conditions, Cyanex 302 outperformed Cyanex 272 in cobalt

  3. Genotyping-by-sequencing data of 272 crested wheatgrass (Agropyron cristatum genotypes

    Directory of Open Access Journals (Sweden)

    Pingchuan Li


    Full Text Available Crested wheatgrass [Agropyron cristatum L. (Gaertn.] is an important cool-season forage grass widely used for early spring grazing. However, the genomic resources for this non-model plant are still lacking. Our goal was to generate the first set of next generation sequencing data using the genotyping-by-sequencing technique. A total of 272 crested wheatgrass plants representing seven breeding lines, five cultivars and five geographically diverse accessions were sequenced with an Illumina MiSeq instrument. These sequence datasets were processed using different bioinformatics tools to generate contigs for diploid and tetraploid plants and SNPs for diploid plants. Together, these genomic resources form a fundamental basis for genomic studies of crested wheatgrass and other wheatgrass species. The raw reads were deposited into Sequence Read Archive (SRA database under NCBI accession SRP115373 ( and the supplementary datasets are accessible in Figshare (10.6084/m9.figshare.5345092. Keywords: Crested wheatgrass, Genotyping-by-sequencing, Diploid, Tetraploid, Raw sequence data

  4. The extraction of zinc and other minor metals from concentrated ammonium chloride solutions with D2EHPA and Cyanex 272

    Directory of Open Access Journals (Sweden)

    Amer, S.


    Full Text Available A comparative study is made of the extractants D2EHPA and Cyanex 272 for the zinc and minor metal extraction from aqueous concentrated ammonium chloride solutions, as those of the leaching liquors of the CENIM-LNETI process. Extraction equilibrium data for zinc are presented as extraction isotherms at constant pH and at a temperature of 50 °C. Zinc extraction and coextraction of minor metal ions as Cu, Ca, Pb, Mg, Cd, Co, Ni and Hg are studied. Mercury does not extract from concentrated ammonium chloride solutions. Cyanex 272 shows a better selectivity for zinc with regard to the minor metals than D2EHPA, which is especially remarkable for calcium, the most coextracted element by D2EHPA. Nickel and cadmium coextraction is negligible for both extractants. The possible use of the Cyanex 272 as an alternative to D2EHPA is considered.

    Se realiza un estudio comparativo del comportamiento del D2EHPA y del Cyanex 272 durante la extracción del cinc y otros metales minoritarios de soluciones acuosas concentradas de cloruro amónico, como las de las soluciones de lixiviación del proceso CENIM-LNETI. Se presentan los datos de equilibrio de extracción del cinc en forma de isotermas de extracción a una temperatura de 50 °C y pH constante y se estudia la coextracción de los metales minoritarios Cu, Ca, Pb, Mg, Cd, Co, Ni y Hg. El mercurio no se extrae de las soluciones concentradas de cloruro amónico. La selectividad del Cyanex 272 para el cinc respecto de esos metales minoritarios es mejor que la del D2EHPA, siendo verdaderamente notable para el calcio, que es la impureza que más se coextrae con el D2EHPA. La coextracción de níquel y de cadmio es muy pequeña para ambos extractantes. Se considera la posibilidad del uso alternativo del Cyanex 272 en lugar del D2EHPA.

  5. Ambient Ozone Pollution and Daily Mortality: A Nationwide Study in 272 Chinese Cities. (United States)

    Yin, Peng; Chen, Renjie; Wang, Lijun; Meng, Xia; Liu, Cong; Niu, Yue; Lin, Zhijing; Liu, Yunning; Liu, Jiangmei; Qi, Jinlei; You, Jinling; Zhou, Maigeng; Kan, Haidong


    Few large multicity studies have been conducted in developing countries to address the acute health effects of atmospheric ozone pollution. We explored the associations between ozone and daily cause-specific mortality in China. We performed a nationwide time-series analysis in 272 representative Chinese cities between 2013 and 2015. We used distributed lag models and over-dispersed generalized linear models to estimate the cumulative effects of ozone (lagged over 0-3 d) on mortality in each city, and we used hierarchical Bayesian models to combine the city-specific estimates. Regional, seasonal, and demographic heterogeneity were evaluated by meta-regression. At the national-average level, a 10-μg/m 3 increase in 8-h maximum ozone concentration was associated with 0.24% [95% posterior interval (PI): 0.13%, 0.35%], 0.27% (95% PI: 0.10%, 0.44%), 0.60% (95% PI: 0.08%, 1.11%), 0.24% (95% PI: 0.02%, 0.46%), and 0.29% (95% PI: 0.07%, 0.50%) higher daily mortality from all nonaccidental causes, cardiovascular diseases, hypertension, coronary diseases, and stroke, respectively. Associations between ozone and daily mortality due to respiratory and chronic obstructive pulmonary disease specifically were positive but imprecise and nonsignificant. There were no statistically significant differences in associations between ozone and nonaccidental mortality according to region, season, age, sex, or educational attainment. Our findings provide robust evidence of higher nonaccidental and cardiovascular mortality in association with short-term exposure to ambient ozone in China.

  6. Fine Particulate Air Pollution and Daily Mortality. A Nationwide Analysis in 272 Chinese Cities. (United States)

    Chen, Renjie; Yin, Peng; Meng, Xia; Liu, Cong; Wang, Lijun; Xu, Xiaohui; Ross, Jennifer A; Tse, Lap A; Zhao, Zhuohui; Kan, Haidong; Zhou, Maigeng


    Evidence concerning the acute health effects of air pollution caused by fine particulate matter (PM 2.5 ) in developing countries is quite limited. To evaluate short-term associations between PM 2.5 and daily cause-specific mortality in China. A nationwide time-series analysis was performed in 272 representative Chinese cities from 2013 to 2015. Two-stage Bayesian hierarchical models were applied to estimate regional- and national-average associations between PM 2.5 concentrations and daily cause-specific mortality. City-specific effects of PM 2.5 were estimated using the overdispersed generalized additive models after adjusting for time trends, day of the week, and weather conditions. Exposure-response relationship curves and potential effect modifiers were also evaluated. The average of annual mean PM 2.5 concentration in each city was 56 μg/m 3 (minimum, 18 μg/m 3 ; maximum, 127 μg/m 3 ). Each 10-μg/m 3 increase in 2-day moving average of PM 2.5 concentrations was significantly associated with increments in mortality of 0.22% from total nonaccidental causes, 0.27% from cardiovascular diseases, 0.39% from hypertension, 0.30% from coronary heart diseases, 0.23% from stroke, 0.29% from respiratory diseases, and 0.38% from chronic obstructive pulmonary disease. There was a leveling off in the exposure-response curves at high concentrations in most, but not all, regions. The associations were stronger in cities with lower PM 2.5 levels or higher temperatures, and in subpopulations with elder age or less education. This nationwide investigation provided robust evidence of the associations between short-term exposure to PM 2.5 and increased mortality from various cardiopulmonary diseases in China. The magnitude of associations was lower than those reported in Europe and North America.

  7. Apolipoprotein E4 (1–272 fragment is associated with mitochondrial proteins and affects mitochondrial function in neuronal cells

    Directory of Open Access Journals (Sweden)

    Michikawa Makoto


    Full Text Available Abstract Background Apolipoprotein E allele ε4 (apoE4 is a strong risk factor for developing Alzheimer's disease (AD. Secreted apoE has a critical function in redistributing lipids among central nervous system cells to maintain normal lipid homeostasis. In addition, previous reports have shown that apoE4 is cleaved by a protease in neurons to generate apoE4(1–272 fragment, which is associated with neurofibrillary tanglelike structures and mitochondria, causing mitochondrial dysfunction. However, it still remains unclear how the apoE fragment associates with mitochondria and induces mitochondrial dysfunction. Results To clarify the molecular mechanism, we carried out experiments to identify intracellular apoE-binding molecules and their functions in modulating mitochondria function. Here, we found that apoE4 binds to ubiquinol cytochrome c reductase core protein 2 (UQCRC2 and cytochrome C1, both of which are components of mitochondrial respiratory complex III, and cytochrome c oxidase subunit 4 isoform 1 (COX IV 1, which is a component of complex IV, in Neuro-2a cells. Interestingly, these proteins associated with apoE4(1–272 more strongly than intact apoE4(1–299. Further analysis showed that in Neuro-2a cells expressing apoE4(1–272, the enzymatic activities of mitochondrial respiratory complexes III and IV were significantly lower than those in Neuro-2a cells expressing apoE4(1–299. Conclusion ApoE4(1–272 fragment expressed in Neuro2a cells is associated with mitochondrial proteins, UQCRC2 and cytochrome C1, which are component of respiratory complex III, and with COX IV 1, which is a member of complex IV. Overexpression of apoE4(1–272 fragment impairs activities of complex III and IV. These results suggest that the C-terminal-truncated fragment of apoE4 binds to mitochondrial complexes and affects their activities, and thereby leading to neurodegeneration.

  8. Calreticulin Fragment 39-272 Promotes B16 Melanoma Malignancy through Myeloid-Derived Suppressor Cells In Vivo

    Directory of Open Access Journals (Sweden)

    Xiao-Yan He


    Full Text Available Calreticulin (CRT, a multifunctional Ca2+-binding glycoprotein mainly located in the endoplasmic reticulum, is a tumor-associated antigen that has been shown to play protective roles in angiogenesis suppression and anti-tumor immunity. We previously reported that soluble CRT (sCRT was functionally similar to heat shock proteins or damage-associated molecular patterns in terms of ability to activate myeloid cells and elicit strong inflammatory cytokine production. In the present study, B16 melanoma cell lines expressing recombinant CRT fragment 39-272 (sCRT/39-272 in secreted form (B16-CRT, or recombinant enhanced green fluorescence protein (rEGFP (B16-EGFP, were constructed for investigation on the roles of sCRT in tumor development. When s.c. inoculated into C57BL/6 mice, the B16-CRT cells were significantly more aggressive (in terms of solid tumor growth rate than B16-EGFP controls in a TLR4- and myeloid-derived suppressor cells (MDSC-dependent manner. The B16-CRT-bearing mice showed increased Gr1+ MDSC infiltration in tumor tissues, accelerated proliferation of CD11b+Ly6G+Ly6Clow (G-MDSC precursors in bone marrow, and higher percentages of G-MDSCs in spleen and blood, which was mirrored by decreased percentage of dendritic cells (DC in periphery. In in vitro studies, recombinant sCRT/39-272 was able to promote migration and survival of tumor-derived MDSCs via interaction with TLR4, inhibit MDSC differentiation into DC, and also elicit expression of inflammatory proteins S100A8 and S100A9 which are essential for functional maturation and chemotactic migration of MDSCs. Our data provide solid evidence for CRT as a double-edged sword in tumor development.

  9. [A protective effect of GLY272SER polymorphism of GNB3 gene in development of essential hypertension and its relations with environmental hypertension risk factors]. (United States)

    Polonikov, A V; Solodilova, M A; Ivanov, V P; Shestakov, A M; Ushachev, D V; Vialykh, E K; Vasil'eva, O V; Poliakova, N V; Antsupov, V V; Kabanina, V A; Kupriianova, Ia S; Bulgakova, I V; Kozhukhov, M A; Tevs, D S


    To study associations of C825T (rs5443) and G272S (rs16932941) polymorphisms of GNB3 gene in Russian population of the Central Chernozem region with essential hypertension (EH) risk; to elicit the role of environmental risk factors in realization of EH predisposition in this gene genotypes carriers. We studied DNA samples obtained from 205 EH patients and 207 healthy individuals. EH patients were treated in Kursk hospitals. Genotyping of GNB3 gene polymorphisms was conducted by polymerase chain reaction and restriction analysis. Prevalence of 82ST allele of GNB3 gene in EH patients and healthy individual was 0.334 and 0.295, respectively, of 272S allele--0.037 and 0.058, respectively. We found no significant differences by prevalence of genotypes of gene GNB3 polymorphisms C825T and G272S in EH patients and healthy individuals. Non-smoking carriers of 272GS genotype had a low risk of EH (OR 0.42 in 95% CI from 0.18 to 0.97; p = 0.04). Smokers had no protective effect of this genotype. The protective effect of 272GS genotype was also found in individuals with low or moderate alcohol drinking habits (OR 0.29 in 95% CI from 0.11 to 0.77, p = 0.02) and in individuals without chronic exposure to stress (OR 0.29 in 95% CI from 0.09 to 0.91, p = 0.04). In contrast, hard drinkers and patients exposed to chronic stress had no protective effect of heterozygous genotype 272GS of gene GNB3. G272S polymorphism of GNB3 gene can be considered as a new genetic marker of predisposition to EH. The protective effect depends of environmental factors associated with high risk to develop EH.

  10. Development of reliable analytical method for extraction and separation of thorium(IV) by Cyanex 272 in kerosene

    International Nuclear Information System (INIS)

    Madane, N.S.; Mohite, B.S.


    A simple and selective spectrophotometric method has been developed for the extraction and separation of thorium(IV) from sodium salicylate media using Cyanex 272 in kerosene. Thorium(IV) was quantitatively extracted by 5 x 10 -4 M Cyanex 272 in kerosene from 1 x 10 -5 M sodium salicylate medium. The extracted thorium(IV) was stripped out quantitatively from the organic phase with 4.0 M hydrochloric acid and determined spectrophotometrically with arsenazo(III) at 620 nm. The effect of concentrations of sodium salicylate, extractant, diluents, metal ion and strippants has been studied. Separation of thorium(IV) from other elements was achieved from binary as well as multicomponent mixtures such as uranium(VI), strontium(II), rubidium(I), cesium(I), potassium(I), Sodium(I), lithium(I), lead(II), barium(II), beryllium(II) etc. Using this method separation and determination of thorium(IV) in geological and real samples has been carried out. The method is simple, rapid and selective with good reproducibility (approximately ±2%). (author)

  11. Studies on thermo-acoustic parameters in binary liquid mixtures of phosphinic acid (Cyanex 272) with different diluents at temperature 303.15 K: an ultrasonic study

    International Nuclear Information System (INIS)

    Kamila, Susmita; Jena, Satyaban; Swain, Bipin Bihari


    Acoustical investigations for the binary mixtures of phosphinic acid (Cyanex 272), used as liquid-liquid extractant, have been made in various diluents such as benzene, toluene, and xylene from ultrasonic velocity and density measurements at temperature 303.15 K and atmospheric pressure. This study involves evaluation of different thermo-acoustic parameters along with the excess properties, which are interpreted in the light of molecular interaction between a polar extractant, Cyanex 272 with non-polar diluent, benzene and weakly polar diluents, toluene and xylene. The excess values are correlated using Redlich-Kister polynomial equation, and corresponding adjustable parameters are derived

  12. High-Performance Computing Act of 1991. Report of the Senate Committee on Commerce, Science, and Transportation on S. 272. Senate, 102d Congress, 1st Session. (United States)

    Congress of the U.S., Washington, DC. Senate Committee on Commerce, Science, and Transportation.

    This report discusses Senate Bill no. 272, which provides for a coordinated federal research and development program to ensure continued U.S. leadership in high-performance computing. High performance computing is defined as representing the leading edge of technological advancement in computing, i.e., the most sophisticated computer chips, the…

  13. Human p53(264-272) HLA-A2 binding peptide is an immunodominant epitope in DNA-immunized HLA-A2 transgenic mice

    DEFF Research Database (Denmark)

    Petersen, T R; Bregenholta, S; Pedersen, L O


    C57BL/10 mice transgenic for HLA-A2 were immunized with either a full-length DNA-construct of the tumor suppressor p53 or with a minigene encoding the p53-derived immunodominant peptide p53(264)LLGRNSFEV272 (L9V). Vaccination with the full-length p53 construct induced potent cytotoxic activity...

  14. Risk Factors for Mortality in 272 Patients With Lung Transplant: A Multicenter Analysis of 7 Intensive Care Units. (United States)

    Rello, Jordi; Bello, Irene; de Vicente, Rosario; Hermira Anchuelo, Ana; Ballesteros, Maria Ángeles; Iranzo, Reyes; Rellán, Luzdivina; Riera, Jordi; Robles, Juan Carlos


    One-year survival in lung transplant is around 85%, but this figure has not increased in recent years, in spite of technical improvements. Retrospective, multicenter cohort study. Data from 272 eligible adults with lung transplant were recorded at 7 intensive care units (ICU) in Spain in 2013. The objective was to identify variables that might help to guide future clinical interventions in order to reducethe risk of death in the postoperative period. One patient (0.3%) died in the operating room and 27 (10%) within 90 days. Twenty (7.4%) died within 28 days, after a median of 14 ICU days. Grade 3 pulmonary graft dysfunction was documented in 108 patients, of whom 21 died, compared with 6 out of 163 without pulmonary graft dysfunction (P60yr (OR: 2.91) and SOFA>8 (OR: 2.53) as independent predictors of 90-day mortality. At ICU admission, higher median procalcitonin (1.6 vs 0.6) and lower median PaO2/FiO2 (200 vs 280mmHg) were significantly associated with mortality. Graft dysfunction remains a significant problem in lung transplant. Early ICU interventions in patients with severe hypoxemia or high procalcitonin are crucial in order to lower mortality. Copyright © 2017 SEPAR. Publicado por Elsevier España, S.L.U. All rights reserved.

  15. Final report on CCQM-K27.2: Second Subsequent study: determination of ethanol in aqueous media (United States)

    Schantz, Michele M.; Parris, Reenie M.; May, Willie E.; Rosso, Adriana; Puglisi, Celia; Marques Rodrigues Caixeiro, Janaína; Massiff, Gabriela; Camacho Frías, Evangelina; Pérez Urquiza, Melina; Archer, Marcellé; Visser, M. S.; deVos, Betty-Jayne


    subsequent study (nominal concentrations of 0.2 mg/g, 1 mg/g, 3 mg/g and 60 mg/g). The three participants in the CCQM-K27-Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in the concentration range of 0.2 mg/g to 60 mg/g. A report on this project has been approved by the CCQM and can be found at the BIPM website. A second follow-on key comparison, CCQM-K27.2 Second Subsequent, was initiated in 2006 to accommodate laboratories that had not been ready to benchmark their methods in the previous two CCQM-K27 studies. Two levels of ethanol in water were used in the second subsequent study ranging in concentration between 0.5 mg/g and 4 mg/g. Four of the five participants in the CCQM-K27.2 Second Subsequent key comparison demonstrated their ability to measure ethanol in aqueous matrix in that concentration range. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database The final report has been peer-reviewed and approved for publication by the CCQM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  16. An Investigation of Comet Hale-Bopp at 21.6 and 27.2 AU from the Sun (United States)

    Kramer, Emily A.; Fernandez, Y. R.; Kelley, M. S.; Woodney, L. M.; Lisse, C. M.


    Comet Hale-Bopp offered us an unprecedented opportunity to observe a large, bright comet in great detail. Since its 1997 perihelion, continued observations have let us observe how its activity has changed over time. Here we present 2005 and 2008 Spitzer Space Telescope observations of Hale-Bopp that show coma and tail, which is uncommon given its heliocentric distance -- 21.6 AU in 2005 and 27.2 AU in 2008. We have images at 24 µm (obtained with MIPS, the Multiband Imaging Photometer for Spitzer) that show thermal emission from the dust, and we are using dynamical models [1,2] to explain the dust morphology and constrain the dust's properties. Preliminary work suggests that the motion of the dust cannot be solely due to the effects of gravity and radiation pressure, which generally are the dominant forces. We investigate the role of other possible driving forces such as the so-called rocket force [3]. Our science goals are to: understand the comet's activity mechanism, constrain the age of the dust, find the size of the grains, and compare properties of the dust we see now to those of the dust seen in the 1990s. Our overarching goal is to use Hale-Bopp and other distant, active comets to understand cometary activity and the structure of cometary nuclei, which is related to icy planetesimal formation and evolution. We acknowledge support from the NSF, NASA and the Spitzer Science Center for this work. References: [1] Kelley, M.S., et al. 2008, Icarus 193, 572, [2] Lisse, C.M., et al. 1998, ApJ 496, 971, [3] Reach, W.T., et al. 2009, Icarus 203, 571.

  17. Measurement of polarization in K-p elastic scattering between 0.955 GeV/c and 1.272 GeV/c

    International Nuclear Information System (INIS)

    Bryant, H.C.; Carter, A.A.; Coupland, M.; Eisenhandler, E.; Gibson, W.R.; Kalmus, P.I.P.; Pritchard, T.W.; Sandhu, H.; Watts, S.J.; Arnison, G.T.J.


    The polarization parameter has been measured for K - p elastic scattering at nine incident beam momenta between 0.955 and 1.272 GeV/c covering the c.m. angular range -0.9 < cos theta* < +0.9. Experimental results and coefficients of Legendre polynomial fits to the data are presented and compared with other measurements and a partial-wave analysis. (orig.)

  18. Comparative study on Ce (III) and La (III) solvent extraction and separation from a nitric acid medium by D2EHPA and Cyanex272 (United States)

    Habibpour, R.; Dargahi, M.; Kashi, E.; Bagherpour, M.


    The solvent extraction of Cerium(III) and Lanthanum(III) from nitric acid solution using the organophosphorous extractants Di-(2-ethyl hexyl) phosphate (D2EHPA) and di-2,4,4- trimethylpentyl phosphoric acid (Cyanex272) in kerosene was investigated. In this study, the magnitude of the extraction of Ce(III) was found to be more significant with Cyanex272 than D2EHPA. D2EHPA was found to be a better extractant for La(III). Among the two extractants, Cyanex272 was used for the separation of Ce from La in three stages with an extraction efficiency of 90.2% for Ce. A 556 mg/L Ce solution was used for the scrubbing of La with an efficiency of ≈34%, which required multi stage scrubbing. The study of thermodynamic parameters such as enthalpy, entropy, and Gibbs free energy impart the exothermic and non-spontaneous process. The chemical speciation curves for lanthanum and cerium in the aqueous phase as a function of pH showed that the free La(III) and Ce(III) metal ion species were largely predominate between a pH = 0 and pH = 7.

  19. Analysis of a hydrometallurgical route to recover base metals from spent rechargeable batteries by liquid-liquid extraction with Cyanex 272 (United States)

    Mantuano, Danuza Pereira; Dorella, Germano; Elias, Renata Cristina Alves; Mansur, Marcelo Borges

    A hydrometallurgical route is proposed to recover zinc and manganese from spent alkaline batteries in order to separate base metals such as nickel, copper, aluminium, cadmium, lithium and cobalt which constitute the main metallic species of spent NiCd, NiMH and Li-ion rechargeable batteries. The route comprises the following main steps: (1) sorting batteries by type, (2) battery dismantling to separate the spent battery dust from plastic, iron scrap and paper, (3) leaching of the dust with sulphuric acid and (4) metal separation by a liquid-liquid extraction using Cyanex 272 (bis-2,4,4-trimethylpentyl phosphinic acid) as extractant. The metal content of NiCd, NiMH and Li-ion batteries from three distinct manufacturers has been evaluated. A factorial design of experiments was used to investigate the leaching step using operational variables such as temperature, H 2SO 4 concentration, S/L ratio and H 2O 2 concentration. Analysis of metal separation by the liquid-liquid extraction with Cyanex 272 identified a pH 1/2 2.5-3.0 for zinc and aluminium, pH 1/2 4.0-4.5 for manganese, cadmium, copper and cobalt, pH 1/2 6.5 for nickel and pH 1/2 8.0 for lithium. These results indicate that batteries must be previously sorted by type and treated separately. In addition, data fitting to an equilibrium model proposed for the reactive test system by the European Federation of Chemical Engineering (EFChE) have indicated that MR 2(RH) 2 and MR 2 complexes (where M = Zn, Mn, Co, Cd and Cu) co-exist in the organic phase with Cyanex 272 depending on the loading conditions. The route has been found technically viable to separate the main metallic species of all batteries considered in this study.

  20. Geographic distribution and regional origin of 272 cystic fibrosis mutations in European populations. The Biomed CF Mutation Analysis Consortium. (United States)

    Estivill, X; Bancells, C; Ramos, C


    The geographic distribution of 272 cystic fibrosis (CF) mutations has been studied by assessing the origin of 27,177 CF chromosomes from 29 European countries and three countries from the North of Africa. The most common mutations are delta F308 (66.8%), G542X (2.6%), N1303K (1.6%), G551D (1.5%) and W1282X (1.0%). The delta F508 mutation has the highest frequency in Denmark (87.2%) and the lowest in Algeria (26.3%). Mutation G542X is common in the Mediterranean countries, with a mean frequency of 6.1%. N1303K is found in most of the western and Mediterranean countries and has the highest frequency in Tunisia (17.2%). The wide distribution of these mutations suggests an ancient origin. G551D is common in north-west and central Europe, but is uncommon in other parts of Europe. W1282X has the highest frequency in Israel (36.2%), being also common in most Mediterranean countries and north Africa. Seventeen mutation have frequencies between 0.1 and 0.9%, 1717-1G-->A (0.83%), R553X (0.75%), R1162X (0.51%), 621 + 1G-->T (0.54%) and 2183AA-->G (0.36%), being the most common ones. Some mutations reach relatively high frequencies in some extended geographic regions, such as mutation 394delTT in northern Europe (1.1-28.8%), R117H in northwestern Europe (1.3-3.0%), R553X in central Europe (1.1-24.4%), 1717-1G-->A in Belgium and France (1.1-5.3%), and 2183AA-->G in Italy and Greece (3.2%). Other mutations are only common in small regions: T338I (Sardinia), 711 + 1G-->T (Tunisia), R1162X (Algeria and north of Italy), 1609delCA (east of Spain), 1811 + 1.6kbA-->G (southeastern Spain), R1066C (Portugal), S549R (Algeria), R334W (Crete), 621 + 1G-->T (Central Greece), 3849 + 10kbC-->T (Israel), 2789 + 5G-->A (south of Greece), 451 + 1G--A (Israel), R347P (south of Bulgaria), 1677delTA (south of Bulgaria and Turkey), G85E (south of Greece), R347H (Turkey), 3905insT (Switzerland), 1078delT (Brittany), 1898 + 1G-->A (Wales), A455E (The Netherlands), delta I507 (Brittany), 3659del

  1. Interaction between ADH1C Arg272Gln and alcohol intake in relation to breast cancer risk suggests that ethanol is the causal factor in alcohol related breast cancer

    DEFF Research Database (Denmark)

    Benzon Larsen, Signe; Vogel, Ulla Birgitte; Christensen, Jane


    , Cancer and Health study. Among variant allele carriers of ADH1C Arg(272)Gln, alcohol intake increased the risk of breast cancer with 14% (95% CI: 1.04-1.24) per 10g alcohol/day, but not among homozygous wild type carriers (p for interaction=0.06). Thus, slow oxidation of ethanol seemed to be associated...

  2. Extreme 15N-enrichments in 2.72-Gyr-old sediments: evidence for a turning point in the nitrogen cycle. (United States)

    Thomazo, C; Ader, M; Philippot, P


    Although nitrogen is a key element in organic molecules such as nucleic acids and proteins, the timing of the emergence of its modern biogeochemical cycle is poorly known. Recent studies on the antiquity of the nitrogen cycle and its interaction with free oxygen suggests the establishment of a complete aerobic N biogeochemical cycle with nitrification, denitrification, and nitrogen fixation at about 2.68 Gyr. Here, we report new bulk nitrogen isotope data for the 2.72 billion-year-old sedimentary succession of the Tumbiana Formation (Pilbara Craton, Western Australia). The nitrogen isotopic compositions vary widely from +8.6‰ up to +50.4‰ and are inversely correlated with the very low δ(13)C values of associated organic matter defining the Fortescue excursion (down to about -56‰). We propose that this (15)N-enrichment records the onset of nitrification coupled to the continuous removal of its derivatives (nitrite and nitrate) by denitrification. This finding implies an increase in the availability of electron acceptors and probably oxygen in the Tumbiana depositional environment, 300 million years before the oxygenation of the Earth's atmosphere. © 2011 Blackwell Publishing Ltd.

  3. Recovery of Cd(II), Co(II) and Ni(II) from Chloride Medium by Solvent Extraction Using CYANEX 923 and CYANEX 272 I

    International Nuclear Information System (INIS)

    Ahmed, M.; El Dessouky, S.I.; El-Nadi, Y.A.; Daoud, J.A.; Saad, E.A.


    The paper aims to study the extraction and separation of Cd(II), Co(II) and Ni(II) from their mixtures in hydrochloric acid medium with CYANEX 923 in kerosene. Preliminary investigations showed that only Cd(II) is extracted with CYANEX 923 while Co(II) and Ni(II) are not extracted. Different parameters affecting the extraction of Cd(II) with CYANEX 923 such as hydrochloric acid, hydrogen ion, extractant and metal concentrations, temperature investigations were also investigated. The stoichiometry of the extracted metal species investigated was found to be HCdCl 3 . 2 CYANEX 923. The stripping of the extracted Cd(II) species is obtained with 0.1 M HCl solution. Co(II) was found to be extracted with CYANEX 272 at ph 5.8 leaving Ni(II) in the solution. A developed process for the sequential of Cd(II), Co(II) and Ni(II) from their mixture in hydrochloric acid medium is proposed

  4. Flight Test of a 40-Foot Nominal Diameter Disk-Gap-Band Parachute Deployed at a Mach Number of 2.72 and a Dynamic Pressure of 9.7 Pounds per Square Foot (United States)

    Eckstrom, Clinton V.; Preisser, John S.


    A 40-foot-nominal-diameter (12.2 meter) disk-gap-band parachute was flight tested as part of the NASA Supersonic Planetary Entry Decelerator (SPED-I) Program. The test parachute was deployed from an instrumented payload by means of a deployment mortar when the payload was at an altitude of 158,500 feet (48.2 kilometers), a Mach number of 2.72, and a free-stream dynamic pressure of 9.7 pounds per foot(exp 2) (465 newtons per meter(exp 2)). Suspension line stretch occurred 0.46 second after mortar firing and the resulting snatch force loading was -8.lg. The maximum acceleration experienced by the payload due to parachute opening was -27.2g at 0.50 second after the snatch force peak for a total elapsed time from mortar firing of 0.96 second. Canopy-shape variations occurred during the higher Mach number portion of the flight test (M greater than 1.4) and the payload was subjected to large amplitude oscillatory loads. A calculated average nominal axial-force coefficient ranged from about 0.25 immediately after the first canopy opening to about 0.50 as the canopy attained a steady inflated shape. One gore of the test parachute was damaged when the deployment bag with mortar lid passed through it from behind approximately 2 seconds after deployment was initiated. Although the canopy damage caused by the deployment bag penetration had no apparent effect on the functional capability of the test parachute, it may have affected parachute performance since the average effective drag coefficient of 0.48 was 9 percent less than that of a previously tested parachute of the same configuration.

  5. Risk-reducing, conservative mastectomy-analysis of surgical outcome and quality of life in 272 implant-based reconstructions using TiLoop(®) Bra versus autologous corial flaps. (United States)

    Rezai, Mahdi; Strauß, Stefanie; Kimmig, Rainer; Kern, Peter


    Different approaches have evolved for conservative mastectomies, mostly according to surgeon's preference. Patients' perspective was not always in the primary focus. BRCA status has drawn much attention and therapeutic as well as prophylactic mastectomies are rising. However, knowledge on quality of life (QoL) thereafter is limited. We investigated the surgical and patient reported outcome of conservative mastectomies with implants and TiLoop(®) Bra vs. corial flaps. Conservative mastectomies were analyzed from a prospectively maintained database in a unicentric study of consecutive 272 reconstructions from 2000-2014. We used four validated QoL questionnaires: FACT-G, EORTC C-30, EORTC B-23 and Breast Cancer Treatment Outcome Scale (BCTOS). The use of TiLoop(®) Bra, a titanized polypropylene mesh, for lower breast pole coverage was compared to autologous corial flaps. A total of 217 patients with 272 conservative mastectomies (55 bilateral) were included. Median follow-up was 3.5 years (range, 0-14 years). Skin-sparing mastectomy (SSM) was performed in 131 patients and subcutaneous mastectomy (SCM) in 86 patients. Invasive breast-cancer was the indication for surgery in 106 patients, non-invasive breast cancer (DCIS) in 80 patients, prophylactic indication (BRCA1/2-mutation) in 30 patients and contralateral alignment in 1 patient. TiLoop(®) Bra was used in 78 and corial flap in 79 patients. Response to questionnaires was 70%. TiLoop(®) Bra improved aesthetic results (P=0.049) and prevented implant dislocation (P=0.009). All patients expressed their adherence to the decision for surgery. Patients with SCM expressed their satisfaction even to a higher extent than those with SSM, particulary with regard to symmetry (P=0.018) and scars (P=0.037). QoL after conservative mastectomies is demonstrated as excellent in several validated QoL-instruments. Double-plane technique for coverage of the implant yields good results with autologous corial flaps and Tiloop(®) Bra

  6. Risk-reducing, conservative mastectomy—analysis of surgical outcome and quality of life in 272 implant-based reconstructions using TiLoop® Bra versus autologous corial flaps (United States)

    Strauß, Stefanie; Kimmig, Rainer; Kern, Peter


    Background Different approaches have evolved for conservative mastectomies, mostly according to surgeon’s preference. Patients’ perspective was not always in the primary focus. BRCA status has drawn much attention and therapeutic as well as prophylactic mastectomies are rising. However, knowledge on quality of life (QoL) thereafter is limited. We investigated the surgical and patient reported outcome of conservative mastectomies with implants and TiLoop® Bra vs. corial flaps. Methods Conservative mastectomies were analyzed from a prospectively maintained database in a unicentric study of consecutive 272 reconstructions from 2000-2014. We used four validated QoL questionnaires: FACT-G, EORTC C-30, EORTC B-23 and Breast Cancer Treatment Outcome Scale (BCTOS). The use of TiLoop® Bra, a titanized polypropylene mesh, for lower breast pole coverage was compared to autologous corial flaps. Results A total of 217 patients with 272 conservative mastectomies (55 bilateral) were included. Median follow-up was 3.5 years (range, 0-14 years). Skin-sparing mastectomy (SSM) was performed in 131 patients and subcutaneous mastectomy (SCM) in 86 patients. Invasive breast-cancer was the indication for surgery in 106 patients, non-invasive breast cancer (DCIS) in 80 patients, prophylactic indication (BRCA1/2-mutation) in 30 patients and contralateral alignment in 1 patient. TiLoop® Bra was used in 78 and corial flap in 79 patients. Response to questionnaires was 70%. TiLoop® Bra improved aesthetic results (P=0.049) and prevented implant dislocation (P=0.009). All patients expressed their adherence to the decision for surgery. Patients with SCM expressed their satisfaction even to a higher extent than those with SSM, particulary with regard to symmetry (P=0.018) and scars (P=0.037). Conclusions QoL after conservative mastectomies is demonstrated as excellent in several validated QoL-instruments. Double-plane technique for coverage of the implant yields good results with

  7. Comprehensive review of the duplication 3q syndrome and report of a patient with Currarino syndrome and de novo duplication 3q26.32-q27.2. (United States)

    Dworschak, G C; Crétolle, C; Hilger, A; Engels, H; Korsch, E; Reutter, H; Ludwig, M


    Partial duplications of the long arm of chromosome 3, dup(3q), are a rare but well-described condition, sharing features of Cornelia de Lange syndrome. Around two thirds of cases are derived from unbalanced translocations, whereas pure dup(3q) have rarely been reported. Here, we provide an extensive review of the literature on dup(3q). This search revealed several patients with caudal malformations and anomalies, suggesting that caudal malformations or anomalies represent an inherent phenotypic feature of dup(3q). In this context, we report a patient with a pure de novo duplication 3q26.32-q27.2. The patient had the clinical diagnosis of Currarino syndrome (CS) (characterized by the triad of sacral anomalies, anorectal malformations and a presacral mass) and additional features, frequently detected in patients with a dup(3q). Mutations within the MNX1 gene were found to be causative in CS but no MNX1 mutation could be detected in our patient. Our comprehensive search for candidate genes located in the critical region of the duplication 3q syndrome, 3q26.3-q27, revealed a so far neglected phenotypic overlap of dup(3q) and the Pierpont syndrome, associated with a mutation of the TBL1XR1 gene on 3q26.32. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  8. Reference: 272 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available m L et al. 2005 Oct. Plant J. 44(1):114-27. The specification of epidermal (L1) identity occurs early during...s within the suspensor. Markers for L1 identity, ACR4 and ATML1, are not expressed in homozygous mutant seedlings showed a specific loss of epidermal cell identity within large portions of the cotyledons. In a

  9. 12 CFR 272.4 - Committee actions. (United States)


    ... shall be in writing, by telephone, or electronic means; if the communication is made orally, the Secretary shall cause a written record to be made without delay. An action taken between meetings has the... to make technical corrections, such as spelling, grammar, construction, and organization (including...

  10. 76 FR 272 - Final Flood Elevation Determinations (United States)


    ... Geodetic Vertical Datum. + North American Vertical Datum. Depth in feet above ground. [caret] Mean Sea.... downstream of Cemetery Road. Approximately 980 feet +712 upstream of Cemetery Road. * National Geodetic Vertical Datum. + North American Vertical Datum. Depth in feet above ground. [caret] Mean Sea Level...

  11. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    New capacity and fresh insights are among the goals of the Teasdale-Corti global health program that aims to expand the influence of research over a wide range of health issues. When a group of health... Computers for Schools Kenya at top of the class. Five years after retooling its first recycled computers and finding them ...

  12. 40 CFR 27.2 - Definitions. (United States)


    ... Environmental Protection Agency. Benefit means, in the context of “statement,” anything of value, including but not limited to any advantage, preference, privilege, license, permit, favorable decision, ruling... or statement. Makes, wherever it appears, shall include the terms presents, submits, and causes to be...

  13. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  14. Publications | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fighting the violet vampire. In the fields of sub-Saharan Africa, Alan Watson and McGill University's Weed Research Group are battling devastating parasites — naturally. Something big was happening in these agricultural fields of.

  15. Array CGH characterization of an unbalanced X-autosome translocation associated with Xq27.2-qter deletion, 11q24.3-qter duplication and Xq22.3-q27.1 duplication in a girl with primary amenorrhea and mental retardation. (United States)

    Chen, Chih-Ping; Lin, Shuan-Pei; Chern, Schu-Rern; Kuo, Yu-Ling; Wu, Peih-Shan; Chen, Yu-Ting; Lee, Meng-Shan; Wang, Wayseen


    We present array comparative genomic hybridization (aCGH) characterization of an unbalanced X-autosome translocation with an Xq interstitial segmental duplication in a 16-year-old girl with primary ovarian failure, mental retardation, attention deficit disorder, learning difficulty and facial dysmorphism. aCGH analysis revealed an Xq27.2-q28 deletion, an 11q24.3-q25 duplication, and an inverted duplication of Xq22.3-q27.1. The karyotype was 46,X,der(X)t(X;11)(q27.2;q24.3) dup(X)(q27.1q22.3). We discuss the genotype-phenotype correlation in this case. Our case provides evidence for an association of primary amenorrhea and mental retardation with concomitant unbalanced X-autosome translocation and X chromosome rearrangement. Copyright © 2013 Elsevier B.V. All rights reserved.

  16. Page 1 272 Ethiopian Journal of Environmental Studies ...

    African Journals Online (AJOL)



    Mar 24, 2015 ... The ants. (Solenopsis invicta) in this study are an important finding, these ants are known as important components of ecosystems because they act as ecosystem engineers. (Folgarait, 1998). The significant difference in the mean abundance of ground dwelling arthropods between the Gallery forest and ...

  17. 272--11 Dec 2009 [final version].indd

    African Journals Online (AJOL)


    Dec 11, 2009 ... architect of natural theology, are then juxtaposed against those .... deviates from the sola Scriptura and the sola gratia principles of .... (Paley 2006:4), as, in it, he presents his 'comprehensive design'. Charles Darwin, in reading the work, rediscovered the. 'invisible hand' of natural selection (Altner 2003:24).

  18. 29 CFR 1910.272 - Grain handling facilities. (United States)


    ... pulleys used to increase the coefficient of friction between the pulley and the belt. Permit means the... criteria for the air aspiration would be acceptable to OSHA, provided the prototype test report is...

  19. 7 CFR 2.72 - Chairman, World Agricultural Outlook Board. (United States)


    ... analyses which significantly relate to international and domestic commodity supply and demand, including..., production, imports, domestic utilization, price, income, support programs, carryover, exports, and..., background data and other relevant data regarding the overall economy and market prospects for specific...

  20. 12 CFR 272.2 - Functions of the Committee. (United States)


    ... and domestic and international economic and financial developments, and other pertinent information... Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES OF PROCEDURE... direction of open market operations conducted by the Federal Reserve banks and with respect to certain...

  1. 7 CFR 272.5 - Program informational activities. (United States)


    ... creed, national origin or political belief. (c) Program informational activities for low-income..., application procedures, and benefits of the Food Stamp Program. Program informational materials used in such... the socio-economic and demographic characteristics of the target population, types of media used...

  2. 38 CFR 17.272 - Benefits limitations/exclusions. (United States)


    ...) Radiology, laboratory, and pathological services and machine diagnostic testing not related to a specific... support for cleft palate. (xii) Prosthetic replacement of jaw due to trauma or cancer. (22) Nonsurgical... health supervision visits intended to promote optimal health for infants and children to include the...

  3. Dicty_cDB: VFD272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Translate...IAK YNKALRYLDCCSNIDGLKNVQTICYNNMSQCYLKEKKVPMLW*lqkkh*nyhqmilkhsl eklklyl*wrnmmklskiskks Homology vs CSM-cDNA

  4. 7 CFR 272.10 - ADP/CIS Model Plan. (United States)


    ...) Expiration; (v) Prior to certification, crosscheck for duplicate cases for all household members by means of... and replacement; (2) FNS-250—Reconciliation of redeemed ATPs with reported authorized coupon issuance. (B) Reconciliation: FNS-46—ATP Reconciliation Report. (vii) Generate data necessary to meet other...

  5. 7 CFR 272.1 - General terms and conditions. (United States)


    ... providing translations of the posters and fliers in languages other than Spanish. The State agency shall... those programs; (iii) Persons directly connected with the verification of immigration status of aliens... such organizations and agencies. The language of the request for assistance, the notice to households...

  6. 46 CFR 272.24 - Subsidy repair summaries. (United States)


    ... an Operator in the following manner: This is to certify that, to the best of my knowledge and belief... completed, and the price is fair and reasonable (exceptions are listed on separate page). (c) Categorization... reasonableness of the prices for the submitted work. With respect to any claims for M&R performed outside the...

  7. 50 CFR 216.272 - Permissible methods of taking. (United States)


    ... 155 annually) (B) Pygmy sperm whales (Kogia breviceps)—830 (an average of 166 annually) (C) Dwarf...) Northern right whale dolphin (Lissodelphis borealis)—7935 (an average of 1547 annually) (P) Pacific white...

  8. 7 CFR 272.4 - Program administration and personnel requirements. (United States)


    ... administration of the program shall be permitted access to food coupons, ATP's, or other issuance documents. (b...-language minority; and (iii) In project areas with a certification office that provides bilingual service... being sued because it misapplied Federal policy in administering the Program. (iii) State agencies shall...

  9. Dicty_cDB: VFA272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene, partial cds. 64 2e-09 2 CB832670 |CB832670.1 USDA-FP_100461 Adult Alate Brown Citrus Aphid...1.1 USDA-FP_102714 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-37_E02 5', mRNA seque

  10. 48 CFR 538.272 - MAS price reductions. (United States)


    ... maintain during the contract period the negotiated price/discount relationship (and/or term and condition relationship) between the eligible ordering activities and the offeror's customer or category of customers on... customers) that results in a less advantageous relationship between the eligible ordering activities and...

  11. 7 CFR 272.3 - Operating guidelines and forms. (United States)


    ... Guidelines. Other examples of Operating Guidelines are manuals, instructions, directives or transmittal memos... Application for Food Stamps, and other operating guidelines to implement the provisions of the Food Stamp Act...

  12. 38 CFR 3.272 - Exclusions from income. (United States)


    ... private relief, welfare, or charitable organizations. (Authority: 38 U.S.C. 1503(a)(1)) (b) Maintenance... community institution or facility, public or private, because of impaired health or advanced age, money paid... vocational rehabilitation or training, to include amounts paid for tuition, fees, books, and materials, and...

  13. 38 CFR 21.272 - Veteran-student services. (United States)


    ... by the Chapter 30 rate; (2) Motivation of the veteran; and (3) Compatibility of the work assignment... out under the supervision of a VA employee; (2) Preparation and processing of necessary VA papers and...

  14. 7 CFR 272.2 - Plan of operation. (United States)


    ... program operations and establish objectives. When planning and budgeting for program operations for the... Project shall include that Project's Work Plan in the State Plan of Operation. The Plan's attachments... Act; and to implement the FNS-approved State Plan of Operation. 2. Comply with Title VI of the Civil...

  15. Swedbank Eesti teenis esimeses kvartalis 272 mln krooni kahjumit

    Index Scriptorium Estoniae


    Swedbank Eesti tulud kasvasid I kvartalis võrreldes 2009. a. IV kvartaliga 1%, tegevuskulud vähenesid 15%, klientide hoiused kasvasid kvartali jooksul 2%, probleemseid laene oli 8,8 mld. krooni suuruses summas

  16. 40 CFR 180.272 - Tribuphos; tolerances for residues. (United States)


    ...: Commodity Parts per million Cattle, fat 0.15 Cattle, meat 0.02 Cattle, meat byproducts 0.02 Cotton, gin... byproducts 0.02 Milk 0.01 Sheep, fat 0.15 Sheep, meat 0.02 Sheep, meat byproducts 0.02 (b) Section 18...

  17. All projects related to | Page 272 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    Universities in Innovation for Inclusive Development: Africa. Project. A new research network will explore how African universities can help innovation thrive on the continent. Start Date: February 24, 2012. End Date: August 24, 2015. Topic: HIGHER EDUCATION, KNOWLEDGE, AFRICA SOUTH OF SAHARA, INFORMAL ...

  18. 20 CFR 702.272 - Informal recommendation by district director. (United States)


    ... LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims... any wage loss suffered as the result of the discharge or discrimination. The district director may... of the Chief Administrative Law Judge for hearing pursuant to § 702.317. [42 FR 45302, Sept. 9, 1977] ...

  19. 40 CFR Appendix A to Part 272 - State Requirements (United States)


    ... Michie Company, Law Publishers, 1 Town Hall Square, Charlottesville, Virginia 22906-7587. The regulatory... the Michie Company, Law Publishers: sections 39-5802; 39-5803; 39-5808; 39-5811; 39-5813(1); and 39... Company, Law Publishers, 1 Town Hall Square, Charlottesville, VA 22906-7587. (b) The regulatory provisions...

  20. Dicty_cDB: AFL272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAATGTTCACAGAAA ATGTTTCTAAANATTAGAAAAAA sequence update 2001. 6. 1 Translated Amino Acid sequence y*ttxrf*ly...inctcti nnen*nycttrt*ilcmdwwfnfsftlnfptngiskeeyxnpvhqcsqkmflxirk Frame B: y*ttxrf

  1. 40 CFR 1065.272 - Nondispersive ultraviolet analyzer. (United States)


    ... measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept... high concentrations to interfere with proper operation. (b) Component requirements. We recommend that... other gaseous measurements and the engine's known or assumed fuel properties. The target value for any...

  2. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian


    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py......CSP simulator is able to simulate 220 Monte Carlo simulations in less than 35 seconds in the smallest BPU simulation....

  3. 47 CFR 25.272 - General inter-system coordination procedures. (United States)


    ... network control center which will have the responsibility to monitor space-to-Earth transmissions in its... and with its Columbia Operations Center in Columbia, Maryland, a current listing of the names, titles... earth station operator shall notify the satellite network control center and receive permission from the...

  4. BKR 27(2) pp. 76-84 (Mordi et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... be able to ameliorate CdCl2- induced toxicity (which is dose dependent) and this supports its usage in local treatment as an antidote ..... mechanisms against oxidative stress caused by toxicants, long term exposure to .... chemistry, enzyme working Group of the German society for clinical chemistry. Eur.

  5. : tous les projets | Page 272 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les mégapoles côtières situées dans des basses terres, déjà aux prises avec une croissance démographique rapide et d'autres problèmes d'ordre économique, social, sanitaire et culturel, doivent en outre faire face à la menace que font peser sur elles les changements climatiques. Date de début : 1 mars 2011. End Date: ...

  6. Nuclear Technology. Course 27: Metrology. Module 27-2, Fixed Gages, Dividers, Calipers, and Micrometers. (United States)

    Selleck, Ben; Espy, John

    This second in a series of eight modules for a course titled Metrology dscribes fixed gages, dividers, calipers, vernier and dial calipers, and micrometers. The module follows a typical format that includes the following sections: (l) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student, (5) subject matter, (6)…

  7. Crystal structure of spinach major light-harvesting complex at 2.72Å resolution (United States)

    Liu, Zhenfeng; Yan, Hanchi; Wang, Kebin; Kuang, Tingyun; Zhang, Jiping; Gui, Lulu; An, Xiaomin; Chang, Wenrui


    The major light-harvesting complex of photosystem II (LHC-II) serves as the principal solar energy collector in the photosynthesis of green plants and presumably also functions in photoprotection under high-light conditions. Here we report the first X-ray structure of LHC-II in icosahedral proteoliposome assembly at atomic detail. One asymmetric unit of a large R32 unit cell contains ten LHC-II monomers. The 14 chlorophylls (Chl) in each monomer can be unambiguously distinguished as eight Chla and six Chlb molecules. Assignment of the orientation of the transition dipole moment of each chlorophyll has been achieved. All Chlb are located around the interface between adjacent monomers, and together with Chla they are the basis for efficient light harvesting. Four carotenoid-binding sites per monomer have been observed. The xanthophyll-cycle carotenoid at the monomer-monomer interface may be involved in the non-radiative dissipation of excessive energy, one of the photoprotective strategies that have evolved in plants.

  8. BKR 27(2) pp. 63-67 (Ejike et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... ABSTRACT: The Ejike-Ijeh equations for the estimation of body fat percentage makes it possible for the body fat content of individuals and ... Health Organisation estimated that the prevalence of overweight and obesity ... chronic diseases, ranging from diabetes mellitus to cancers. (Ejike and Ezeanyika ...

  9. 75 FR 15679 - Foreign-Trade Zone 272-Lehigh Valley, Pennsylvania Application for Subzone Grundfos Pumps... (United States)


    ... Valley, Pennsylvania Application for Subzone Grundfos Pumps Manufacturing Corporation (Multi-Stage Centrifugal Pumps); Allentown, PA An application has been submitted to the Foreign-Trade Zones Board (the...-purpose subzone status for the multi-stage centrifugal pump manufacturing facility of Grundfos Pumps...

  10. BKR 27(2) pp. 85-88 (Adekanle et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... several disease states in adult and infants. Reactive oxygen species (ROS) are generated spontaneously in cells during metabolism and are implicated in the aetiology of different degenerative diseases, such as heart diseases, stroke, rheumatoid arthritis, diabetes and cancer (Oloyede and. Afolabi, 2012).

  11. Protein expression of Myt272-3 recombinant clone and in silico ...

    African Journals Online (AJOL)

    . Lane L is a CriterionTM 10-20. % Tris-Tricine protein marker; Lane 1 indicates protein expressed without insert (control); lane 2 shows protein expression at 1mM IPTG where red arrow indicates the expressed his-tag protein. Lane 3 is a non- ...

  12. SU-F-T-272: Patient Specific Quality Assurance of Prostate VMAT Plans with Portal Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Darko, J; Osei, E [Grand River Cancer Centre @ Grand River Hospital, Kitchener, ON (Canada); University of Waterloo, Waterloo, ON (Canada); Kiciak, A [University of Waterloo, Waterloo, ON (Canada); Badu, S; Grigorov, G; Fleck, A [Grand River Cancer Centre @ Grand River Hospital, Kitchener, ON (Canada)


    Purpose: To evaluate the effectiveness of using the Portal Dosimetry (PD) method for patient specific quality assurance of prostate VMAT plans. Methods: As per institutional protocol all VMAT plans were measured using the Varian Portal Dosimetry (PD) method. A gamma evaluation criterion of 3%-3mm with a minimum area gamma pass rate (gamma <1) of 95% is used clinically for all plans. We retrospectively evaluated the portal dosimetry results for 170 prostate patients treated with VMAT technique. Three sets of criterions were adopted for re-evaluating the measurements; 3%-3mm, 2%-2mm and 1%-1mm. For all criterions two areas, Field+1cm and MLC-CIAO were analysed.To ascertain the effectiveness of the portal dosimetry technique in determining the delivery accuracy of prostate VMAT plans, 10 patients previously measured with portal dosimetry, were randomly selected and their measurements repeated using the ArcCHECK method. The same criterion used in the analysis of PD was used for the ArcCHECK measurements. Results: All patient plans reviewed met the institutional criteria for Area Gamma pass rate. Overall, the gamma pass rate (gamma <1) decreases for 3%-3mm, 2%-2mm and 1%-1mm criterion. For each criterion the pass rate was significantly reduced when the MLC-CIAO was used instead of FIELD+1cm. There was noticeable change in sensitivity for MLC-CIAO with 2%-2mm criteria and much more significant reduction at 1%-1mm. Comparable results were obtained for the ArcCHECK measurements. Although differences were observed between the clockwise verses the counter clockwise plans in both the PD and ArcCHECK measurements, this was not deemed to be statistically significant. Conclusion: This work demonstrates that Portal Dosimetry technique can be effectively used for quality assurance of VMAT plans. Results obtained show similar sensitivity compared to ArcCheck. To reveal certain delivery inaccuracies, the use of a combination of criterions may provide an effective way in improving the overall sensitivity of PD. Funding provided in part by the Prostate Ride for Dad, Kitchener-Waterloo, Canada.

  13. 40 CFR 272.1351 - Montana State-Administered Program: Final Authorization. (United States)


    ... Annotated (MCA) 2005, Title 25, “Civil Procedure”: Chapter 20, “Rules of Civil Procedure”, Rule 24(a). (iii) Montana Code Annotated (MCA) 2005, Title 27, “Civil Liability, Remedies, and Limitations”: Chapter 30...

  14. 7 CFR 205.272 - Commingling and contact with prohibited substance prevention practice standard. (United States)


    ...), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM... organically produced agricultural product or ingredient labeled in accordance with subpart D of this part: (1) Packaging materials, and storage containers, or bins that contain a synthetic fungicide, preservative, or...

  15. 34 CFR 272.30 - What criteria does the Secretary use to make a grant? (United States)


    ...; (2) The plan of management ensures proper and efficient administration of the project; (3) The... reviews each application to determine the ability of the applicant to sustain a long-term, high-quality... its organization; (2) Selects project staff with an appropriate mixture of scholarly and practitioner...

  16. BKR 27(2) pp. 106-110 (Mohammed et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... (Nig) Ltd. Lagos, Supplying the following per kg of premix: Vitamin A,. 5000,00 IU; Vitamin D3 800,000IU; Vitamin E, 12,000mg; Vitamin K,. 1,5000mg; Vitamin B1, 1,000mg; Vitamin B2, 2,000mg, Vitamin B6,. 1,500mg; Niacin, 12,000mg; Pantothenic acid, 20.00mg;. Biotin,10.00mg; Vitamin B12, 300.00mg; ...

  17. 7 CFR 272.8 - State income and eligibility verification system. (United States)


    ... NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM REQUIREMENTS FOR..., disability, SSI and related benefits; (iii) The IRS from which unearned income information is available... titles II (Federal Old Age, Survivors, and Disability Insurance Benefits) and XVI (Supplemental Security...

  18. BKR 27(2) pp. 68-75 (Muhammad et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    . The study concluded that, on account of adequate haematocrit and immune statuses, in addition to its hypoglycaemic ability, boiling mucuna seed meal with 5.00 % level of inclusion can be used without any deleterious effect ...

  19. BKR 27(2) pp. 56-62 (Omage et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    Jun 30, 2015 ... (i.e. bicarbonate, calcium, chloride, magnesium, phosphate, potassium, and sodium) in the blood. The effects of extracts (aqueous or ethanol) of Acalypha wilkesiana leaves on serum sodium levels in normal experimental rabbits are as indicated in Table 1. The decrease effect in the serum sodium levels of ...

  20. Automated Laser Ultrasonic Testing (ALUT) of Hybrid Arc Welds for Pipeline Construction, #272 (United States)


    One challenge in developing new gas reserves is the high cost of pipeline construction. Welding costs are a major component of overall construction costs. Industry continues to seek advanced pipeline welding technologies to improve productivity and s...

  1. Sud du Sahara | Page 272 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sud du Sahara. Read more about Decentralization, Local Politics and the Construction of Women's Citizenship (Uganda, Kenya and Tanzania) - Phase I. Langue English. Read more ... Read more about Monitoring Progress Toward the Information Society : Digital Divide Index. Langue English. Read more about Réforme ...

  2. 40 CFR 272.651 - Idaho State-Administered Program: Final Authorization. (United States)


    ..., “Hazardous Waste Management”, published in 2002 by the Michie Company, Law Publishers: sections 39-4404; 39... by the Michie Company, Law Publishers: sections 39-5804; 39-5809; 39-5810; 39-5813(2); 39-5814; 39..., Volume 2, Title 9, Chapter 3, “Public Writings”, published in 1990 by the Michie Company, Law Publishers...

  3. Mutational analysis of Glu272 in elongation factor 1A of E. coli

    DEFF Research Database (Denmark)

    Mansilla, Francisco; Knudsen, Charlotte Rohde; Clark, Brian F. C.


    In our previous work (Mansilla et al. (1997) Protein Eng. 10, 927-934) we showed that Arg7 of Escherichia coli elongation factor Tu (EF1A) plays an essential role in aminoacyl-tRNA (aa-tRNA) binding. Substitution of Arg7 by Ala or Glu lost this activity. We proposed that Arg7 forms a salt bridge...

  4. BKR 27(2) pp. 89-97 (Sunmonu et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    Vol. 27 (no. 2) 89–97. 30 June 2015. Biokemistri. An International Journal of the Nigerian Society for Experimental Biology. Research Article. Effects of Strophanthus hispidus DC. .... Oral treatment of the diabetic rats with specified doses of S hispidus aqueous root extract and glibenclamide was carried out daily for fourteen.

  5. BKR 27(2) pp. 98-105 (Ugbaja et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji


    cholesterol, triglyceride and phospholipid) in different compartments in the organism. These perturbations were reflected in the up-/down-regulation of the levels of these lipids. This suggests that the metabolism of these lipids by their ...

  6. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...... in the cases where we were not able to gain any performance boost by specialization, the added cost, for kernel generation and extra bookkeeping, is minimal. Many of the lessons learned developing and optimizing the Bohrium GPU vector engine has proven to be valuable in a broader perspective, which has made...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF. pp 101-102 Book Review. Fixed Points - From Russia with Love - A Primer of Fixed Point Theory · A K Vijaykumar · More Details Fulltext PDF. pp 102-103 Book Review. The Medusa and the Snail.

  8. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  9. Fulltext PDF

    Indian Academy of Sciences (India)

    64 Fulfilling Mendeleev's Dream. A G Samuelson. 67 Glenn Seaborg 1912-1999. Gregory J Butera. RESEARCH EWS. 91 Nobel Prize in Physiology or Medicine 1999. Utpal Tatu. 95 Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. BO K REV EWS. Fixed Points. From Russia with Love - A Primer of ...

  10. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)


    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  11. Health education as a tool in the prevention of parasitosis - doi:10.5020/18061230.2009.p272

    Directory of Open Access Journals (Sweden)

    Loeste de Arruda Barbosa


    Full Text Available in childhood by means of Health Education actions. Methods: A descriptive study of educational intervention with residents of a neighborhood in the municipality of Crato - CE, in partnership with the Family Health strategy. Fecal samples from children aged 2 to 8 years were collected for analysis by both direct and Holffmann methods and from the results, we directed the educational process for children and their parents on preventive behaviors for infection by intestinal parasites. Results: Regarding to material collection and the analysis of the results, approximately 47% of the containers for collection of feces were delivered, comprising 21 samples and, from this total, 10 children had some type of parasites, the most frequent being: Giardia lamblia, Entamoeba histolytic, Entamoeba coli, Endomilax nana and Ascaris lumbricoides. The educational moment occurred with the participation of 48 persons, among them 16 children. There was medical consultation and prescription of antiparasitic drugs to children, with positive results for some type of parasites. Both children and their parents showed to have understood the message by actively participating in educational activities. Conclusion: The population proved to be aware of the actions taken, and succeeded the educational process carried out in a subject-subject approach and not in a vertical manner, in the search for community empowerment on the issues raised, stressing the importance of a continuous process of health education.

  12. The importance of shared environment in mother-infant attachment security: A behavioral genetic study [IF: 3.272

    NARCIS (Netherlands)

    Bokhorst, C.L.; Bakermans-Kranenburg, M.J.; Fearon, R.M.; van IJzendoorn, M.H.; Fonagy, P.; Schuengel, C.


    In a sample of 157 monozygotic and dizygotic twins, genetic and environmental influences on infant attachment and temperament were quantified. Only unique environmental or error components could explain the variance in disorganized versus organized attachment as assessed in the Ainsworth Strange

  13. 42 CFR 423.272 - Review and negotiation of bid and approval of plans submitted by potential Part D sponsors. (United States)


    ... 42 Public Health 3 2010-10-01 2010-10-01 false Review and negotiation of bid and approval of plans... and negotiation of bid and approval of plans submitted by potential Part D sponsors. (a) Review and negotiation regarding information, terms and conditions. CMS reviews the information filed under § 423.265(c...

  14. SU-E-J-272: Auto-Segmentation of Regions with Differentiating CT Numbers for Treatment Response Assessment

    International Nuclear Information System (INIS)

    Yang, C; Noid, G; Dalah, E; Paulson, E; Li, X; Gilat-Schmidt, T


    Purpose: It has been reported recently that the change of CT number (CTN) during and after radiation therapy (RT) may be used to assess RT response. The purpose of this work is to develop a tool to automatically segment the regions with differentiating CTN and/or with change of CTN in a series of CTs. Methods: A software tool was developed to identify regions with differentiating CTN using K-mean Cluster of CT numbers and to automatically delineate these regions using convex hull enclosing method. Pre- and Post-RT CT, PET, or MRI images acquired for sample lung and pancreatic cancer cases were used to test the software tool. K-mean cluster of CT numbers within the gross tumor volumes (GTVs) delineated based on PET SUV (standard uptake value of fludeoxyglucose) and/or MRI ADC (apparent diffusion coefficient) map was analyzed. The cluster centers with higher value were considered as active tumor volumes (ATV). The convex hull contours enclosing preset clusters were used to delineate these ATVs with color washed displays. The CTN defined ATVs were compared with the SUV- or ADC-defined ATVs. Results: CTN stability of the CT scanner used to acquire the CTs in this work is less than 1.5 Hounsfield Unit (HU) variation annually. K-mean cluster centers in the GTV have difference of ∼20 HU, much larger than variation due to CTN stability, for the lung cancer cases studied. The dice coefficient between the ATVs delineated based on convex hull enclosure of high CTN centers and the PET defined GTVs based on SUV cutoff value of 2.5 was 90(±5)%. Conclusion: A software tool was developed using K-mean cluster and convex hull contour to automatically segment high CTN regions which may not be identifiable using a simple threshold method. These CTN regions were reasonably overlapped with the PET or MRI defined GTVs

  15. Sloshing, fluid-structure interaction and structural response due to shock and impact loads 1994. PVP-Vol. 272

    International Nuclear Information System (INIS)

    Ma, D.C.; Shin, Y.S.; Brochard, D.; Fujita, K.


    This volume is comprised of papers presented in two symposia at the 1994 ASME Pressure Vessels and Piping Conference. These sessions, sponsored by the Fluid-Structure Interaction and Seismic Engineering Technical Committees, provided a forum for the discussion of recent advances in sloshing, fluid-structure interaction, and structural dynamics produced by high energy excitations. The papers presented at the four technical sessions on Sloshing and Fluid-Structure Interaction represent a broad spectrum of fluid-structure systems: sloshing, fluid-structure interaction, and dynamic and seismic response of various fluid-structure systems such as reactor components, liquid storage tanks, submerged structures and piping systems, etc. The paper presented at the session on Structural Dynamics Produced by High-Energy Excitations cover underwater explosion effects on submerged structures, bubble loading phenomena, finite element mesh refinements on failure predictions, penetration and impact problems, and dynamic design of blast containment vessels. Also included are numerical analysis, design, and testing to understand difficult transient response phenomena. Separate abstracts were prepared for 24 papers in this volume

  16. Nocturnum (Plaut., Amph. 272. Cuestión filológica, solución semántica

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández


    Full Text Available Nocturnum is neither an epithet of the god Bacchus, nor of the planet Saturn, nor of any other god of the night, in the Plautine passage we are dealing with; it is simply the epithet of Iubar (= Lucifer. The presence of Vesperugo in the same context does not exclude this reference; both Nocturnus and Vesperugo have the same referent, the planet Venus; but, owing to their different reference and connotation, they are clearly seen as separate by the popular mind mirrored in the comedy.

  17. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels


    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  18. Molecular modeling of human MT2 melatonin receptor: the role of Val204, Leu272 and Tyr298 in ligand binding

    Czech Academy of Sciences Publication Activity Database

    Mazna, Petr; Obšilová, Veronika; Jelínková, Irena; Balík, Aleš; Berka, K.; Sovová, Žofie; Ettrich, Rüdiger; Svoboda, Petr; Obšil, T.; Teisinger, Jan


    Roč. 91, č. 4 (2004), s. 836-842 ISSN 0022-3042 R&D Projects: GA ČR GA309/02/1479; GA ČR GA309/04/0496; GA ČR GA204/03/0714; GA AV ČR IAA5011103; GA AV ČR IAA5011408; GA AV ČR KJB5011308; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5011922; CEZ:MSM 113100001 Keywords : homology modeling * MT2 melatonin receptor * site-directed mutagenesis Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 4.824, year: 2004

  19. 272. Reparación de válvula mitral con anillo semirrígido sorin memo 3D

    Directory of Open Access Journals (Sweden)

    A.M. Barral Varela


    Full Text Available El interés creciente en estos últimos años en las técnicas de reparación mitral ha llevado al desarrollo de distintos anillos de anuloplastia. En este estudio analizamos los resultados en la implantación del anillo Sorin Memo 3D en la reparación de la válvula mitral. Revisamos 27 pacientes sometidos a anuloplastia mitral en los años 2010 y 2011 de carácter electivo, preferente y urgente. Todos los pacientes fueron estudiados mediante ecocardiograma transesofágico preoperatorio para analizar el mecanismo de insuficiencia mitral (clasificación funcional: 7 tipo I, 13 tipo II, 2 tipo IIIa, 4 tipo IIIb y 1 con mecanismo mixto I-II. El ecocardiograma intraoperatorio demostró ausencia de insuficiencia significativa en 24 de los casos (88,9%, 2 pacientes con insuficiencia leve-moderada (7,4% y 1 con insuficiencia moderada (3,7%, decidiéndose en este último recambio valvular mitral. Los datos del ecocardiograma de control previo al alta revalidaron los resultados intraoperatorios. No se registró ningún caso de mortalidad intrahospitalaria. Los buenos resultados obtenidos a corto plazo requieren seguimiento y estudios a más largo plazo y en series más amplias con el fin confirmar la durabilidad de los cambios tras la técnica.

  20. ABC 27-2 General bat activity measured with an ultrasound detector in a fragmented tropical landscape in Los Tuxtlas, Mexico

    Directory of Open Access Journals (Sweden)

    Estrada, A.


    Full Text Available Bat tolerance to neotropical forest fragmentation may be related to ability by bats to use available habitats in the modified environmental matrix. This paper presents data on general bat activity (for three hours starting at dusk measured with an ultrasound detector in a fragmented landscape in the region of Los Tuxtlas, Mexico. Bat activity was measured in continuous forests, forests fragments, forest-pasture edges, forest corridors, linear strips of vegetation, citrus groves, pastures and the vegetation present in local villages. The highest bat activity rates were recorded in the villages, in the forest fragments and in linear strips of vegetation. The lowest activity rates were detected in pasture habitats. Data suggest that native and man-made arboreal vegetation may be important for sustaining bat activity in fragmented landscapes.

  1. The feed forward neural network model for liquid-liquid extraction and separation of cobalt (II) from sodium acetate media using cyanex 272 (United States)

    Sudibyo, Aji, B. B.; Priyanto, S.


    Cobalt is one of the precious ferromagnetic metals, which widely used in the preparation of magnetic, wear-resistant and high-strength alloys. This metal was not found naturally in single metal form but is found as impurities in nickel or copper ore. The extraction process is one of the methods to separate cobalt from its impurities. However, this process needs an expensive organic solution. In practice, changing the composition of chemicals composition in extraction process always affect at a high cost. Therefore, the development of the artificial neural network (ANN) model to model the cobalt extraction process can serve as an important tool for predicting and investigating the optimum production for the cobalt extraction without the need to run the actual experiment. Hence, the development of the ANN model of cobalt extraction model is essential to simulate the process, which can lead to high yields of cobalt production. In this work a selected optimum multiple-input-single-output (MISO) model of feed forward neural network (FFNN) was used to predict the percentage of cobalt extraction. MISO FFNN with 20, 30 and 50 hidden nodes were used to simulate cobalt extraction process. The simulation results achieved was compared with data available in the literature. The results show that MISO FFNN with 50 hidden nodes has the best performance. The optimum result of MISO FFNN then exported to Simulink model in Matlab environment, hence make it easy to use in predicting and investigating for the optimum production of the cobalt extraction.

  2. Multibeam collection for TN272: Multibeam data collected aboard Thomas G. Thompson from 2011-11-05 to 2011-12-17, Honolulu, HI to Apra, Guam (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Prevalence of overweight, obesity and hypertension in adolescents attending an art school. DOI: 10.5007/1980-0037.2011v13n4p272

    Directory of Open Access Journals (Sweden)

    Patricia Torres


    Full Text Available A cross-sectional analytical study involving the population of adolescent students attending the Nigelia Soria Public School and Art Institute (n=213, 24% boys, 76% girls in the two career paths (non-physical: visual arts and music, and physical artistic activities: dance was conducted. Anthropometric variables, blood pressure (systolic, SBP, and diastolic, DBP, and heart rate were measured. A semi-structured questionnaire collecting personal data regarding non-communicable chronic diseases, trauma, menstrual cycle, non-school physical activity, inactivity, and sleep duration was administered. The participation rate was 70%. In boys (age 15.6±1.8 years, the prevalence rates of low weight, eutrophy, overweight, and obesity were 0%, 87.5%, 12.5% and 0%, respectively. In girls (age 15.5±1.7 years, these rates were 1.1%, 86%, 8.6%, and 4.3%. Body mass index was significantly associated with waist circumference and brachial circumference in both genders (p<0.001. In the overweight/obesity group, two students were diagnosed with isolated systolic hypertension (SBP 90th percentile. A eutrophic male student with SBP/DBP 90th percentile was confirmed as borderline by 24-h blood pressure measurement. In the group of overweight/obese girls, two students were identified with isolated SBP 90th percentile, one with isolated DBP 90th percentile, and two with SBP/DBP 90th percentile. The nutritional status of students is satisfactory, with a high proportion of young healthy adolescents of both genders. However, the implementation of this protocol permitted to identify adolescents with high blood pressure, overweight, and obesity. These factors may pose a health risk considering the school activity of these students.

  4. Prevalence of overweight, obesity and hypertension in adolescents attending an art school. DOI: 10.5007/1980-0037.2011v13n4p272

    Directory of Open Access Journals (Sweden)

    Patricia Torres


    Full Text Available A cross-sectional analytical study involving the population of adolescent students attending the Nigelia Soria Public School and Art Institute (n=213, 24% boys, 76% girls in the two career paths (non-physical: visual arts and music, and physical artistic activities: dance was conducted. Anthropometric variables, blood pressure (systolic, SBP, and diastolic, DBP, and heart rate were measured. A semi-structured questionnaire collecting personal data regarding non-communicable chronic diseases, trauma, menstrual cycle, non-school physical activity, inactivity, and sleep duration was administered. The participation rate was 70%. In boys (age 15.6±1.8 years, the prevalence rates of low weight, eutrophy, overweight, and obesity were 0%, 87.5%, 12.5% and 0%, respectively. In girls (age 15.5±1.7 years, these rates were 1.1%, 86%, 8.6%, and 4.3%. Body mass index was significantly associated with waist circumference and brachial circumference in both genders (p<0.001. In the overweight/obesity group, two students were diagnosed with isolated systolic hypertension (SBP 90th percentile. A eutrophic male student with SBP/DBP 90th percentile was confirmed as borderline by 24-h blood pressure measurement. In the group of overweight/obese girls, two students were identified with isolated SBP 90th percentile, one with isolated DBP 90th percentile, and two with SBP/DBP 90th percentile. The nutritional status of students is satisfactory, with a high proportion of young healthy adolescents of both genders. However, the implementation of this protocol permitted to identify adolescents with high blood pressure, overweight, and obesity. These factors may pose a health risk considering the school activity of these students.

  5. Comment on: "Morphotectonic records of neotectonic activity in the vicinity of North Almora Thrust Zone, Central Kumaun Himalaya", by Kothyari et al. 2017, Geomorphology (285), 272-286 (United States)

    Rana, Naresh; Sharma, Shubhra


    The recent paper by Kothyari et al. (2017) suggests that the North Almora Thrust (NAT) and a few subsidiary faults in the central Lesser Himalaya were active during the late Quaternary and Holocene. Considering that in the Indian Summer Monsoon (ISM) dominated and tectonically active central Himalaya, the landscape owes their genesis to a coupling between the tectonics and climate. The present study would have been a good contribution toward improving our understanding on this important topic. Unfortunately, the inferences drawn by the authors are based on inadequate/vague field observations, supported by misquoted references, which reflects their poor understanding of the geomorphic processes. For example, authors implicate tectonics in the landform evolution without providing an argument to negate the role of climate (ISM). In view of this, the above contribution does not add anything substantial in improving our existing knowledge of climate-tectonic interaction in landform evolution. On the contrary, if the above publication is not questioned for its scientific merit, it may create enormous confusion and proliferation of wrong scientific data and inferences.

  6. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.


    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  7. Nathalie Ortar, La Vie en deux. Familles françaises et britanniques face à la mobilité géographique professionnelle, Éditions Petra, 2015, 272 p.


    Verley, Élise


    Les effets sociaux de la « grande mobilité géographique professionnelle », impliquant pour un individu de résider et de travailler dans des lieux distants de plusieurs centaines, voire de milliers de kilomètres, restent encore mal connus en France. Pourtant cette mobilité spatiale, emblématique de nos sociétés modernes, transforme profondément le quotidien des travailleurs mobiles et de leur famille. C’est le grand intérêt de l’ouvrage de Nathalie Otar que de décrire finement la façon dont ce...

  8. Michał Głuszkowski, Socjologia w badaniach dwujęzyczności, Toruń: Wydawnictwo Naukowe Uniwersytetu Mikołaja Kopernika, 2013, 272 ss.

    Directory of Open Access Journals (Sweden)

    Anna Zielińska


    Książka Michała Głuszkowskiego Socjologia w badaniach dwujęzyczności, wydana przez Wydawnictwo Naukowe Uniwersytetu Mikołaja Kopernika w roku 2013 jest pierwszą w Polsce teoretyczną rozprawą omawiającą kierunki i rozwój badań nad dwujęzycznością w językoznawstwie światowym. Autor skoncentrował się na aspektach socjologicznych, dokonując przeglądu literatury światowej pod kątem uwzględniania wpływu czynników pozajęzykowych na strukturę języków funkcjonujących w kontakcie. Książka składa się z trzech głównych rozdziałów (rozdział I: „Teoretyczne podstawy dla wykorzystania teorii socjologicznych w badaniach dwujęzyczności”, rozdział II: „Socjologiczne uzupełnienie teorii kontaktów językowych”, rozdział III: „Teoria a praktyka. Przykłady zastosowania teorii socjologicznych w badaniach nad dwujęzycznością”, wstępu, zakończenia, streszczeń w językach rosyjskim i angielskim oraz bibliografii.

  9. Response: Discussion of 'Morphotectonic records of neotectonic activity in the vicinity of North Almora Thrust Zone, Central Kumaun Himalaya' by Kothyari et al. (2017), Geomorphology (285), 272-286 (United States)

    Kothyari, Girish Ch.; Kandregula, Raj Sunil; Luirei, Khayingshing


    Rana and Sharma (2017) dispute our tectonic interpretation mainly on the basis of what they believe (climate?). However, we welcome their comments, as this gives us a chance to highlight the ambiguity inherent in discriminating the climate-tectonic imprints in morphotectonic records that are prevalent in current research. We should note that the paper published by Kothyari et al. (2017) was reviewed by national/international reviewers. We would like to emphasize the fact that the paper does not rule out the role of climate. However, most importantly, it presents significant features and observations that collection/assemblage points toward the dominant role of tectonics in their shaping, and not solely climate, as postulated by Rana and Sharma (2017). The objective of this paper is to identify tectonic signatures (geomorphology) in a monsoon - dominated, tectonically active terrain like the North Almora Thrust (NAT). These faults are marked by previous workers based on field evidence such as folding and faulting of lithological units; presence of slickensides parallel to the fault; offset of NAT owing to a transverse fault; and offset of drainage, drainage basin analysis, strath terraces, fluviolacustrine terraces, development of scarp, narrow river course, and deeply incised valleys. However, we disagree with the comments raised by Rana and Sharma (2017), because they are highly skewed toward the climate school of thought, and did not perceive the setting as a collection of landforms. Instead, they attempted to view them in isolation. Because these comments are important, we will try to further our research incorporating issues related to isolation of climate and tectonics imprints in the immediate future. We would like to thank Rana and Sharma (2017) for raising some basic questions on our work as this gave us an excellent opportunity to summarize and present the dominance of various processes and related landforms as earlier reported by Kothyari et al. (2017). A point-by-point detailed rebuttal/explanation of their queries is provided below.

  10. A High Performance Backend for Array-Oriented Programming on Next-Generation Processing Units

    DEFF Research Database (Denmark)

    Lund, Simon Andreas Frimann

    are analyzed and experimentally tested. Resulting in the design and implementation of Bohrium a runtime-system for transforming, scheduling and executing array-oriented programs. Multiple interfaces for existing languages such as Python, C++, C#, and F# have been built which utilize the backend. A suite...... and the efficient execution of them on high performance systems. This work investigates the requirements for, and the implementation of, a high performance backend supporting these goals. This involves an outline of the hardware available today, in the near future and how to program it for high performance....... The main challenge is to bridge the gaps between performance, productivity and portability. A declarative high-level array-oriented programming model is explored to achieve this goal and a backend implemented to support it. Different strategies to the backend design and application of optimizations...

  11. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.


    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  12. 75 FR 54528 - Privacy Act of 1974: Implementation of Exemptions United States Citizenship and Immigration... (United States)


    ...: Donald K. Hawkins (202-272-8000), Privacy Officer, U.S. Citizenship and Immigration Services, 20... FURTHER INFORMATION CONTACT: For general questions please contact Donald K. Hawkins (202-272-8000...

  13. Light Curve Solution of the Contact Binary AW UMa

    Directory of Open Access Journals (Sweden)

    J. H. Jeong


    Full Text Available A total of 1088 observations (272 in B,272 in V, 272 in R, and 272 in I were made from January to February in 1995 at Chungbuk National University observatory(CbNUO. We constructed BVRI light curves with our data. The photometric solution of these light curves was obtained by means of the Wilson-Devinney method. Our result was compared with those by previous investigators.

  14. 76 FR 14663 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications... (United States)


    ... Operating Company (BOC) may choose from among three regulatory regimes in its provision of in-region... implementing rules, 47 CFR 272. Under this regime, a BOC and its section 272 affiliate may not jointly own... under arrangements that would permit the creditor to look to the assets of the BOC. The section 272...

  15. Comparative Effect of an Addition of a Surface Term to Woods-Saxon Potential on Thermodynamics of a Nucleon (United States)

    Lütfüoğlu, B. C.


    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schrödinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an α particle confined in Bohrium-270 nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared for both wells. The internal energy and the specific heat capacity increase as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the number of available states. Supported by the Turkish Science and Research Council (TÜBİTAK) and Akdeniz University

  16. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.


    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  17. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)


  19. Comparison of Rapid Malaria Test and Laboratory Microscopy ...

    African Journals Online (AJOL)

    Michael Horsfall

    ABSTRACT: Blood samples collected from 272 volunteers in two communities of Bayelsa State in the Niger. Delta area were investigated for falciparum malaria parasite using the rapid test based on the detection of soluble antigen and laboratory microscopy test. The data showed that out of the 272 samples collected, ...

  20. Idala: An unnamed Function Peptide Vaccine for Tuberculosis ...

    African Journals Online (AJOL)

    Purpose: To evaluate Myt272 protein antigenicity and immunogenicity by trial vaccination in mice and its in silico analysis as a potential peptide vaccine for tuberculosis. Methods: Myt272 gene, which has 100 % identity with Mycobacterium tuberculosis H37Rv unknown function gene Rv3424c, was ligated by genomic ...

  1. Human betacoronavirus 2c EMC/2012-related viruses in bats, Ghana and Europe. (United States)

    Annan, Augustina; Baldwin, Heather J; Corman, Victor Max; Klose, Stefan M; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K V; Lina, Peter H C; Godlevska, Elena V; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian; Drexler, Jan Felix


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats.

  2. Human Betacoronavirus 2c EMC/2012–related Viruses in Bats, Ghana and Europe (United States)

    Annan, Augustina; Baldwin, Heather J.; Corman, Victor Max; Klose, Stefan M.; Owusu, Michael; Nkrumah, Evans Ewald; Badu, Ebenezer Kofi; Anti, Priscilla; Agbenyega, Olivia; Meyer, Benjamin; Oppong, Samuel; Sarkodie, Yaw Adu; Kalko, Elisabeth K.V.; Lina, Peter H.C.; Godlevska, Elena V.; Reusken, Chantal; Seebens, Antje; Gloza-Rausch, Florian; Vallo, Peter; Tschapka, Marco; Drosten, Christian


    We screened fecal specimens of 4,758 bats from Ghana and 272 bats from 4 European countries for betacoronaviruses. Viruses related to the novel human betacoronavirus EMC/2012 were detected in 46 (24.9%) of 185 Nycteris bats and 40 (14.7%) of 272 Pipistrellus bats. Their genetic relatedness indicated EMC/2012 originated from bats. PMID:23622767

  3. Mechanisms and timing of replacement dental lamina regression

    Czech Academy of Sciences Publication Activity Database

    Dosedělová, H.; Dumková, J.; Lesot, H.; Glocová, K.; Hampl, A.; Tucker, A.; Buchtová, Marcela


    Roč. 296, special feature (2013), s. 272-272 ISSN 1932-8486. [International Congress of Vertebrate Morphology /10./. 08.07.2013-12.07.2013, Barcelona] Institutional support: RVO:67985904 Keywords : dental lamina Subject RIV: FF - HEENT, Dentistry

  4. Solar Cogeneration of Electricity and Hot Water at DoD Installations (United States)


    right) Commercial system (272 kWp) operating at the Sonoma Wine Company in Graton, CA...array configured from ground-mounted applications. (right) Commercial system (272 kWp) operating at the Sonoma Wine Company in Graton, CA. Figure 2... deposited in the final cell fabrication step to carry the higher currents generated from concentrated light. - PVT Panels — produced in production

  5. Aptychi from the Berriasian/Valanginian (France and Spain): New stratigraphical and morphological details

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Janssen, N. M. M.; Klein, J.


    Roč. 86, č. 3 (2016), s. 265-272 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Berriasian/Valanginian * Vocontian Basin * Betic Cordillera Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016 default /files/volumes/86_3_265_272.pdf

  6. Genetic and bibliographic information: TRPV2 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available table bowel syndrome (MeSH) Digestive System Diseases (C06) > Gastrointestinal Diseases (C06.405) > Intestinal Diseases... (C06.405.469) > Colonic Diseases (C06.405.469.158) > Colonic Diseases, Functional (C06.405.469.158.272) > Irritable Bowel Syndrome (C06.405.469.158.272.608) 05A0781424 ...

  7. Genetic and bibliographic information: TRPV4 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available table bowel syndrome (MeSH) Digestive System Diseases (C06) > Gastrointestinal Diseases (C06.405) > Intestinal Diseases... (C06.405.469) > Colonic Diseases (C06.405.469.158) > Colonic Diseases, Functional (C06.405.469.158.272) > Irritable Bowel Syndrome (C06.405.469.158.272.608) 05A0781424 ...

  8. 76 FR 33282 - Information Collections Being Submitted for Review and Approval to the Office of Management and... (United States)


    ... the Commission's burden estimates. A Bell Operating Company (BOC) may choose from among three... 1934, as amended and the Commission's implementing rules, 47 CFR 272. Under this regime, a BOC and its... the assets of the BOC. The section 272 affiliate must conduct all transactions with the BOC on an arm...

  9. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  10. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  11. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  12. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  13. Improving the Selection, CLassification and Utilization of Army Enlisted Personnel (United States)


    Stability 112 66.22 118 6.03 272 65.05 7.86 Self - Estem 112 34.77 118 34.04 272 35.12 5.00 Cooperativeness 112 53.33 118 54.60 272 54.19 6.05... self -development, support for the norms and customs of the organization, and perseverance in the face of adversity. Factors vs. a Composite Saying...course, it is by far the most expensive to search. As a consequence, we collected eight archival performance indicators via a self report questionnaire

  14. Is Rorty a linguistic idealist?

    Czech Academy of Sciences Publication Activity Database

    Marvan, Tomáš


    Roč. 21, č. 3 (2011), s. 272-279 ISSN 1210-3055 Institutional research plan: CEZ:AV0Z90090514 Keywords : Rorty * linguistic idealism * internal realism * intrinsic structure of reality * representation Subject RIV: AA - Philosophy ; Religion

  15. Nízkomolekulární inhibitory replikace enterovirů

    Czech Academy of Sciences Publication Activity Database

    Nencka, Radim; Hřebabecký, Hubert; Šála, Michal; Dejmek, Milan


    Roč. 108, č. 4 (2014), s. 326-334 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : enteroviruses * antivirals * inhibitors of virus replication Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  16. Book Review: The BBI Dictionary of English Word Combinations ...

    African Journals Online (AJOL)

    Abstract. Book Title: The BBI Dictionary of English Word Combinations. Book Authors: Morton Benson, Evelyn Benson & Robert Ilson. Revised edition 1997, xl + 386 pp. ISBN 90 272 2167 7 (Eur.) / 1-55619-521-4 (US). Amsterdam: John Benjamins.

  17. 78 FR 28744 - Approval and Promulgation of Implementation Plans; Georgia; State Implementation Plan... (United States)


    ... attained when the annual arithmetic mean concentration, as determined in accordance with 40 CFR part 50... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  18. 76 FR 28393 - Proposed Approval of Air Quality Implementation Plan; Ohio and West Virginia; Determinations of... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR Part 50, appendix N, is less than or... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  19. 75 FR 55725 - Approval and Promulgation of Air Quality Implementation Plans; Indiana; Kentucky; Louisville... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR part 50, Appendix N, is less than or... the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) do not apply because...

  20. 76 FR 56701 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR part 50, Appendix N, is less than or... 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because...

  1. 75 FR 77595 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... secondary PM 2.5 NAAQS are met when the annual arithmetic mean concentration, as determined in accordance... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  2. 77 FR 39659 - Proposed Approval of Air Quality Implementation Plan; Michigan; Determination of Attainment of... (United States)


    ... annual arithmetic mean concentration, as determined in accordance with 40 CFR part 50, appendix N, is... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  3. 76 FR 36326 - Approval and Promulgation of Air Quality Implementation Plans; Virginia; Adoption of the Revised... (United States)


    ... ppb standard to the annual primary standard and change the unit of measurement from annual arithmetic... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  4. 76 FR 41739 - Approval and Promulgation of Air Quality Implementation Plans; West Virginia; Determination of... (United States)


    ... standards are met when the annual arithmetic mean concentration, as determined in accordance with 40 CFR... and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those requirements would be...

  5. 77 FR 1411 - Approval and Promulgation of Air Quality Implementation Plans; District of Columbia, Maryland... (United States)


    ... annual primary and secondary PM 2.5 standards are met when the annual arithmetic mean concentrations, as... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  6. 76 FR 43634 - Approval and Promulgation of Air Quality Implementation Plans; West Virginia and Ohio... (United States)


    ... secondary PM 2.5 standards are met when the annual arithmetic mean concentrations, as determined in... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  7. 78 FR 63878 - Approval and Promulgation of Air Quality Implementation Plans; Virginia; Revised Ambient Air... (United States)


    ..., 2013, EPA revised the NAAQS for PM 2.5 . See 78 FR 3086. The annual arithmetic mean concentration has... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  8. 76 FR 72374 - Approval and Promulgation of Air Quality Implementation Plans; Maryland; Baltimore Nonattainment... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR part 50, appendix N, is less than or... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  9. 76 FR 31900 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... CFR 50.7, the 1997 annual primary and secondary PM 2.5 standards are met when the annual arithmetic... and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those requirements would be...

  10. 76 FR 27290 - Approval and Promulgation of Air Quality Implementation Plans; West Virginia; Kentucky; Ohio... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR part 50, Appendix N, is less than or... and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those requirements would be...

  11. 76 FR 75464 - Approval and Promulgation of Air Quality Implementation Plans; West Virginia and Ohio... (United States)


    ... primary and secondary PM 2.5 standards are met when the annual arithmetic mean concentrations, as... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  12. 76 FR 45424 - Approval and Promulgation of Air Quality Implementation Plans; Pennsylvania; Determinations of... (United States)


    ... primary and secondary PM 2.5 standards are met when the annual arithmetic mean concentration, as... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  13. 76 FR 15892 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... the annual arithmetic mean concentration, as determined in accordance with 40 CFR part 50, Appendix N... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  14. 76 FR 31898 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ..., the 1997 annual primary and secondary PM 2.5 standards are met when the annual arithmetic mean... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  15. 76 FR 32110 - Approval and Promulgation of Air Quality Implementation Plans; Ohio, Kentucky, and Indiana... (United States)


    ... NAAQS are met when the annual arithmetic mean concentration, as determined in accordance with 40 CFR... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  16. 78 FR 30770 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; Air Quality Standards... (United States)


    ...-year average of annual arithmetic mean PM 2.5 concentrations at each monitor in an area, and by... Advancement Act of 1995 (15 U.S.C. 272 note) because application of those requirements would be inconsistent...

  17. 77 FR 33360 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... arithmetic mean concentration, as determined in accordance with 40 CFR part 50, Appendix N, is less than or... and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those requirements would be...

  18. 76 FR 29652 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; Missouri; Saint Louis... (United States)


    ... calculated using the arithmetic mean of three consecutive annual averages, such as 2007-2009 or 2008-2010... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  19. 76 FR 78869 - Approval and Promulgation of Implementation Plans and Designations of areas for Air Quality... (United States)


    ....5 standards are met when the annual arithmetic mean concentration, as determined in accordance with... requirements of section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

  20. 76 FR 15895 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


    ... secondary PM 2.5 NAAQS are met when the annual arithmetic mean concentration, as determined in accordance...(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because...

  1. 76 FR 68378 - Approval and Promulgation of Air Quality Implementation Plans; District of Columbia, Maryland... (United States)


    ... annual arithmetic mean concentrations, as determined in accordance with 40 CFR part 50, appendix N, is... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  2. 78 FR 28747 - Approval and Promulgation of Implementation Plans; North Carolina; State Implementation Plan... (United States)


    ... part 50, the primary and secondary 2006 24-hour PM 2.5 NAAQS are attained when the annual arithmetic... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  3. 78 FR 20001 - Approval and Promulgation of Implementation Plans; Idaho: Sandpoint PM10 (United States)


    ... an annual arithmetic mean. The EPA also promulgated secondary PM 10 standards that were identical to... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

  4. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals |

  • Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals |

  • Modulární laboratorní fluorová linka v ÚOCHB AV ČR

    Czech Academy of Sciences Publication Activity Database

    Valášek, Michal; Šembera, Filip; Janoušek, Zbyněk; Michl, Josef


    Roč. 108, č. 4 (2014), s. 394-397 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : carboranes * fluorine * hydrogen fluoride Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

  • San Antonio Bay 1986-1989 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The effect of salinity on utilization of shallow-water nursery habitats by aquatic fauna was assessed in San Antonio Bay, Texas. Overall, 272 samples were collected...

  • Contribution to the study of external decontamination procedure. Experiments on a new product in the case of radioactive contamination of the teguments

    International Nuclear Information System (INIS)

    Toulet, J.; Tabernat, J.


    General principles of external decontamination with elements of practical organisation in a centre of nuclear studies. Reprint of a paper published in 'Archives des Maladies Professionnelles', Tome 20, n. 3, 1959, p. 272-282

  • Prožitek architektury

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula


    Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage

  • Anabaenopsis morphospecies (Cyanobacteria, Nostocales) from Los Patos shallow lake (Province of Buenos Aires, Argentina).

    Czech Academy of Sciences Publication Activity Database

    Aguilera, A.; Komárek, Jiří; Echenique, R. O.


    Roč. 272, č. 3 (2016), s. 173-183 ISSN 1179-3155 Institutional support: RVO:67985939 Keywords : biodiversity * cyanobacteria l blooms * Argentine Subject RIV: EA - Cell Biology Impact factor: 1.240, year: 2016

  • Review: Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity (2013

    Directory of Open Access Journals (Sweden)

    Tinashe Nyamunda


    Full Text Available Review of the monograph:Sabelo J. Ndlovu-Gatsheni, Empire, Global Coloniality and African Subjectivity, New York and Oxford: Berghahn Books, 2013, ISBN 978-0-85745-951-0, 272 pages

  • Vibrační optická aktivita: Experimentální zázemí a počítačové simulace

    Czech Academy of Sciences Publication Activity Database

    Hudecová, Jana; Bouř, Petr


    Roč. 108, č. 4 (2014), s. 285-292 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : vibrational optical activity * circular dichroism * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

  • Report: Internal Control Weaknesses under EPA Grant Nos. I004802070 and BG96483308, Awarded to the Eastern Band of Cherokee Indians, Cherokee, North Carolina (United States)

    Report #10-4-0001, October 5, 2009. EBCI does not have a conflict of interest and its SF 272s are correct and prepared in compliance with federal requirements, EPA policies, and grant terms and conditions.

  • O použití Einsteinových rovnic v kosmologii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal


    Roč. 60, č. 3 (2015), s. 255-272 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : dark matter * dark energy * Friedmann equation Subject RIV: BA - General Mathematics

  • Význam kapra v rybničním hospodářství

    Czech Academy of Sciences Publication Activity Database

    Matěna, Josef; Flajšhans, Martin


    Roč. 61, č. 6 (2013), s. 272-274 ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour

  • Stabat Mater. Chant gregorien / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric


    Uuest heliplaadist "Stabat Mater. Chant gregorien. Palestrina: Stabat Mater a 8; Pärt: Stabat Mater; Browne: Stabat Mater dolorosa a 6. Fretwork (concort de violes)". Virgin Classics 545 272-2 (CD: 167F)

  • Critical Arts

    African Journals Online (AJOL)

    both formal and informal) in culture and social theory. CRITICAL ARTS aims to challenge and ... Book Review: Brian McNair, An Introduction to Political Communication (3rd edition), London: Routledge, 2003, ISBN 0415307082, 272pp. Phil Joffe ...

  • Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.


    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  • Increased presence of the thermophilic mosquitoes and potential vectors Anopheles hyrcanus (Pallas, 1771) and Culex modestus Ficalbi 1889 in Central Europe’s lower Dyje River basin (South Moravia, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Šebesta, O.; Gelbič, Ivan


    Roč. 51, č. 3 (2015), s. 272-280 ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : Anopheles hyrcanus * Culex modestus * vector Subject RIV: EH - Ecology, Behaviour Impact factor: 0.575, year: 2015

  • Developing Your English Vocabulary: A Systematic New Approach ...

    African Journals Online (AJOL)

    Abstract. Gabriele Stein. Developing Your English Vocabulary: A Systematic New Approach. 2002, VIII + 272 pp. Stauffenburg Linguistik 26. ISBN 3-86057-727-1. Tübingen: Stauffenburg Verlag. Price: €33.

    1. 7 CFR 277.4 - Funding. (United States)


      ... training and assistance pursuant to § 272.4(d)(2) are not allowable. (g) Investigations of authorized... Sections Affected, which appears in the Finding Aids section of the printed volume and on GPO Access. ...

    2. mos114_0402c.tif -- Side scan sonar image from survey effort HMPR-114-2004-02c in the Olympic Coast National Marine Sanctuary. (United States)

      National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in August 2004 onboard the NOAA vessel Tatoosh. An EG&G 272 side scan system was...

    3. Changes to Your Relationships (United States)

      ... It's also common for caregivers to lose sexual desire because of the demands of caregiving, the transition ... 272.3900 Locate a support group in your community Visit our message boards Get resources from our ...

    4. The young and the digital, by S. Craig Watkins [book review


      Melanie E. S. Kohnen


      Review of S. Craig Watkins, The young and the digital: What migration to social-networking sites, games, and anytime, anywhere media means for our future. Boston: Beacon Press, 2009, paperback, $18 (272p) ISBN 978-0807006160.

    5. ‘Vanishing cities’: can urban costs explain deindustrialization?

      Czech Academy of Sciences Publication Activity Database

      Goryunov, Maxim; Kokovin, S.


      Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: RVO:67985998 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016

    6. ‘Vanishing cities’: can urban costs explain deindustrialization?

      Czech Academy of Sciences Publication Activity Database

      Goryunov, Maxim; Kokovin, S.


      Roč. 95, č. 3 (2016), s. 633-651 ISSN 1056-8190 Institutional support: PRVOUK-P23 Keywords : city size * urban hierarchies * agglomeration Subject RIV: AH - Economics Impact factor: 1.272, year: 2016

    7. Recent approaches to the total synthesis of phytoprostanes, isoprostanes and neuroprostanes as important products of lipid oxidative stress and biomarkers of disease

      Czech Academy of Sciences Publication Activity Database

      Jahn, Emanuela; Durand, T.; Galano, J. M.; Jahn, Ullrich


      Roč. 108, č. 4 (2014), s. 301-319 ISSN 0009-2770 Institutional support: RVO:61388963 Keywords : lipids * oxidative stress * phytoprostanes * isoprostanes * neuroprostanes * total synthesis Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    8. Fellowship | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      . (Cantab), FNA, FNASc, FTWAS. Date of birth: 30 September 1925. Specialization: Number Theory and Discrete Geometry Address: 1275, Sector 19B, Chandigarh 160 019, U.T.. Contact: Residence: (0172) 272 4863. Mobile: 94172 24863

    9. Caustic addition system operability test procedure

      International Nuclear Information System (INIS)

      Parazin, R.E.


      This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

    10. (1)H-NMR-based metabolomic analysis of the effect of moderate wine consumption on subjects with cardiovascular risk factors


      Vázquez Fresno, Rosa; Llorach, Rafael; Alcaro, Francesca; Rodríguez Martínez, Miguel Ángel; Vinaixa Crevillent, Maria; Chiva Blanch, Gemma; Estruch Riba, Ramon; Correig Blanchar, Xavier; Andrés Lacueva, Ma. Cristina


      Moderate wine consumption is associated with health-promoting activities. An H-NMR-based metabolomic approach was used to identify urinary metabolomic differences of moderate wine intake in the setting of a prospective, randomized, crossover, and controlled trial. Sixty-one male volunteers with high cardiovascular risk factors followed three dietary interventions (28 days): dealcoholized red wine (RWD) (272mL/day, polyphenol control), alcoholized red wine (RWA) (272mL/day) and gin (GIN) (100m...

    11. Género y pueblos indígenas


      Zimmermann, Tania Regina

      2014-01-01, Ângela; GRAMKOW, Márcia Maria (orgs.) Gênero e Povos Indígenas. Rio de Janeiro, Brasília, Museu do Índio/GIZ/FUNAI, 2012, 272 p. SACCHI, Ângela; GRAMKOW, Márcia Maria (orgs.) Gênero e Povos Indígenas. Rio de Janeiro: Brasília, Museu do Índio/GIZ/FUNAI, 2012, 272 p.  SACCHI, Ângela; GRAMKOW, Márcia Maria (orgs.) Gênero e Povos Indígenas. Rio de Janeiro: Brasília, Museu do Índio/GIZ/FUNAI, 2012, 272 p. 

    12. An essential role of intestinal cell kinase in lung development is linked to the perinatal lethality of human ECO syndrome. (United States)

      Tong, Yixin; Park, So Hyun; Wu, Di; Xu, Wenhao; Guillot, Stacey J; Jin, Li; Li, Xudong; Wang, Yalin; Lin, Chyuan-Sheng; Fu, Zheng


      Human endocrine-cerebro-osteodysplasia (ECO) syndrome, caused by the loss-of-function mutation R272Q in the intestinal cell kinase (ICK) gene, is a neonatal-lethal developmental disorder. To elucidate the molecular basis of ECO syndrome, we constructed an Ick R272Q knock-in mouse model that recapitulates ECO pathological phenotypes. Newborns bearing Ick R272Q homozygous mutations die at birth due to respiratory distress. Ick mutant lungs exhibit not only impaired branching morphogenesis associated with reduced mesenchymal proliferation but also significant airspace deficiency in primitive alveoli concomitant with abnormal interstitial mesenchymal differentiation. ICK dysfunction induces elongated primary cilia and perturbs ciliary Hedgehog signaling and autophagy during lung sacculation. Our study identifies an essential role for ICK in lung development and advances the mechanistic understanding of ECO syndrome. © 2017 Federation of European Biochemical Societies.

    13. Solvent Extraction of Pr and Nd from Chloride Solution by Mixtures of Acidic Extractants and LIX 63

      Energy Technology Data Exchange (ETDEWEB)

      Liu, Yang; Lee, Man Seung [Mokpo National University, Chonnam (Korea, Republic of); Jeon, Ho Seok [Korea Institute of Geoscience and Mineral Resources (KIGAM), Daejon (Korea, Republic of)


      Mixtures of acidic extractants and LIX 63 were employed to improve the extraction efficiency of Pr and Nd from chloride solutions. The effect of the composition of the extractant mixtures has been studied. The order of metal extraction by single acidic extractant was D2EHPA > PC88A > Cyanex 272 > Cyanex 301. The addition of LIX 63 to the acidic extractants resulted in a synergistic effect, and the strength of the effect was the reverse order of that found for extraction by single extractants. Moreover, mixing of saponified Cyanex 272 and LIX 63 enhanced the extraction, while the addition of Alamine 336 to the mixtures of Cyanex 272 and LIX 63 depressed the extraction.

    14. Nonlinear current-voltage characteristics of WO3-x nano-/micro-rods (United States)

      Shen, Zhenguang; Peng, Zhijian; Zhao, Zengying; Fu, Xiuli


      A series of crystalline tungsten oxide nano-/micro-rods with different compositions of WO3, WO2.90, W19O55 (WO2.89) and W18O49 (WO2.72) but identical morphology feature were first prepared. Then, various nanoscaled electrical devices were fabricated from them by micro-fabrication through a focused ion beam technique. Interestingly, the devices from the oxygen-deficient WO3-x display significantly nonlinear current-voltage characteristics. The calculated nonlinear coefficients of the WO2.90, WO2.83, and WO2.72 varistors are 2.52, 3.32 and 4.91, respectively. The breakdown voltage of the WO2.90, WO2.83, and WO2.72 varistors are 1.93, 1.28 and 0.93 V, respectively. Such WO3-x nano-varistors might be promising for low-voltage electrical/electronic devices.

    15. Roles of Breast Cancer Genes in DNA Homologous Recombination and Cellular Sensitivity to Radiation and Anticancer Drugs (United States)


      1.2, Juan Huan 2, Zhiyuan Shen 1,3 ’Dept. of Molecular Genetics and Microbiology, University of New Mexico Health Sciences Center; 915 Camino de Salud ...915 Camino de Salud , NE Albuquerque, NM 87131 Phone: 505-272-4291 FAX: 505-272-6029 Email zshen()salud.unntLedL. Key words: BRCA2, Calcium-binding...Immunoprecipitation and Immunoblotting. Cells were collected, treated with lysis buffer (150mM NaC1, lmM EDTA, 50mM Tris.CI, pH 7.5, 1% NP-40) for 30

    16. Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea


      Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei


      A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE) assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA), H272 and 272Y of the Succinate dehydrogenase iron–sulfur...

    17. Wpływ edukacji zdrowotnej na zachowania zdrowotne dzieci w wieku przedszkolnym w opinii rodziców = Health education influence on health behaviors of preschool children in the opinion of their parents


      Olejniczak, Dominik; Święcka, Wioleta; Skonieczna, Joanna; Dykowska, Grażyna


      Olejniczak Dominik, Święcka Wioleta, Skonieczna Joanna, Dykowska Grażyna. Wpływ edukacji zdrowotnej na zachowania zdrowotne dzieci w wieku przedszkolnym w opinii rodziców = Health education influence on health behaviors of preschool children in the opinion of their parents. Journal of Education, Health and Sport. 2015;5(9):261-272. ISSN 2391-8306. DOI 10.5281/zenodo.30539

    18. Tank farms essential drawing plan

      International Nuclear Information System (INIS)

      Domnoske-Rauch, L.A.


      The purpose of this document is to define criteria for selecting Essential Drawings, Support Drawings, and Controlled Print File (CPF) drawings and documents for facilities that are part of East and West Tank Farms. Also, the drawings and documents that meet the criteria are compiled separate listings. The Essential Drawing list and the Support Drawing list establish a priority for updating technical baseline drawings. The CPF drawings, denoted by an asterisk (*), defined the drawings and documents that Operations is required to maintain per the TWRS Administration Manual. The Routing Boards in Buildings 272-WA and 272-AW are not part of the CPF

    19. Optimization of metals extraction using cyanex series and NaDDC reagents in liquid/supercritical CO{sub 2}

      Energy Technology Data Exchange (ETDEWEB)

      Ko, M. S.; Kim, S. H.; Park, K. H.; Kim, H. D.; Kim, H. W. [Kyunghee Univ., Youngin (Korea, Republic of)


      In this research, extraction of small fraction of radioactive elements from mixed contaminated working dress has been conducted by organic solvent extraction, but use of organic solvents has created secondary wastes. In this study, liquid/supercritical fluid CO{sub 2}, an environmentally friendly solvent, was used to extract five metals(Co, Cu, Pb, Cd, Zn). Using five metals selective ligand Cyanex-272 and NaDDC, the most optimized extraction conditions were founded 20 .deg. C, 100atm and complexed ratio(Cyanex-272: 100mg, NaDDC:5mg). The results suggest the possibility of utilizing supercritical fluid technology for extraction of metals from contaminated working dress.

    20. Multiple Nebular Gas Reservoirs Recorded by Oxygen Isotope Variation in a Spinel-rich CAI in CO3 MIL 090019 (United States)

      Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.


      We conducted NanoSIMS O-isotopic imaging of a primitive spinel-rich CAI spherule (27-2) from the MIL 090019 CO3 chondrite. Inclusions such as 27-2 are proposed to record inner nebula processes during an epoch of rapid solar nebula evolution. Mineralogical and textural analyses suggest that this CAI formed by high temperature reactions, partial melting, and condensation. This CAI exhibits radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting interactions with distinct nebular O-isotopic reservoirs.

    1. Normal indices in Nikishin systems


      Branquinho, A.; Bustamante, J.; Foulquié Moreno, A.; López Lagomasino, G.


      9 pages, no figures.-- MSC1991 code: Primary 42C05. MR#: MR2016675 (2004k:41025) Zbl#: Zbl 1035.41010 We improve the class of indices for which normality takes place in a Nikishin system and apply this in Hermite–Padé approximation of such systems of functions. A.B. thanks support from Grants PRAXIS XXI BCC-22201/99 and INTAS 00-272, J.B. from grant CONACYT 32181-E, A.F.M. from Grants PRAXIS XXI BPD-20396/99 and INTAS 00-272, G.L.L. from Grants PRAXIS XXI BCC-22201/99, BFM 2000-02...

    2. Book review: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics by Alexander Lerch

      DEFF Research Database (Denmark)

      Sturm, Bob L.


      A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00......A critical review of the book: An Introduction to Audio Content Analysis: Applications in Signal Processing and Music Informatics, by Alexander Lerch, October 2012, Wiley-IEEE Press. ISBN: 978-1-118-26682-3, Hardcover, 272 pages, 503 references. List price $125.00...

    3. NCBI nr-aa BLAST: CBRC-TTRU-01-1295 [SEVENS

      Lifescience Database Archive (English)

      Full Text Available CBRC-TTRU-01-1295 ref|ZP_03956008.1| permease [Lactobacillus jensenii JV-V16] ref|Z...P_05556845.1| major facilitator superfamily transporter permease [Lactobacillus jensenii 27-2-CHN] ref|ZP_05...861792.1| major facilitator superfamily transporter permease [Lactobacillus jensenii 115-3-CHN] gb|EEI50653....1| permease [Lactobacillus jensenii JV-V16] gb|EEU21706.1| major facilitator supe...rfamily transporter permease [Lactobacillus jensenii 27-2-CHN] gb|EEX24574.1| major facilitator superfamily

    4. 32 CFR 256.3 - Criteria. (United States)


      ... height standards defined in AFM 86-8, 1 NavFac P-272 and P-80, 1 and TM 5-803-4 1 will be used for... Assistant Secretary of Defense (Installations and Logistics)—ID, Washington, DC 20301. (c) Accident... for the purpose of defining accident potential areas. Class A runways are those restricted to light...

    5. Knowledge of outcome of pregnancy and labour among rural ...

      African Journals Online (AJOL)

      A structured questionnaire was used to collect data on demography, prenatal care, complications of pregnancy and delivery, mode of delivery and outcome of pregnancy. The findings of the study revealed that 40.0% teens mothers reported low birth weight and premature babies; and by caesarean 27.2%. The risk of ...

    6. A retrospective analysis of acute organophosphorus poisoning ...

      African Journals Online (AJOL)

      A retrospective analysis of acute organophosphorus poisoning cases admitted to the tertiary care teaching hospital in South India. ... Young adult males were more commonly involved than females (M:F 2.5:1). The mean age of the patients was 28 years (range 2-72 years, SD ± 14.3 years). Mean time to receive treatment ...

    7. Molecular mobility of poly(vinylidene fluoride) in the anisotropic state

      Czech Academy of Sciences Publication Activity Database

      Dmitriev, I.; Gladchenko, S. V.; Afanasyeva, N. V.; Lavrentyev, V. K.; Bukošek, V.; Baldrian, Josef; Elyashevich, G. K.


      Roč. 50, č. 3 (2008), s. 265-272 ISSN 0965-545X Institutional research plan: CEZ:AV0Z40500505 Keywords : poly(vinylidene fluoride) * orientation * molecular mobility Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.543, year: 2008

    8. Assessing the Impact of Exposure Time and Incapacitation on Longitudinal Trajectories of Criminal Offending. (United States)

      Piquero, Alex; Blumstein, Alfred; Brame, Robert; Haapanen, Rudy; Mulvey, Edward P.; Nagin, Daniel S.


      Examined effect of accounting for exposure (incarceration) time on arrest rate of 272 paroled serious offenders followed through age 33. Analysis without exposure time adjustments suggested that over 92 percent exhibited highest arrest activity in late teens and early 20s. Adjusted for exposure time, about 72 percent showed a decline in arrest…

    9. Redbank and Fancher Creeks, California: General Design Memorandum (United States)


      48.1/ 6.5-8.52/ 4 feet!/ Phytoplankton Analysis Biomass on the surface Dominate genus mg/L 272 Anacystis 104 < 1.5 Anacystis preclude the Government from pursuing any other remedy at law or equity to assure faithful performance pursuant to this agreement. ARTICLE 7

    10. Effective Local Security Forces: Some Ideas for the Counterinsurgent (United States)


      figured that those computerized reports were bullshit anyway . . . Obviously the hamlets weren‘t secure.‖272 U.S. CORDS advisors also faced to the government payroll . Leadership was a problem in some of the SOI units which caused them to sit around and do nothing rather than actively

    11. Metody zápisu nanostruktur rastrovací sondou

      Czech Academy of Sciences Publication Activity Database

      Urbánek, Michal; Krátký, Stanislav; Matějka, Milan; Kolařík, Vladimír; Horáček, Miroslav


      Roč. 108, č. 10 (2014), s. 937-941 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LO1212 Keywords : scanning probe lithography * local anodic oxidation * nanoscratching * atomic force microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.272, year: 2014

    12. Documentos sobre la protesta de los artesanos de Bogotá 1845-1854

      Directory of Open Access Journals (Sweden)

      Carmen Escobar Rodríguez


      Full Text Available Documentos sobre la protesta de los artesanos de Bogotá, 1845-1854. Fondos: Pineda, Vergaray otros. Biblioteca Nacional de Colombia. Transcripción de Carmen Escobar Rodríguez. No. 16-17, 1988-1989, págs. 241-272.

    13. The Role of Individuals in the System of the Culture of a Small Ethnographic Region

      Czech Academy of Sciences Publication Activity Database

      Pospíšilová, Jana


      Roč. 65, č. 2 (2017), s. 255-272 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Local culture * bearer * generational transmission * a chronicler Josef Káňa (1929 - 1994) * the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

    14. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping... (United States)


      ...) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials... Applications Numerical Requirements Guidance Materials Data Quality Wednesday, April 14 Continuation of... Planning SC-214 Requirements Review and Response Planning Thursday, April 15 Document Agreements DO-272...

    15. 47 CFR 69.727 - Regulatory relief. (United States)


      ... customer. (b) Phase II relief. Upon satisfaction of the Phase II triggers specified in §§ 69.709(c) or 69... Pricing Flexibility § 69.727 Regulatory relief. (a) Phase I relief. Upon satisfaction of the Phase I... section 272 of the Communications Act of 1934, as amended, or § 64.1903 of this chapter, the price cap LEC...

    16. 2013 information manager.2013 finalx

      African Journals Online (AJOL)


      Management Pay Off: how Leading. Companies Implement Risk Management”. Financial Times, Prentice Hall. P. 272. Breighner, M. and Payton, W. (2005). “A Risk. Management Philosophy” The Risk and. Insurance Management Manual. Library. Administration & Management Association. Retrieved on 5th. April, 2012 via.

    17. 75 FR 409 - Privacy Act of 1974; United States Citizenship and Immigration Services-010 Asylum Information... (United States)


      ... 1974; United States Citizenship and Immigration Services--010 Asylum Information and Pre-Screening... system of records to the Department of Homeland Security's inventory, entitled Unites States Citizenship... Citizenship and Immigration Services (202-272-1663), 20 Massachusetts Avenue, NW., 3rd Floor, Washington, DC...

    18. Officer Computer Utilization Report (United States)



    19. Correction to Hilton et al. (2004) (United States)

      Hilton, N. Zoe; Harris, Grant T.; Rice, Marnie E.; Lang, Carol; Cormier, Catherine A.; Lines, Kathryn J.


      This paper reports errors in the article "A Brief Actuarial Assessment for the Prediction of Wife Assault Recidivism: The Ontario Domestic Assault Risk Assessment," by N. Zoe Hilton, Grant T. Harris, Marnie E. Rice, Carol Lang, Catherine A. Cormier, and Kathryn J. Lines (Psychological Assessment, 2004, Vol. 16, No. 3, pp. 267-275). On page 272,…

    20. Disclosure of HIV Positive Result to a Sexual Partner among Adult ...

      African Journals Online (AJOL)


      sexual partners. Rates, Barriers & outcomes: A. Review paper. WHO. Geneva, Switzerland; 2004. 6. Waddell EN; Messeri PA: Social support, disclosure & use of Anti Retroviral therapy. AIDS behaviour 2006;. 10:263-272. 7. Serovich Jm; Mosack XE: Reasons for HIV disclosure or non-disclosure to causal sexual partners.

    1. 14 CFR 1260.152 - Financial reporting. (United States)


      ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial reporting. 1260.152 Section 1260... Higher Education, Hospitals, and Other Non-Profit Organizations Reports and Records § 1260.152 Financial reporting. (a) When funds are advanced to recipients, each recipient is required to submit the SF 272...

    2. Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode

      Czech Academy of Sciences Publication Activity Database

      Navrátil, Tomáš; Kopanica, M.; Krista, J.


      Roč. 48, č. 2 (2003), s. 265-272 ISSN 0009-2223 Grant - others:GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003

    3. Antimikrobiální peptidy izolované z hmyzu

      Czech Academy of Sciences Publication Activity Database

      Čeřovský, Václav


      Roč. 108, č. 4 (2014), s. 344-353 ISSN 0009-2770 R&D Projects: GA ČR GA203/08/0536 Institutional support: RVO:61388963 Keywords : antimicrobial peptides * analogues * insect * lucifensin Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    4. Particle velocity generated by rockburst during exploitation of the longwall and its impact on the workings

      Czech Academy of Sciences Publication Activity Database

      Holub, Karel; Rušajová, Jana; Holečko, J.


      Roč. 48, č. 6 (2011), s. 942-949 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : Ostrava-Karviná Coal Basin * rockburst * particle velocity * working damage Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.272, year: 2011

    5. Thermodynamic study of selected monoterpenes II

      Czech Academy of Sciences Publication Activity Database

      Štejfa, V.; Fulem, Michal; Růžička, K.; Červinka, C.


      Roč. 79, Dec (2014), 272-279 ISSN 0021-9614 Institutional support: RVO:68378271 Keywords : monoterpenes * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization and sublimation enthalpy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.679, year: 2014

    6. 75 FR 11153 - Free Flow Power Qualified Hydro 22, LLC; Notice of Preliminary Permit Application Accepted for... (United States)


      ... new 19-foot-high by 272-foot-long concrete gravity dam; (2) a new 220-acre impoundment with a normal water surface elevation of 609 feet mean sea level; (3) an new 54-foot-long by 74-foot-wide powerhouse... Commission, 888 First Street, NE., Washington, DC 20426. For more information on how to submit these types of...

    7. Download this PDF file

      African Journals Online (AJOL)

      The aglycone, 2-hydroxy-4-methoxybenzaldehyde is linked to glucose, which is in turn connected to a xylopranose ... absorption band at 1710 cm-1 and the UV spectrum displayed absorption maxima at 296, 272, 226 and 202 nm. The 13C NMR .... Compound 1 is a novel natural product. It is of particular interest because.

    8. 77 FR 21913 - Approval and Promulgation of State Implementation Plans; Hawaii; Infrastructure Requirements for... (United States)


      ... micrograms per cubic meter ([mu]g/m\\3\\), based on the 3-year average of annual arithmetic mean PM 2.5... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

    9. 78 FR 45866 - Approval and Promulgation of State Implementation Plan Revisions; Infrastructure Requirements for... (United States)


      ... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272... meter) Class I Area PM2.5: Annual arithmetic mean 1 24-hr maximum 2 PM10: Annual arithmetic mean 4 24-hr maximum 8 Sulfur dioxide: Annual arithmetic mean 2 24-hr maximum 5 3-hr maximum 25 Nitrogen dioxide...

    10. 77 FR 35652 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality... (United States)


      ... maximum arithmetic 3-month mean concentration for a 3- year period. See 40 CFR 50.16. On November 22, 2010... at 40 CFR 50.16, the 2008 primary and secondary lead standards are met when the maximum arithmetic 3... Advancement Act of 1995 (15 U.S.C. 272 note) do not apply because it would be inconsistent with applicable law...

    11. 77 FR 23399 - National Emission Standards for Hazardous Air Pollutants From Coal- and Oil-Fired Electric... (United States)


      ... and Advancement Act of 1995 (15 U.S.C. 272) do not apply. The corrections also do not involve special... in accordance with Sec. 63.10010(i). Initial compliance is achieved if the arithmetic average of 30...., flow rate, CO 2 , O 2 , or moisture systems) to calculate the arithmetic average emissions rate in...

    12. 76 FR 77903 - Approval and Promulgation of Implementation Plans and Designation of Areas for Air Quality... (United States)


      ...). The annual arithmetic mean PM 2.5 concentrations for 2007-2010 and the 3-year averages of these values... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    13. 76 FR 80747 - Approval and Promulgation of Implementation Plans; Oregon: New Source Review/Prevention of... (United States)


      ... the 1997 PM 2.5 NAAQS are 15.0 [micro]g/m\\3\\ (annual arithmetic mean concentration) and 65 [micro]g/m... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    14. 76 FR 71452 - Approval and Promulgation of Implementation Plans and Designation of Areas for Air Quality... (United States)


      ... arithmetic mean PM 2.5 concentrations for 2006-2009 and the 3-year averages of these values (i.e., design... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    15. Proceedings of Symposium on Energy Engineering in the 21st Century (SEE 2000). Volume Two (United States)


      CaCl2 Used for Chemical Heat Pumps", Journal of Chemical Engineering of Japan , v29, 858-864 (1996). 2. K. Fujioka, S.Kato and Y.Hirata; "Measurements of...Effective Thermal conductivity of CaCl2 Reactor Beds Used for Driving Chemical Heat Pumps", Journal of Chemical Engineering of Japan , v31, 266-272

    16. STAT1 and STAT3 do not participate in FGF-mediated growth arrest in chondrocytes

      Czech Academy of Sciences Publication Activity Database

      Krejčí, Pavel; Salazar, L.; Goodridge, H.S.; Kashiwada, T.A.; Schibler, M.J.; Jelínková, P.; Thompson, L.M.; Wilcox, W.R.


      Roč. 121, č. 3 (2008), s. 272-281 ISSN 0021-9533 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : FGFR3 * STAT * cartilage Subject RIV: BO - Biophysics Impact factor: 6.247, year: 2008

    17. C S Sundar

      Indian Academy of Sciences (India)

      Home; Journals; Sadhana. C S Sundar. Articles written in Sadhana. Volume 28 Issue 1-2 February-April 2003 pp 263-272. Superconductivity in MgB2 : Phonon modes and influence of carbon doping · A Bharathi Y Hariharan Jemima Balaselvi C S Sundar · More Details Abstract Fulltext PDF. Following a brief overview, ...

    18. South African Journal of Higher Education - Vol 18, No 1 (2004)

      African Journals Online (AJOL)

      Selection for the Science Foundation Programme (University of Natal): the development of a selection instrument · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Grussendorff, M Liebenberg, J Houston, 265-272. ...

    19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Electric and magnetic multipole transitions among low-lying states of doubly ionized vanadium were computed using the multi-configuration Hartree–Fock ... Energy levels were determined up to and including 32(1)4 b 27/2 and computed energies were found to be in good agreement with experiment and other ...

    20. CLOCK 3111 T/C SNP interacts with emotional eating behavior for weight-loss in a Mediterranean population (United States)

      The goals of this research was (1) to analyze the role of emotional eating behavior on weight-loss progression during a 30-week weight-loss program in 1,272 individuals from a large Mediterranean population and (2) to test for interaction between CLOCK 3111 T/C SNP and emotional eating behavior on t...

    1. Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27

      DEFF Research Database (Denmark)

      Adland, Emily; Hill, Matilda; Lavandier, Nora


      The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...

    2. mos116_0501n.tif -- Side scan sonar image from survey effort HMPR-116-2005-01n in the Olympic Coast National Marine Sanctuary. (United States)

      National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar image of the sea floor was mosaiced from data collected in July 2005 onboard the NOAA vessel Tatoosh. An EG&G 272 side scan system was used...

    3. Point-contact properties of cubic YbCu .sub.5./sub. prepared by melt spinning technique

      Czech Academy of Sciences Publication Activity Database

      Reiffers, M.; Idzikowski, B.; Ilkovič, S.; Zorkovská, A.; Šebek, Josef; Müller, K. H.

      272-276, - (2004), s. 209-210 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : heavy-fermion * pont-contact * YbCu 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    4. Sigmund Freud a první aplikace psychoanalýzy na literární dílo

      Czech Academy of Sciences Publication Activity Database

      Švanda, Martin


      Roč. 49, č. 3 (2005), s. 272-279 ISSN 0009-062X R&D Projects: GA AV ČR IAA7025402 Keywords : psychology of literature * author * literary work Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

    5. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

      NARCIS (Netherlands)

      G.B. Ehret (Georg); T. Ferreira (Teresa); D.I. Chasman (Daniel); A.U. Jackson (Anne); E.M. Schmidt (Ellen); T. Johnson (Toby); G. Thorleifsson (Gudmar); J. Luan (Jian'An); L.A. Donnelly (Louise); S. Kanoni (Stavroula); A.K. Petersen; V. Pihur (Vasyl); R.J. Strawbridge (Rona); D. Shungin (Dmitry); Hughes, M.F. (Maria F.); O. Meirelles; M. Kaakinen (Marika); N. Bouatia-Naji (Nabila); K. Kristiansson (Kati); S. Shah (Sonia); M.E. Kleber (Marcus); X. Guo (Xiuqing); L.-P. Lyytikäinen (Leo-Pekka); C. Fava (Cristiano); N. Eriksson (Niclas); I.M. Nolte (Ilja); P.K. Magnusson (Patrik); E. Salfati (Elias); L.S. Rallidis (Loukianos); Theusch, E. (Elizabeth); A.J.P. Smith; L. Folkersen (Lasse); H.E. Witkowska (Ewa); T.H. Pers (Tune); R. Joehanes (Roby); Kim, S.K. (Stuart K.); L. Lataniotis (Lazaros); R. Jansen; A.D. Johnson (Andrew); H. Warren (Helen); Y.J. Kim; Zhao, W. (Wei); Y. Wu (Ying); B. Tayo (Bamidele); M. Bochud (Murielle); D. Absher (Devin); L.S. Adair (Linda); N. Amin (Najaf); D.E. Arking (Dan); T. Axelsson (Tomas); D. Baldassarre (Damiano); B. Balkau (Beverley); S. Bandinelli (Stefania); M.J. Barnes (Michael); I. Barroso (Inês); Bevan, S. (Stephen); J.C. Bis (Joshua); Bjornsdottir, G. (Gyda); M. Boehnke (Michael); E.A. Boerwinkle (Eric); L.L. Bonnycastle (Lori); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan); M.J. Brown (Morris); M. Burnier (Michel); Cabrera, C.P. (Claudia P.); J.C. Chambers (John); Chang, I.-S. (I-Shou); Cheng, C.-Y. (Ching-Yu); P.S. Chines (Peter); Chung, R.-H. (Ren-Hua); F.S. Collins (Francis); Connell, J.M. (John M.); A. Döring (Angela); J. Dallongeville; J. Danesh (John); U. de Faire (Ulf); G. Delgado; A. Dominiczak (Anna); A.S.F. Doney (Alex); F. Drenos (Fotios); T. Edkins (Ted); Eicher, J.D. (John D.); R. Elosua (Roberto); S. Enroth (Stefan); J. Erdmann (Jeanette); P. Eriksson (Per); T. Esko (Tõnu); E. Evangelou (Evangelos); A. Evans (Alun); M. Fall (Magnus); M. Farrall (Martin); J.F. Felix (Janine); J. Ferrieres (Jean); L. Ferrucci (Luigi); M. Fornage (Myriam); T. Forrester (Terrence); N. Franceschini (Nora); O.H. Franco (Oscar); A. Franco-Cereceda (Anders); R.M. Fraser (Ross); S.K. Ganesh (Santhi); Gao, H. (He); K. Gertow (Karl); F. Gianfagna (Francesco); B. Gigante (Bruna); F. Giulianini (Franco); A. Goel (Anuj); A.H. Goodall (Alison); M. Goodarzi (Mark); M. Gorski (Mathias); J. Gräßler (Jürgen); C.J. Groves (Christopher); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); G. Hallmans (Göran); A.L. Hartikainen; Hassinen, M. (Maija); A.S. Havulinna (Aki); C. Hayward (Caroline); S. Hercberg (Serge); K.H. Herzig; A.A. Hicks (Andrew); A. Hingorani (Aroon); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Holmen, J. (Jostein); O.L. Holmen (Oddgeir); J.J. Hottenga (Jouke Jan); P. Howard (Philip); Hsiung, C.A. (Chao A.); S.C. Hunt (Steven); M.K. Ikram (Kamran); T. Illig (Thomas); C. Iribarren (Carlos); Jensen, R.A. (Richard A.); M. Kähönen (Mika); H.M. Kang (Hyun Min); S. Kathiresan (Sekar); J. Keating (John); K.T. Khaw; Y.K. Kim (Yun Kyoung); E. Kim (Eric); M. Kivimaki (Mika); N. Klopp (Norman); Kolovou, G. (Genovefa); P. Komulainen (Pirjo); J.S. Kooner (Jaspal S.); Kosova, G. (Gulum); R.M. Krauss (Ronald); D. Kuh (Diana); Z. Kutalik (Zoltán); J. Kuusisto (Johanna); K. Kvaløy (Kirsti); T.A. Lakka (Timo); N.R. Lee (Nanette); I.T. Lee; W.-J. Lee (Wen-Jane); D. Levy (Daniel); X. Li (Xiaohui); Liang, K.-W. (Kae-Woei); Lin, H. (Honghuang); Lin, L. (Li); J. Lindström (Jaana); S. Lobbens (Stéphane); S. Männistö (Satu); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); F. MacH (François); H.S. Markus (Hugh); E. Marouli (Eirini); M.I. McCarthy (Mark); C.A. McKenzie (Colin); P. Meneton (Pierre); C. Menni (Cristina); A. Metspalu (Andres); Mijatovic, V. (Vladan); L. Moilanen (Leena); M.E. Montasser (May E.); A.D. Morris (Andrew); A.C. Morrison (Alanna); Mulas, A. (Antonella); R. Nagaraja (Ramaiah); N. Narisu (Narisu); K. Nikus (Kjell); C.J. O'Donnell (Christopher); P.F. O'Reilly (Paul); K.K. Ong (Ken); Paccaud, F. (Fred); C. Palmer (Cameron); A. Parsa (Afshin); N.L. Pedersen (Nancy); B.W.J.H. Penninx (Brenda); M. Perola (Markus); A. Peters (Annette); N.R. Poulter (Neil); P.P. Pramstaller (Peter Paul); B.M. Psaty (Bruce); T. Quertermous (Thomas); D.C. Rao (Dabeeru C.); A. Rasheed (Asif); N.W. Rayner (Nigel William); F. Renström (Frida); R. Rettig (Rainer); K.M. Rice (Kenneth); R. Roberts (Robert); L.M. Rose (Lynda); Rossouw, J. (Jacques); N.J. Samani (Nilesh); S. Sanna (Serena); J. Saramies (Jouko); H. Schunkert (Heribert); S. Sebert (Sylvain); Sheu, W.H.-H. (Wayne H.-H.); Shin, Y.-A. (Young-Ah); X. Sim (Xueling); G.D. Smith; A.V. Smith (Albert Vernon); M.X. Sosa (Maria X.); T.D. Spector (Timothy); A. Stancáková (Alena); A. Stanton (Alice); K. Stirrups (Kathy); H.M. Stringham (Heather); Sundstrom, J. (Johan); A.J. Swift (Amy); A.C. Syvänen; Tai, E.-S. (E-Shyong); T. Tanaka (Toshiko); K.V. Tarasov (Kirill); A. Teumer (Alexander); U. Thorsteinsdottir (Unnur); M.D. Tobin (Martin); E. Tremoli (Elena); Uitterlinden, A.G. (Andre G.); M. Uusitupa (Matti); A. Vaez (Ahmad); D. Vaidya (Dhananjay); Van Duijn, C.M. (Cornelia M.); E.P.A. van Iperen (Erik); Vasan, R.S. (Ramachandran S.); G.C. Verwoert (Germaine); J. Virtamo (Jarmo); Vitart, V. (Veronique); B.F. Voight (Benjamin); P. Vollenweider (Peter); Wagner, A. (Aline); Wain, L.V. (Louise V.); N.J. Wareham (Nick); H. Watkins (Hugh); A.B. Weder (Alan); H.J. Westra (Harm-Jan); Wilks, R. (Rainford); T. Wilsgaard (Tom); J.F. Wilson (James F.); Wong, T.Y. (Tien Y.); T.-P. Yang (Tsun-Po); J. Yao (Jiefen); L. Yengo (Loic); W. Zhang (Weihua); J.H. Zhao (Jing Hua); X. Zhu (Xiaofeng); P. Bovet (Pascal); Cooper, R.S. (Richard S.); K.L. Mohlke (Karen); Saleheen, D. (Danish); J.-Y. Lee (Jong-Young); P. Elliott (Paul); L.M. Gierman (Lobke); C.J. Willer (Cristen); L. Franke (Lude); G. Kees Hovingh; K.D. Taylor (Kent); G.V. Dedoussis (George); P. Sever (Peter); A. Wong (Andrew); W.H.L. Kao (Wen); T.L. Assimes (Themistocles); I. Njølstad (Inger); P.E.H. Schwarz (Peter); C. Langenberg (Claudia); H. Snieder (Harold); M. Caulfield (Mark); O. Melander (Olle); M. Laakso (Markku); J. Saltevo (Juha); R. Rauramaa (Rainer); J. Tuomilehto (Jaakko); Ingelsson, E. (Erik); T. Lehtimäki (Terho); K. Hveem (Kristian); W. Palmas (Walter); W. März (Winfried); M. Kumari (Meena); V. Salomaa (Veikko); Y.D. Chen (Y.); Rotter, J.I. (Jerome I.); P. Froguel (Philippe); M.-R. Jarvelin (Marjo-Riitta); E. Lakatta (Edward); K. Kuulasmaa (Kari); P.W. Franks (Paul); A. Hamsten (Anders); H.E. Wichmann (Heinz Erich); C.N.A. Palmer (Colin); Stefansson, K. (Kari); P.M. Ridker (Paul); R.J.F. Loos (Ruth); A. Chakravarti (Aravinda); P. Deloukas (Panagiotis); A.P. Morris (Andrew); C. Newton-Cheh (C.); P. Munroe (Patricia)


      textabstractTo dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We

    6. Fundamental relations of mineral specific magnetic carriers for paleointensity determination

      Czech Academy of Sciences Publication Activity Database

      Kletetschka, Günther; Wieczorek, M. A.


      Roč. 272, November 2017 (2017), s. 44-49 ISSN 0031-9201 Institutional support: RVO:67985831 Keywords : Paleofield determination * TRM * Planetary magnetic anomalies * Néel’s theory of magnetism * Magnetic acquisition * Moon * Mars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Particles and field physics Impact factor: 2.075, year: 2016

    7. Fluorované fosfonáty jako činidla pro zavedení fluorovaných funkčních skupin

      Czech Academy of Sciences Publication Activity Database

      Beier, Petr; Opekar, Stanislav


      Roč. 108, č. 10 (2014), s. 926-936 ISSN 0009-2770 R&D Projects: GA ČR GP203/08/P310 Institutional support: RVO:61388963 Keywords : phosphonate * fluorine * nucleophilic addition Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    8. Sexual function of pregnant women in the third trimester

      African Journals Online (AJOL)

      Nülüfer Erbil


      35th and 36th and higher gestational weeks of preg- nancy were as follows: sexual desire scores, 2.50, 2.77 and 2.40; sexual arousal scores, 2.26, 2.72 and. 1.69; lubrication scores, 2.61, 3.42 and 1.97; orgasm scores, 2.51, ...

    9. Laserový systém pro odměřování reliéfu MIEMS vytvářeného metodou hlubokého reaktivního leptání

      Czech Academy of Sciences Publication Activity Database

      Maňka, Tadeáš; Šerý, Mojmír; Lazar, Josef; Číp, Ondřej; Krátký, Stanislav; Zemánek, Pavel


      Roč. 62, č. 10 (2017), s. 270-272 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : laser interferometry * reactive ion etching * micro electro-mechanical system Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

    10. 76 FR 5078 - Approval and Promulgation of Air Quality Implementation Plans: Tennessee; Approval of Section 110... (United States)


      ... adverse comments on this action during the public comment period. However, EPA is making note of two... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... notes that it will not impose substantial direct costs on tribal governments or preempt tribal law. The...

    11. Study of fecal bacterial diversity in Yunnan snub-nosed monkey ...

      African Journals Online (AJOL)


      probably had some link with human obesity (Ley et al.,. 2006). J272 and J278 had 94 and 93% similarity, respectively, with the uncultured bacteria isolated from ... in the microbiota of R. bieti, it reflects the fecal bacterial diversity of R. bieti to a large extent by the use of fecal analysis based on molecular scatology. Analysis of ...

    12. Chronic congestive heart failure. Description and survival of 190 consecutive patients with a diagnosis of chronic congestive heart failure based on clinical signs and symptoms

      DEFF Research Database (Denmark)

      Madsen, B K; Hansen, J F; Stokholm, K H


      with independent, significant prognostic information, (hazard ratios for death in brackets): ln (natural logarithm) (LVEF) (3.19), NYHA class III+IV (2.72), plasma urea > 7.6 mmol.l-1 (2.22), serum creatinine > 121 mumol.l-1 (2.05), serum sodium

    13. Influence of preparation conditions on superconducting properties of ...

      Indian Academy of Sciences (India)

      Proceedings of IPMM'97 2 451. Kambe S, Guo Y G, Liu H K, Wakahara Y, Maeda H,. Kakimoto K and Yavuz M 1998 Supercond. Sci. Technol. 11. 1061. Matthiesen M M, Graybeal J M, Orlando T P and Vander Sande J B. 1991 IEEE Trans. Magn. 1223 272. Mihalache V, Aldica G, Giusca C and Miu L 2001 J. Supercond.

    14. Solute segregation to ferrite grain boundaries in nodular cast iron: experiment and prediction

      Czech Academy of Sciences Publication Activity Database

      Lejček, Pavel; Konečná, R.; Janovec, J.


      Roč. 40, 3-4 (2008), s. 503-506 ISSN 0142-2421 R&D Projects: GA ČR(CZ) GA202/06/0004 Institutional research plan: CEZ:AV0Z10100521 Keywords : nodular cast iron * concentration heterogeneity * impurity segregation * AES * fracture Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.272, year: 2008

    15. Identification of Candida strains isolated from Tanzanian pregnant ...

      African Journals Online (AJOL)

      Objective: To identify Candida strains isolated from Tanzanian women (13 to 45 years) with vaginal candidiasis. Design: A cross-sectional study. Setting: Antenatal clinic in llala district hospital in Dar es Salaam, Tanzania from March 1998 to December 2000. Results: The identities of the 272 isolates tested with API Candida ...

    16. Attachment Styles as a Predictor of Emotional Intelligence (United States)

      Hamarta, Erdal; Deniz, M. Engin; Saltali, Neslihan


      The purpose of this study is to examine if attachment styles predict emotional intelligence (intrapersonal, interpersonal, adaptability, stress management, and general mood). Participants of the study consisted of 463 (272 females, 191 males) undergraduate students selected randomly from different faculties of Selcuk University. Regression and…

    17. Nanodiamanty - fluorescenční a zobrazovací nanosondy

      Czech Academy of Sciences Publication Activity Database

      Šlegerová, Jitka; Cígler, Petr


      Roč. 108, č. 4 (2014), s. 387-393 ISSN 0009-2770 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027 Institutional support: RVO:61388963 Keywords : nanodiamond * fluorescence * biocompatibility Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    18. An 8.4-Mb 3q26.33-3q28 microdeletion in a patient with blepharophimosis-intellectual disability syndrome and a review of the literature. (United States)

      Õunap, Katrin; Pajusalu, Sander; Zilina, Olga; Reimand, Tiia; Žordania, Riina


      3q26.33-3q27.2 microdeletion can be classified as a clinical entity characterized by intrauterine growth retardation, feeding problems in infancy, short stature, intellectual disability, hypotonia, dysmorphic facial features (medially sparse eyebrows, narrow horizontal palpebral fissures, epicanthal folds, flat nasal bridge and tip, short philtrum, and downturned corners of mouth), and teeth and feet abnormalities.

    19. AcEST: DK955956 [AcEST

      Lifescience Database Archive (English)

      Full Text Available . 30 9.8 sp|Q03211|PEXLP_TOBAC Pistil-specific extensin-like protein OS=N... 30 9.8 sp|Q96JK9|MAML3_HUMAN Master... PVAYPPVMTPSPSPAAEPPIIAPFPSPPANPPLIPR 272 >sp|Q96JK9|MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens G

    20. Efektivita přeměn energie - Možnosti dokonalejší přeměny

      Czech Academy of Sciences Publication Activity Database

      Luxa, Martin; Synáč, J.


      Roč. 92, č. 5 (2013), s. 272-275 ISSN 0042-4544 Institutional support: RVO:61388998 Keywords : steam turbine * long blade * aerodynamic laboratory * CFD * interferometry Subject RIV: BK - Fluid Dynamics

    1. Optimizing the recovery rate of Mycobacterium species from gastric ...

      African Journals Online (AJOL)


      Main outcomes and results: This study analyzed gastric lavages from 408 children suspected of having TB. Recovery of Mycobacterium spp was optimized by the use of the relatively new non- radiometric fully automated BACTEC MGIT 960 which produced a positivity rate of 27.2% against. 17.2% that of L-J media.

    2. Chemistry of New Silicon Containing Polymers Triply Bonded Silicon Intermediates. (United States)


      Nazran, and D. Griller , J. Organometal. Chem., 272, C10 (1984). 10. Dimethylsilylene: Its Optical Absorption Spectrum and Reaction Kinetics, I.S...Alnaimi, W.P. Weber, A.S. Nazran, J.A. Hawaii and D. Griller , J. Am. Chem. Soc., 106, 7267 (1984). 11. Unsaturated Reactive Intermediates in

    3. Untitled

      Indian Academy of Sciences (India)

      4 Geologia pp. 75-84. Melsa J L and Cohn D L 1978 Decision and estimation theory (New York; McGraw-Hill) pp. 272. Merton R K 1985 George Sarton: episodic recollections by an unruly apprentice; Isis 76470-486. Metropolis N, Rosenblueth A, Rosenblueth M, Teller A and Teller E 1953 Equation of state calculations.

    4. Human MT2 melatonin receptor and its melatonin recognition site: a structural model

      Czech Academy of Sciences Publication Activity Database

      Luley, Ladislav; Stockner, T; Sovová, Žofie; Mazna, Petr; Ettrich, Rüdiger; Teisinger, Jan

      Roč.272, č.S1 (2005), s. 222-223 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z60870520 Keywords : melatonin receptor * model * structure Subject RIV: BO - Biophysics

    5. Guidelines for the review of environmental-related legislation ...

      African Journals Online (AJOL)

      The development of legislation for the progressive realisation of the right to access to sufficient food is labelled as an international and national objective. Section 27(2) of the Constitution of the Republic of South Africa, 1996 assigns a compulsory mandate to the South African government to take reasonable legislative and ...

    6. Maturity-onset diabetes of the young with end-stage nephropathy

      DEFF Research Database (Denmark)

      Saudek, Frantisek; Pruhová, Stepánka; Boucek, Peter


      -onset diabetes of the young (MODY). SPK was performed in a 47-year old man who has MODY3 because of a Arg272His mutation in the hepatocyte nuclear factor-1alphagene. He developed overt diabetes mellitus at 19 years and end-stage diabetic nephropathy 26 years thereafter. Before SPK, the patient had measurable...

    7. Fabrication and thermal stability studies of polyamide 66 containing ...

      Indian Academy of Sciences (India)

      During fabrication of FR-PA66, melt polymerization time exhibits more surprising influence on intrinsic viscosity than aqueous solution polymerization time. The LOI value of FR-PA66 with 9 wt% TPO reaches 27.2, and corresponding UL94 rating reaches V-0. Improved thermo-stability of FR-PA66 can be attributed to both ...

    8. Solid Waste Management: Abstracts From the Literature - 1964. (United States)

      Connolly, John A.; Stainback, Sandra E.

      The Solid Waste Disposal Act of 1965 (Public Law 89-272, Title II) and its amending legislation, the Resource Recovery Act of 1970 (Public Law 91-512, Title I), authorize collection, storage, and retrieval of information relevant to all aspects of solid-waste management. As part of this effort, the U.S. Environmental Protection Agency's…

    9. Direct observations of the vacancy and its annealing in germanium

      DEFF Research Database (Denmark)

      Slotte, J.; Kilpeläinen, S.; Tuomisto, F.


      Weakly n-type doped germanium has been irradiated with protons up to a fluence of 3×1014 cm-2 at 35 K and 100 K in a unique experimental setup. Positron annihilation measurements show a defect lifetime component of 272±4 ps at 35 K in in situ positron lifetime measurements after irradiation at 100...


      Czech Academy of Sciences Publication Activity Database

      Čopíková, J.; Wimmer, Zdeněk; Lapčík, O.; Cahlíková, L.; Opletal, L.; Moravcová, J.; Drašar, P.


      Roč. 108, č. 11 (2014), s. 1053-1057 ISSN 0009-2770 Institutional support: RVO:61389030 Keywords : OBJECTIVE EVALUATION * PHENOLIC-COMPOUNDS * TASTE INTENSITIES Subject RIV: GM - Food Processing Impact factor: 0.272, year: 2014

    11. The outcome of Mental Health Care Users admitted under Section ...

      African Journals Online (AJOL)

      diagnosed as having a personality disorder (PD). The diagnosis was unknown in 8.19% (n=58) of MHCU's. Final outcomes. Forty-five, point one percent (n=319) of police referrals to. CHBH were discharged (from the MAW). Of those admitted from the MAW, 38.42% (n=272) were to a psychiatric ward and 14.41% (n=102) to ...

    12. Does smoking increase sick-leaves? Evidence using register data on Swedish workers

      NARCIS (Netherlands)

      Lundborg, N.


      Objective: To examine the effect of smoking on sick leave. Methods: Nationally representative data on 14 272 workers aged 16-65 years from the 1988-91 waves of the Swedish Survey of Living Conditions were used for the analyses. The data are linked to register-based data, on the annual number of

    13. AtMBD6, a methyl CpG binding domain protein, maintains gene ...

      Indian Academy of Sciences (India)


      Jan 13, 2017 ... transcriptional gene expression. FEBS J. 272 2118-2131. Matragkou C, Papachristou H, Karetsou Z, Papadopoulos G, Papa- marcaki T, Vizirianakis IS, Tsiftsoglou AS and Choli-. Papadopoulou T 2009 On the intracellular trafficking of mouse. S5 ribosomal protein from cytoplasm to nucleoli. J. Mol. Biol. 392.

    14. 76 FR 55561 - Special Local Regulations for Marine Events; Temporary Change of Dates for Recurring Marine... (United States)


      ... consist of two groups of 750 swimmers entering Banks Channel at the Blockade Runner Hotel and swimming... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... marine events on the navigable waters of the United States that may have potential for negative impact on...

    15. The genetics of blood pressure regulation and its target organs from association studies in 342,415 individuals

      NARCIS (Netherlands)

      Ehret, Georg B.; Ferreira, Teresa; Chasman, Daniel I.; Jackson, Anne U.; Schmidt, Ellen M.; Johnson, Toby; Thorleifsson, Gudmar; Luan, Jian'an; Donnelly, Louise A.; Kanoni, Stavroula; Petersen, Ann -Kristin; Pihurl, Vasyl; Strawbridge, Rona J.; Shungin, Dmitry; Hughes, Maria F.; Meirelles, Osorio; Kaakinen, Marika; Bouatia-Naji, Nabila; Kristiansson, Kati; Shah, Sonia; Kleber, Marcus E.; Guo, Xiuqing; Lyytikainen, Leo-Pekka; Fava, Cristiano; Eriksson, Nidas; Nolte, Ilja M.; Magnusson, Patrik K.; Salfati, Elias L.; Rallidis, Loukianos S.; Theusch, Elizabeth; Smith, Andrew J. P.; Folkersen, Lasse; Witkowska, Kate; Pers, Tune H.; Joehanes, Roby; Kim, Stuart K.; Lataniotis, Lazaros; Jansen, Rick; Johnson, Andrew D.; Warren, Helen; Kim, Young Jin; Zhao, Wei; Wu, Ying; Tayo, Bamidele O.; Bochud, Murielle; Absher, Devin; Adair, Linda S.; Amin, Najaf; Arkingl, Dan E.; Axelsson, Tomas; Baldassarre, Damian; Balkau, Beverley; Bandinelli, Stefania; Barnes, Michael R.; Barroso, Ines; Bevan, Stephen; Bis, Joshua C.; Bjornsdottir, Gyda; Boehnke, Michael; Boerwinkle, Eric; Bonnycastle, Lori L.; Boomsma, Dorret I.; Bornstein, Stefan R.; Brown, Morris J.; Burnier, Michel; Cabrera, Claudia P.; Chambers, John C.; Chang, I-Shou; Cheng, Ching-Yu; Chines, Peter S.; Chung, Ren-Hua; Collins, Francis S.; Connell, John M.; Doring, Angela; Dallongeville, Jean; Danesh, John; de Faire, Ulf; Delgado, Graciela; Dominiczak, Anna F.; Doney, Alex S. F.; Drenos, Fotios; Edkins, Sarah; Eicher, John D.; Elosua, Roberto; Enroth, Stefan; Erdmann, Jeanette; Eriksson, Per; Esko, Tonu; Evangelou, Evangelos; Evans, Alun; Fai, Tove; Farra, Martin; Felixl, Janine F.; Ferrieres, Jean; Ferrucci, Luigi; Fornage, Myriam; Forrester, Terrence; Franceschinil, Nora; Franco, Oscar H.; Franco-Cereceda, Anders; Fraser, Ross M.; Ganesh, Santhi K.; Gao, He; Gertow, Karl; Gianfagna, Francesco; Gigante, Bruna; Giulianini, Franco; Goe, Anuj; Goodall, Alison H.; Goodarzi, Mark; Gorski, Mathias; Grassler, Jurgen; Groves, Christopher J.; Gudnason, Vilmundur; Gyllensten, Ulf; Hallmans, Goran; Hartikainen, Anna-Liisa; Hassinen, Maija; Havulinna, Aki S.; Hayward, Caroline; Hercberg, Serge; Herzig, Karl-Heinz; Hicks, Andrew A.; Hingorani, Aroon D.; Hirschhorn, Joel N.; Hofmanl, Albert; Holmen, Jostein; Holmen, Oddgeir Lingaas; Hottenga, Jouke-Jan; Howard, Phil; Hsiung, Chao A.; Hunt, Steven C.; Ikram, M. Arfan; Illig, Thomas; Iribarren, Carlos; Jensen, Richard A.; Kahonen, Mika; Kang, Hyun Min; Kathiresan, Sekar; Keating, Brendan J.; Khaw, Kay-Tee; Kim, Yun Kyoung; Kim, Eric; Kivimaki, Mika; Klopp, Norman; Kolovou, Genovefa; Komulainen, Pirjo; Kooner, Jaspal S.; Kosova, Gulum; Krauss, Ronald M.; Kuh, Diana; Kutalik, Zoltan; Kuusisto, Johanna; Kvaloy, Kirsti; Lakka, Timo A.; Lee, Nanette R.; Lee, I-Te; Lee, Wen-Jane; Levy, Daniel; Li, Xiaohui; Liang, Kae-Woei; Lin, Honghuang; Lin, Li; Lindstrom, Jaana; Lobbens, Stephane; Mannisto, Satu; Muller, Gabriele; Muller-Nurasyid, Martina; Mach, Francois; Markus, Hugh S.; Marouli, Eirini; McCarthy, Mark I.; McKenzie, Colin A.; Meneton, Pierre; Menni, Cristina; Metspalu, Andres; Mijatovic, Vladan; Moilanen, Leena; Montasser, May E.; Morris, Andrew D.; Morrison, Alanna C.; Mulas, Antonella; Nagaraja, Ramaiah; Narisu, Narisu; Nikus, Kjell; O'Donnell, Christopher J.; O'Reilly, Paul F.; Ong, Ken K.; Paccaud, Fred; Palmer, Cameron D.; Parsa, Afshin; Pedersen, Nancy L.; Penninx, Brenda W.; Perola, Markus; Peters, Annette; Poulter, Neil; Pramstaller, Peter P.; Psaty, Bruce M.; Quertermous, Thomas; Rao, Dabeeru C.; Rasheed, Asif; Rayner, N. William; Renstrom, Frida; Rettig, Rainer; Rice, Kenneth M.; Roberts, Robert; Rose, Lynda M.; Rossouw, Jacques; Samani, Nilesh J.; Sanna, Serena; Saramies, Jouko; Schunkert, Heribert; Sebert, Sylvain; Sheu, Wayne H-H; Shin, Young-Ah; Sim, Xueling; Smit, Johannes H.; Smith, Albert V.; Sosa, Maria X.; Spector, Tim D.; Stancakova, Alena; Stanton, Alice V.; Stirrups, Kathleen E.; Stringham, Heather M.; Sundstrom, Johan; Swift, Amy J.; Syvanen, Ann-Christine; Tai, E-Shyong; Tanaka, Toshiko; Tarasov, Kirill V.; Teumer, Alexander; Thorsteinsdottir, Unnur; Tobin, Martin D.; Tremoli, Elena; Uitterlinden, Andre G.; Uusitupa, Matti; Vaez, Ahmad; Vaidya, Dhananjay; van Duijn, Cornelia M.; van Iperen, Erik P. A.; Vasan, Ramachandran S.; Verwoert, Germaine C.; Virtamo, Jarmo; Vitart, Veronique; Voight, Benjamin F.; Vollenweider, Peter; Wagner, Aline; Wain, Louise V.; Wareham, Nicholas J.; Watldns, Hugh; Weder, Alan B.; Westra, Harm Jan; Wilks, Rainford; Wilsgaard, Tom; Wilson, James F.; Wong, Tien Y.; Yang, Tsun-Po; Yao, Jie; Yengo, Loic; Zhang, Weihua; Zhao, Jing Hua; Zhu, Xiaofeng; Bovet, Pascal; Cooper, Richard S.; Mohlke, Karen L.; Saleheen, Danish; Lee, Jong-Young; Elliott, Paul; Gierman, Hinco J.; Willer, Cristen J.; Franke, Lude; Hovingh, G. Kees; Taylor, Kent D.; Dedoussis, George; Sever, Peter; Wong, Andrew; Lind, Lars; Assimes, Themistocles L.; Njolstad, Inger; Schwarz, Peter E. H.; Langenberg, Claudia; Snieder, Harold; Caulfield, Mark J.; Melander, E.; Laakso, Markku; Saltevo, Juha; Rauramaa, Rainer; Tuomilehto, Jaakko; Ingelsson, Erik; Lehtimaki, Terho; Hveem, Kristian; Palmas, Walter; Marz, Winfried; Kumar, Meena; Salomaa, Veikko; Chen, Yii-Der I.; Rotter, Jerome I.; Froguel, Philippe; Jarvelin, Marjo-Riitta; Lakatta, Edward G.; Kuulasmaa, Kari; Franks, Paul W.; Hamsten, Anders; Wichmann, H-Erich; Palmer, Colin N. A.; Stefansson, Kari; Ridker, Paul M.; Loos, Ruth J. F.; Chalcravarti, Aravinda; Deloukas, Panos; Morris, Andrew P.; Newton-Cheh, Christopher; Munroe, Patricia B.


      To dissect the genetic architecture of blood pressure and assess effects on target organ damage, we analyzed 128,272 SNPs from targeted and genome-wide arrays in 201,529 individuals of European ancestry, and genotypes from an additional 140,886 individuals were used for validation. We identified 66

    16. Analysis of grain boundaries in an embrittled ancient silver necklace

      Czech Academy of Sciences Publication Activity Database

      Vaníčková, J.; Děd, J.; Bartuška, Pavel; Drahokoupil, Jan; Čerňanský, Marian; Lejček, Pavel


      Roč. 40, 3-4 (2008), s. 454-457 ISSN 0142-2421 Institutional research plan: CEZ:AV0Z10100520 Keywords : silver embrittlement * archaeological artefacts * AES * SEM + EDX * XRD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.272, year: 2008

    17. Results from GRACE/SUSY at one-loop

      Indian Academy of Sciences (India)

      J Fujimoto1 T Ishikawa1 M Jimbo2 T Kaneko3 T Kon3 Y kurihara1 M Kuroda4 Y Shimizu5 Y Yasui2. KEK, Oho, Tsukuba, Ibaraki 305-0801, Japan; Tokyo Management College, Ichikawa, Chiba 272-0001, Japan; Seikei University, Musashino, Tokyo 180-8633, Japan; Meiji Gakuin University, Totsuka, Yokohama 244-8539, ...

    18. Relations of Shyness-Sensitivity and Unsociability with Adjustment in Middle Childhood and Early Adolescence in Suburban Chinese Children (United States)

      Liu, Junsheng; Chen, Xinyin; Zhou, Ying; Li, Dan; Fu, Rui; Coplan, Robert J.


      This study examined how shyness-sensitivity and unsociability were associated with social, school, and psychological adjustment in Chinese children and adolescents. Participants included 564 children (272 boys, M[subscript age] = 9 years) and 462 adolescents (246 boys, M[subscript age] = 13 years) in a suburban region in China. Data were obtained…

    19. On the generalised stretch function

      Czech Academy of Sciences Publication Activity Database

      Kharlamov, Alexander A.; Filip, Petr


      Roč. 21, č. 4 (2012), s. 272-278 ISSN 1022-1344 R&D Projects: GA ČR GA103/09/2066 Institutional research plan: CEZ:AV0Z20600510 Keywords : molecular length * recurrence equations * rubber * strain * stretch functions Subject RIV: BK - Fluid Dynamics Impact factor: 1.606, year: 2012

    20. Cohomology of line bundles on Schubert varieties: The rank two case

      Indian Academy of Sciences (India)

      R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

      Math. 33 (1976) 271–272. [3] Jantzen J C, Representations of algebraic groups, Pure Appl. Math. (Florida: Academic. Press) (1987) vol. 131. [4] Paramasamy K, Thesis, Cohomology of line bundles on Schubert varieties (submitted to the University of Madras) (2004). [5] Sai-Ping Li, Moody R V, Nicolescu M and Patera J, ...

    1. Complement-dependent transport of antigen into B cell follicles

      DEFF Research Database (Denmark)

      Gonzalez, Santiago F.; Lukacs-Kornek, Veronika; Kuligowski, Michael P.


      Since the original proposal by Fearon and Locksley (Fearon and Locksley. 1996. Science 272: 50-53) that the complement system linked innate and adaptive immunity, there has been a rapid expansion of studies on this topic. With the advance of intravital imaging, a number of recent papers revealed ...

    2. The quest for truth, particularly in mechanics

      Czech Academy of Sciences Publication Activity Database

      Okrouhlík, Miloslav


      Roč. 19, č. 4 (2013), s. 253-272 ISSN 1736-6038 Institutional support: RVO:61388998 Keywords : continuum mechanics of solids * finite element analysis * validity of models * definitions of terms Subject RIV: BI - Acoustics

    3. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by ... under age 65 and have younger-onset Alzheimer's. One in 10 people age 65 and older (10 ...

    4. Alzheimer's Disease Facts and Figures

      Medline Plus

      Full Text Available | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by ... a contribution to the nation valued at $230.1 billion. Approximately two-thirds of caregivers are women, ...

    5. Influence of pH, temperature and glucose on biodegradation of 4 ...

      African Journals Online (AJOL)



      Aug 18, 2009 ... biodegradation of 4-aminophenol by a novel bacterial .... observed at 30°C, as compared to 15.6, 36.1 and 25.5% .... toxicity of aniline and aniline derivatives of cyanobacteria. Arch. Microbiol. 130: 272-275. Dean-Ross D, Rahimi M (1995). Toxicity of phenolic compounds to sediment bacteria. Bull. Environ.

    6. Sequence Classification: 892295 [

      Lifescience Database Archive (English)

      Full Text Available Non-TMB TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|33438861|ref|NP_878149.1| Identified by gene-trapping, micro...array-based expression analysis, and genome-wide homology searching; Ymr272w-bp || ...

    7. 75 FR 65985 - Safety Zone: Epic Roasthouse Private Party Firework Display, San Francisco, CA (United States)


      ... the navigable waters of San Francisco Bay 1,000 yards off Epic Roasthouse Restaurant, San Francisco... waters of San Francisco Bay, 1,000 yards off Epic Roasthouse Restaurant, San Francisco, CA. The fireworks... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...

    8. 76 FR 38015 - Safety Zones; July 4th Weekend Fireworks Displays Within the Captain of the Port St. Petersburg... (United States)


      ..., located just offshore of Mar Vista Restaurant in Longboat Key at position 27[deg]26'13'' N, 82[deg]40'45..., located on the Gulf of Mexico just offshore of Sand Bar Restaurant in Anna Maria at position 27[deg]31'35... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use...

    9. Sex Differences in Occupational Choice, Pay, and Worth: A Supply-Side Approach to Understanding the Male-Female Wage Gap. (United States)

      Hollenbeck, John R.; And Others


      Explored utility of adopting supply-side approach to understanding the nature of wage differentials between men and women using job applicants (N=272) as subjects. Results suggested much of the wage gap can be explained by evaluations of outcomes other than pay, and gender-related differences in expectancies, instrumentalities, and valences with…

    10. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil. (United States)

      Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke


      We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

    11. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil


      Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke


      We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

    12. Review of Raffaele Simone and Francesca Masini: Word classes: Nature, typology and representations

      DEFF Research Database (Denmark)

      Shibuya, Yoshikata; Jensen, Kim Ebensgaard


      Review of Raffaele Simone and Francesca Masini (eds.). Word classes: Nature, typology and representations. Current Issues in Linguistic Theory [CILT] 332. Amsterdam/ Philadelphia: John Benjamins Publishing Company, 2014, 293 + vii pp., ISBN: 1978-90-272-4851-0. Hardback and E-book 99.00 EUR / 149...

    13. Anorexigenní neuropeptid CART v regulaci příjmu potravy

      Czech Academy of Sciences Publication Activity Database

      Nagelová, Veronika; Železná, Blanka; Maletínská, Lenka


      Roč. 108, č. 4 (2014), s. 354-357 ISSN 0009-2770 R&D Projects: GA ČR GAP303/10/1368 Institutional support: RVO:61388963 Keywords : CART * cocaine and amphetamine regulated transcript * anorexigenic neuropeptide Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

    14. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

      Czech Academy of Sciences Publication Activity Database

      Vodička, R.; Mantič, V.; Roubíček, Tomáš


      Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.357, year: 2016


      NARCIS (Netherlands)

      Peiretti, Enrico; Ferrara, Daniela C.; Caminiti, Giulia; Mura, Marco; Hughes, John


      To report the frequency of choroidal neovascularization (CNV) in Caucasian patients with chronic central serous chorioretinopathy (CSC). Retrospective consecutive series of 272 eyes (136 patients) who were diagnosed as having chronic CSC based on clinical and multimodal fundus imaging findings and

    16. Prevalence of Neonatal Jaundice on Central Hospital, Warri, Delta ...

      African Journals Online (AJOL)

      Methods: 272 babies (aged 1 – 30 days) the Neonatal Clinic of the Department of Child Health, Central Hospital, Warri, Delta State between June 2009 and June 2010 were examined daily for evidence of jaundice. Those with serum bilirubin ³15mg/100ml were subjected to additional clinical and laboratory investigations to ...

    17. Clinical impact of the use of additional ultrasonography in diagnostic breast imaging.

      NARCIS (Netherlands)

      Vercauteren, L.D.; Kessels, A.G.; Weijden, T.T. van der; Koster, D.; Severens, J.L.; Engelshoven, JM van; Flobbe, K.


      The degree of adherence with evidence-based guidelines for the use of breast ultrasonography was determined in clinical practice of radiologists in six hospitals. Additional ultrasonography was performed in 2,272 (53%) of all 4,257 patients referred for mammography. High adherence rates (mean: 95%)

    18. Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics (United States)

      Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.


      The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

    19. Promotion of Mo/Al2O3 Sulfide Catalyst by Noble Metals in Simultaneous Hydrodesulfurization of Thiophene and Hydrodenitrogenation of Pyridine: A Comparative Study

      Czech Academy of Sciences Publication Activity Database

      Vít, Zdeněk; Cinibulk, Josef; Gulková, Daniela


      Roč. 272, 1-2 (2004), s. 99-107 ISSN 0926-860X R&D Projects: GA AV ČR IAA4072103 Institutional research plan: CEZ:AV0Z4072921 Keywords : Mo catalyst * noble metal * HDS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor : 2.378, year: 2004

    20. The Role of Academic Self-Efficacy as a Mediator Variable between Perceived Academic Climate and Academic Performance (United States)

      Abd-Elmotaleb, Moustafa; Saha, Sudhir K.


      This study examines the mediating influence of academic self-efficacy on the link between perceived academic climate and academic performance among university students. The participants in the study consist of 272 undergraduate students at the University of Assiut, Assiut, Egypt. A scale to measure perceived academic climate, was developed. To…

    1. Magnetic properties of UNi.sub. 2/3./sub. Rh.sub.13./sub. Al single crystal probed by polarized neutron diffraction

      Czech Academy of Sciences Publication Activity Database

      Prokeš, K.; Gukasov, A.; Sechovský, V.; Andreev, Alexander V.

      272-276, - (2004), e67-e69 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : magnetic structure determination * neutron diffraction * fied induced ferromagnetic order * UNi 2/3 Rh 1/3 Al * magnetic frustration Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004



      Edgar L. Feige; Harold W. Watts


      A proposal for maintaining privacy protection in large data bases by the use of partially aggregated data instead of the original individual data. Proper micro aggregation techniques can serve to protect the confidential nature of the individual data with minimumal information loss. Reference:Data base4s, Computers and the Social Sciences, R. Bisco (ed.),Wiley, 1970, pp. 261-272

    3. Rainfall simulation experiments in the Southwestern USA using the Walnut Gulch rainfall simulator (United States)

      The dataset contains hydrological, erosion, vegetation, ground cover, and other supplementary information from 272 rainfall simulation experiments conducted on 23 semi-arid rangeland locations in Arizona and Nevada between 2002 and 2013. On 30% of the plots simulations were conducted up to five time...


      Czech Academy of Sciences Publication Activity Database

      Nováková, Kateřina; Navrátil, Tomáš; Šestáková, Ivana; Mareček, Vladimír; Chýlková, J.


      Roč. 108, č. 3 (2014), s. 219-225 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GAP208/12/1645; GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : lecitine * cholesterol * biological membranes Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

    5. bony injuries in trauma patients diagnosed by radiological ...

      African Journals Online (AJOL)


      Jun 1, 2015 ... diagnosis of Road Traffic Accident or trauma of all aetiologies that presented to the hospital between. January 2005 ... indicate that there were 13,572 road traffic accidents recorded in Ghana in 2011, with 13,272 people ..... 1st Ed. Salt Lake City: WB. Saunders 2002; P12-17. 8. Surgical Care at the District ...

    6. Serum selenium and selenoprotein P status in adult Danes-8-year followup

      DEFF Research Database (Denmark)

      Rasmussen, Lone Banke; Hollenbach, B.; Laurberg, P.


      subjects had filled in a food frequency questionnaire (FFQ) and a questionnaire with information about smoking habits, alcohol consumption and exercise habits. Mean serum selenium level was 98.7+/-19.8microg/L and median selenoprotein P level was 2.72 (2.18-3.49)mg/L. Serum selenium and selenoprotein P...

    7. Increasing selectivity of a heterogeneous ion-exchange membrane

      Czech Academy of Sciences Publication Activity Database

      Křivčík, J.; Neděla, D.; Hadrava, J.; Brožová, Libuše


      Roč. 56, č. 12 (2015), s. 3160-3166 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : ion-exchange membrane * selectivity * permselectivity Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015

    8. 75 FR 51392 - New York: Incorporation by Reference of State Hazardous Waste Management Program (United States)


      ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 272 [EPA-R02-RCRA-2010-0249; FRL-9178-8] New York: Incorporation by Reference of State Hazardous Waste Management Program Correction In rule document 2010-18927 beginning on page 45489 in the issue of Tuesday, August 3, 2010, make the following correction: Appendix A...

    9. 41 CFR 101-27.207-3 - Marking material to show extended shelf life. (United States)


      ... extended shelf life. 101-27.207-3 Section 101-27.207-3 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-3 Marking material to show extended shelf life. When the shelf-life period of Type II material (except for critical end-use items as...

    10. 41 CFR 101-27.209 - Utilization and distribution of shelf-life items. (United States)


      ... distribution of shelf-life items. 101-27.209 Section 101-27.209 Public Contracts and Property Management... PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.209 Utilization and distribution of shelf-life items. Where it is determined that specified quantities of both Type I and Type II...

    11. 41 CFR 101-27.206 - Procurement of shelf-life materials. (United States)


      ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Procurement of shelf-life materials. 101-27.206 Section 101-27.206 Public Contracts and Property Management Federal Property... MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.206 Procurement of shelf-life materials. ...

    12. Phase behaviour of Maya crude oil based on calorimetry and rheometry

      Czech Academy of Sciences Publication Activity Database

      Fulem, Michal; Becerra, M.; Hasan, M.D.A.; Zhao, B.; Shaw, J.M.


      Roč. 272, č. 1-2 (2008), s. 32-41 ISSN 0378-3812 Institutional research plan: CEZ:AV0Z10100521 Keywords : phase behaviour * phase diagram * Maya crude oil * calorimetry * rheometry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.699, year: 2008

    13. Stability of Language and Literacy Profiles of Children with Language Impairment in the Public Schools (United States)

      Tambyraja, Sherine R.; Schmitt, Mary Beth; Farquharson, Kelly; Justice, Laura M.


      Purpose: The present study focused on the identification and stability of language and literacy profiles of primary school children receiving school-based language therapy over the course of one academic year. Method: Participants included 272 early elementary school-age children (144 boys, 128 girls) who had been clinically identified as having a…

    14. The presence of Echinococcus multilocularis in the red fox (vulpes vulpes) in the Netherlands

      NARCIS (Netherlands)

      Giessen JWB van der; Rombout Y; Limper L; Veen,A van der; Moolenbeek C; Franchimont H; Homan W; MGB


      Studies were undertaken to investigate the presence of Echinococcus multilocularis in foxes in the Netherlands from 1996 to 1998. Firstly, 272 foxes were tested that were shot close to the border with Germany and Belgium, areas that were considered to be of high risk. This study resulted in the

    15. The influence of activation of heterogeneous ion-exchange membranes on their electrochemical properties

      Czech Academy of Sciences Publication Activity Database

      Brožová, Libuše; Křivčík, J.; Neděla, D.; Kysela, V.; Žitka, Jan


      Roč. 56, č. 12 (2015), s. 3228-3232 ISSN 1944-3994. [International Conference on Membrane and Electromembrane Processes - MELPRO 2014. Prague, 18.05.2014-21.05.2014] Institutional support: RVO:61389013 Keywords : heterogeneous ion-exchange membranes * electrochemical properties * activation Subject RIV: JP - Industrial Processing Impact factor: 1.272, year: 2015

    16. Browse Title Index - African Journals Online

      African Journals Online (AJOL)

      ... 7 (2016), Protein expression of Myt272-3 recombinant clone and in silico prediction of a possible vaccine candidate against Mycobacterium tuberculosis, Abstract PDF .... Vol 17, No 1 (2018), Regulation of MicroRNA-378 expression in mature human adipose tissue cells by adiponectin, free fatty acids and dexamethasone ...

    17. Sun Exposure and Reduced Risk of Multiple Sclerosis

      Directory of Open Access Journals (Sweden)

      J Gordon Millichap


      Full Text Available The association between red hair color (RHC melanocortin 1 receptor genotype, past environmental sun exposure, and risk of multiple sclerosis (MS was investigated in a population-based case-control study in Tasmania, Australia, involving 136 cases with MS and 272 controls.

    18. In vitro Studies of Sandfly Fever Viruses and Their Potential Significance for Vaccine Development. (United States)


      parainfluenza ) or on two separate glycoproteins (Sindbis). As shown in Table 4, three of the GP-2 specific monoclones exhibited HI acti- vities without...Replica- tion by Zinc Ions. Virol. 72: 272-277. 18. Portelle, D., C. Bruck, M. Mammerickx, and A. Burny. 1980. In Animals Infected by Bovine Leukemia

    19. Elektrochemická oxidace přírodních barviv používaných na uměleckých památkách

      Czech Academy of Sciences Publication Activity Database

      Ramešová, Šárka; Sokolová, Romana


      Roč. 108, č. 5 (2014), s. 507-512 ISSN 0009-2770 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR M200401201 Program:M Institutional support: RVO:61388955 Keywords : flavonoids * spectroelectrochemistry * oxidation Subject RIV: CG - Electrochemistry Impact factor: 0.272, year: 2014

    20. Book Review: Evolutionary Ecology of Birds: Life Histories, Mating ...

      African Journals Online (AJOL)

      Abstract. Book Title: Evolutionary Ecology of Birds: Life Histories, Mating Systems and Extinction. Book Authors: P.M. Bennett & I.P.F. Owens. Oxford University. Press. 2002. Pp. 272. Price £24.95 (paperback). ISBN 0 19 851089 6.

    1. Evaluation of the causes and cost impact of returned intravenous ...

      African Journals Online (AJOL)

      significant financial burden on the pharmacy's budget, not only because of the ... The study was approved by the Institutional. Review Board (IRB) of ..... Coma A, Modamio P, Lastra C, Bouvy M, Mariño E. Returned medicines in community pharmacies of. Barcelona, Spain. Pharm World Sci 2008; 30: 272-277. 10. Ibrahim SZ ...

    2. 75 FR 35124 - New York State Department of Transportation (NYSDOT); Environmental Impact Statement: Monroe... (United States)


      ...; 1530 Jefferson Road, Rochester, New York 14623, Telephone: (585) 272-3310. SUPPLEMENTARY INFORMATION... could provide for the existing and projected traffic demand and to address highway safety. During the scoping phase of the project however, the results of traffic studies and accident analysis indicated that...

    3. Influence of stress on the permeability of coal and sedimentary rocks of the Upper Silesian Basin

      Czech Academy of Sciences Publication Activity Database

      Konečný, Pavel; Kožušníková, Alena


      Roč. 48, č. 2 (2011), s. 347-352 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : permeability * triaxial test * coal and sedimentary rocks Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 1.272, year: 2011

    4. Sadhana | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Sadhana. C L Bauer. Articles written in Sadhana. Volume 33 Issue 3 June 2008 pp 261-272. The extrinsic influence of carbon fibre reinforced plastic laminates to strengthen steel structures · A K Patnaik C L Bauer T S Srivatsan · More Details Abstract Fulltext PDF. The intrinsic advantages of strengthening ...

    5. 75 FR 28509 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution... (United States)


      ... enforce an emissions standard for new nonroad engines without first having received a waiver as required... could also result in significant co-benefits by reducing emissions of green house gases. For these... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    6. Příkop středověkého opevnění města Plzně. Archeologický a environmentální výzkum v prostoru zaniklé Pražské brány

      Czech Academy of Sciences Publication Activity Database

      Široký, R.; Kočár, P.; Hlaváč, Jaroslav; Kaštovská, K.; Kostrouch, F.; Kyncl, J.; Militký, J.; Pokorný, Petr; Postránecká, K.; Schneiderwinklová, P.


      Roč. 5, - (2008), s. 272-311 ISSN 1803-1749. [Forum urbes medii aevi /5./. Hainburg, 08.05.2006-11.05.2006] Institutional research plan: CEZ:AV0Z80020508; CEZ:AV0Z30130516 Keywords : archaeobotany * bioarchaeology * urban deposits Subject RIV: AC - Archeology, Anthropology, Ethnology

    7. Book Review | Winberg | Critical Studies in Teaching and Learning

      African Journals Online (AJOL)

      Higgins, J. 2013. Academic freedom in a democratic South Africa: essays and interviews on higher education and the humanities. Johannesburg: Wits University Press. ISBN 978-1-86814-751-9 (print), 272 pp. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

    8. Operant behavior can be triggered by the position of the rat relative to objects rotating on an inaccessible platform

      Czech Academy of Sciences Publication Activity Database

      Pašťálková, Eva; Kelemen, Edo; Bureš, Jan


      Roč. 100, č. 4 (2003), s. 2094-2099 ISSN 0027-8424 R&D Projects: GA ČR GA309/00/1656 Institutional research plan: CEZ:AV0Z5011922 Keywords : trigger operant behavior Subject RIV: FH - Neurology Impact factor: 10.272, year: 2003

    9. Dysmorphic features and developmental outcome of 2-year-old children

      NARCIS (Netherlands)

      Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; Van den Heuvel, Edwin R.; Hadders-Algra, Mijna


      AimThe aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. MethodIn our cross-sectional study, 272

    10. Dysmorphic features and developmental outcome of 2-year-old children

      NARCIS (Netherlands)

      Seggers, Jorien; Haadsma, Maaike L.; Bos, Arend F.; Heineman, Maas Jan; Middelburg, Karin J.; van den Heuvel, Edwin R.; Hadders-Algra, Mijna


      The aim of this study was to assess the associations between dysmorphic features and neurological, mental, psychomotor, and behavioural development in order to improve our understanding of aetiological pathways leading to minor developmental problems. In our cross-sectional study, 272 generally

    11. Fulltext PDF

      Indian Academy of Sciences (India)

      BOOK REVIEW. 277. Co-discoverer. Vidyanand Nanjundiah. Face to Face. Biology as an Inte- grating Natural Sci- ence Domain: A Pro- posal for BSc (Hons) in Integrated Biology. K Muralidhar. 261. 272. 283. Of Mechanisms, Microscopes and Methyl iso- cyanate. S Sriramachari talks to Sujata Varadarajan. 292. Erratum.

    12. Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal

      Czech Academy of Sciences Publication Activity Database

      Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin


      Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012

    13. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

      Czech Academy of Sciences Publication Activity Database

      Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta


      Roč. 69, č. 4 (2004), s. 267-272 ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak-point pressure Subject RIV: FK - Gynaecology, Childbirth

    14. Burnout and health of primary school educators in the North West ...

      African Journals Online (AJOL)

      Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

    15. Quantifying Dispersal of European Culicoides (Diptera: Ceratopogonidae) Vectors between Farms Using a Novel Mark-Release-Recapture Technique

      DEFF Research Database (Denmark)

      Kirkeby, Carsten; Bødker, Rene; Stockmarr, Anders


      specimens of the Obsoletus group on a cattle farm in Denmark. An estimated 9,090 (8,918–9,260) Obsoletus group specimens and 14,272 (14,194–14,448) Pulicaris group specimens were captured in the surroundings and subsequently analysed. Two (0.3%) Obsoletus group specimens and 28 (4.6%) Pulicaris group...

    16. Use of Information and Communication Technologies among ...

      African Journals Online (AJOL)

      ... had formal education including HND (35.8%), OND (33.3%) and secondary school certificate (27.2%). Most of the extension agents had an annual income of N100,000-N300,000, with N376,984 as mean. They were aware and had access to radio, television, telephone, DVD, video, camera, computer, satellite and printer.

    17. 76 FR 57691 - Approval and Promulgation of Implementation Plans; New Jersey; Motor Vehicle Enhanced Inspection... (United States)


      ... Acceleration Simulation Mode (ASM5015) and 2500 Revolutions per Minute (RPM) tests. The TSI test is a tailpipe... CIFs, which New Jersey considered to likely be very conservative in light of the program and technology... requirements of Section 12(d) of the National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272...

    18. Processing-improved properties and morphology of PP/COC blends

      Czech Academy of Sciences Publication Activity Database

      Vacková, Taťana; Šlouf, Miroslav; Nevoralová, Martina; Kaprálková, Ludmila


      Roč. 122, č. 2 (2011), s. 1168-1175 ISSN 0021-8995 R&D Projects: GA ČR GP106/09/P272 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blend * phase morphology * fiber Subject RIV: JI - Composite Materials Impact factor: 1.289, year: 2011

    19. Journal of Genetics | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Volume 88, Issue 3. December 2009, pages 267-391. pp 267-272 Research Article ... pp 273-279 Research Article. Evaluation of RAPD-PCR and protein profile analysis to .... More Details Fulltext PDF. pp 345-348 Research Note. Genetic variation in colchicine-treated regenerated plants of Eucalyptus globulus Labill.

    20. Dinesh

      Indian Academy of Sciences (India)

      Home; Journals; Bulletin of Materials Science. Dinesh. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 267-272 Superconductors. Specific heat studies in Ho–Ba–CuO superconductors: Fermionic and bosonic contributions · Dinesh Varshney Sanjay Shah R K Singh · More Details Abstract ...

    1. Multiple chronic conditions and life expectancy

      DEFF Research Database (Denmark)

      DuGoff, Eva H; Canudas-Romo, Vladimir; Buttorff, Christine


      study using single-decrement period life tables. SUBJECTS: Medicare fee-for-service beneficiaries (N=1,372,272) aged 67 and older as of January 1, 2008. MEASURES: Our primary outcome measure is life expectancy. We categorize study subjects by sex, race, selected chronic conditions (heart disease, cancer...

    2. Word Frequencies in Written and Spoken English

      African Journals Online (AJOL)

      R.B. Ruthven

      Gabriele Stein. Developing Your English Vocabulary: A Systematic New. Approach. 2002, VIII + 272 pp. ... objective of this book is twofold: to compile a lexical core and to maximise the skills of language students by ... chapter 3, she offers twelve major ways of expanding this core-word list and differentiating lexical items to ...

    3. Self-Oriented Perfectionism and Self-Assessment as Predictors of Adolescents? Subjective Well-Being (United States)

      Çelik, Eyüp


      The aim of the present study is to examine whether subjective well-being is predicted by self-oriented perfectionism and self-assessment. The self-oriented perfectionism scale, self-assessment scale and subjective well-being scale (SWB) were administrated to a sample of voluntary 272 eight-grade students from three secondary schools in Sultangazi,…

    4. Journal of Genetics | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Journal of Genetics. P. V. Ramchander. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma.

    5. 78 FR 58470 - General Technical, Organizational, and Conforming Amendments to the Federal Motor Carrier Safety... (United States)


      ... Intercept and Obstruct Terrorism (USA PATRIOT) Act of 2001 (Pub. L. 107-56, 115 Stat. 272, Oct. 26, 2001... to ``Sec. 375.103.'' The definition for the term ``household goods motor carrier'' is located in Sec... definition for ``Conviction,'' the closed quotation mark following the word ``probated'' is removed to...

    6. The Problems That the Classroom Teachers Working in Villages and County Towns Confront in Educational Inspection and Their Opinions Concerning the Effect of These Problems on Their Performance (United States)

      Erdem, Ali Riza; Yaprak, Meral


      The purpose of this research is to establish that the problems of education supervision of the class teachers working in the village and township centre in Denizli and their opinions about these problems affect their performance. 321 class teachers working in official primary schools in townships of Denizli and 272 class teachers working in…

    7. A new species of the Oligocene pomfret fish Paucaichthys (Perciformes; Bramidae) from Iran

      Czech Academy of Sciences Publication Activity Database

      Přikryl, Tomáš; Bannikov, A. F.


      Roč. 272, č. 3 (2014), s. 325-330 ISSN 0077-7749 R&D Projects: GA ČR GP13-19250P Institutional support: RVO:67985831 Keywords : Bramidae * Iran * Oligocene * Paucaichthys elamensis sp. nov. * Perciformes * Teleostei Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.519, year: 2014

    8. Surgical camps: the Ugandan experience

      African Journals Online (AJOL)

      Northern Uganda to offer free surgical services and to teach basic surgical skills to up-country doctors. The team, consisting of 10 surgeons in various specialities, two anaesthetists and two surgical residents, saw 500 patients, of whom 272 had surgery. This was the frrst such surgical camp organised by the Ugandan.

    9. Characterization of gene expression regulated by human OTK18 ...

      Indian Academy of Sciences (India)

      Fearon D. T. and Locksley R. M. 1996 The instructive role of innate immunity in the acquired immune response. Science 272, 50–53. Goldman M. J., Anderson G. M., Stolzenberg E. D., Kari U. P., Za- slof M. and Wilson J. M. 1997 Human beta-defensin-1 is a salt- sensitive antibiotic in lung that is inactivated in cystic fibrosis.

    10. Assessing the Psychological Changes of Gifted Students Attending a Residential High School with an Outcome Measurement (United States)

      Rollins, Marlon R.; Cross, Tracy L.


      This study examined the psychological changes that 272 students experienced while attending a residential school for gifted adolescents in the Midwest. This article shares the quantitative portion of a mixed-methods study. Outcome measurement data from the Youth Outcome Questionnaire Self-Report 2.0 (YOQ-SR) tracked students' level of…

    11. Life and Times of Bourbaki C S Yogananda The author of the book ...

      Indian Academy of Sciences (India)

      IAS Admin

      High Stakes Publishing, London. Price: `1475/-, Pages: 272, 2007. The author of the book under review, Amir. Aczel, presents a thesis about the relation ... ited knowledge of the fields of Art / Linguis- tics / Anthropology (and Mathematics), pri- marily read the book for the story of the. Bourbaki phenomenon and the stories ...

    12. Download this PDF file

      African Journals Online (AJOL)


      Aug 3, 2004 ... obtained from Pioneer Oil (former Okitipupa Oil confectioneries and the bakery trade, in the Palm Plc., Ondo State, Nigeria). The samples were preparation of ice cream and manufacture of toilet stored in the kilner jar at laboratory temperature of soaps, soap powders and detergents. The oil is also 27+2 °C ...

    13. Production and characterization of β-glucosidase from Gongronella ...

      African Journals Online (AJOL)

      sunny t


      Apr 20, 2016 ... Enzimas em Biotecnologia: Produção, Aplicações e Mercado. Rio de Janeiro: Interciência, pp. 241-272. Borges DG, Baraldo-Junior A, Farinas CS, Giordano RLC, Tardioli PW. (2014). Enhanced saccharification of sugarcane bagasse using soluble cellulase supplemented with immobilized b-glucosidase.

    14. The Teaching of Leadership on UK MBA Programmes. A Critical Analysis from an International Perspective. (United States)

      Mellahi, Kamel


      A survey of 272 Asian, African, and Arab master of business administration graduates from British business schools showed that schools had an ethnocentric approach to leadership teaching. Possible causes were lack of alternative theories, lack of non-U.S. research, and a low level of faculty expertise and interest in international dimensions of…

    15. Lee y trabaja: Libro de actividades, 2 (Read and Work: Workbook 2). (United States)

      Martinez, Emiliano; And Others

      This workbook, designed to be used with the textbook of the same title (FL 004 272), contains exercises, riddles, puzzles, coloring activities, and reinforcement of various word-perception skills and sentences. Included is a step-by-step procedure of phonetic analysis. The intention of the workbook is to enable students to increase their ability…

    16. The efficient physiological strategy of a tomato landrace in response to short-term salinity stress

      Czech Academy of Sciences Publication Activity Database

      Moles, T. M.; Pompeiano, Antonio; Reyes, T. H.; Scartazza, A.; Guglielminetti, L.


      Roč. 109, dec (2016), s. 262-272 ISSN 0981-9428 Institutional support: RVO:67179843 Keywords : Salt tolerance * Tomato landrace * Chlorophyll a fluorescence * Gas exchange * Soluble sugars * Antioxidants Subject RIV: EH - Ecology, Behaviour Impact factor: 2.724, year: 2016

    17. Female reproductive anatonlY and developnlent of ovarian follicles ...

      African Journals Online (AJOL)

      Rhinolophidae). J. Linn. Soc. Zool. 40: 143-161. BRAMBELL, ·F.W.G. 1928. The development and morphology of the gonads of the mouse. Part III. The growth of the follicles. Proc. R. Soc. B 103: 258-272. CARTER, D.C. 1970. Chiropteran reproduction. In: About bats. A chiropteran biology symposium. (eds) Slaughter, B.H. ...

    18. Protective double-layer coatings prepared by plasma enhanced chemical vapor deposition on tool steel

      Czech Academy of Sciences Publication Activity Database

      Muresan, M.; Charvátová Campbell, A.; Ondračka, P.; Buršíková, V.; Peřina, Vratislav; Polcar, T.; Reuter, S.; Hammer, M. U.; Valtr, M.; Zajíčková, L.


      Roč. 272, JUN (2015), s. 229-238 ISSN 0257-8972 R&D Projects: GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : PECVD * DLC * amorphous carbon * hardness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.139, year: 2015

    19. Substrate Temperature Effects on Splat Formation, Microstructure Development and Properties of Sprayed Coatings, Part I:Case Study for Partially Stabilized Zirconia

      Czech Academy of Sciences Publication Activity Database

      Sampath, S.; Jiang, X.; Matějíček, Jiří; Leger, A. C.; Vardelle, A.


      Roč. 272, č. 1 (1999), s. 181-188 ISSN 0921-5093 Grant - others:GA NSF DMR(US) 9632570 Institutional research plan: CEZ:AV0Z2043910 Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.943, year: 1999

    20. 75 FR 26673 - Clethodim; Pesticide Tolerances (United States)


      ... genotoxic. The data demonstrate no reproductive effect in rats and no developmental effects in rabbits. No... fetal weights and increased incidence of reduced ossification were seen in the fetuses at the maternal... Technology Transfer and Advancement Act of 1995 (NTTAA), Public Law 104-113, section 12(d) (15 U.S.C. 272...

    1. 78 FR 67918 - Nondiscrimination on the Basis of Disability in Air Travel; Accessibility of Aircraft and Stowage... (United States)


      ... net present value of the benefits of the rule over 20 years, at a 7% discount rate, will amount to $242 million to $272 million. Present value (millions) Total Quantified Benefits.... 20 years, 7% $243... present value over the next 20 years. This cost estimate represents the use of a worst-case approach that...

    2. The Prevalence of Ecto and Endoparasites in Pigs in Urban and Peri ...

      African Journals Online (AJOL)

      nematodes (11.7%) Entomoeba ssp (27.2%), Ascaris suum (1.8%) Balntidium coli (3.8%) and Coccidia spp (3.3%) and the only ectoparasites found was sarcoptic mange (1.4%). In the peri -urban area the endoparasites found were Entomoeba spp (51.6%), Strongylid nematodes (9.7%), Coccidia spp (5.8%). Ascaris suum ...

    3. Perceived Age Discrimination across Age in Europe: From an Ageing Society to a Society for All Ages (United States)

      Bratt, Christopher; Abrams, Dominic; Swift, Hannah J.; Vauclair, Christin-Melanie; Marques, Sibila


      Ageism is recognized as a significant obstacle to older people's well-being, but age discrimination against younger people has attracted less attention. We investigate levels of perceived age discrimination across early to late adulthood, using data from the European Social Survey (ESS), collected in 29 countries (N = 56,272). We test for…

    4. Magnetic, magnetoelastic and other electronic properties of a UIrAl single crystal

      Czech Academy of Sciences Publication Activity Database

      Andreev, Alexander V.; Mushnikov, N. V.; Honda, F.; Sechovyský, V.; Javorský, P.; Goto, T.

      272-276, - (2004), e337-e339 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Institutional research plan: CEZ:AV0Z1010914 Keywords : uranium intermetallics * UIrAl * UPtAl * ferromagnetism * pressure effects Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    5. Bulk study of a DyNiAl single crystal

      Czech Academy of Sciences Publication Activity Database

      Prchal, J.; Andreev, Alexander V.; Javorský, P.; Honda, F.; Jurek, Karel

      272-276, - (2004), e419-e420 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Keywords : rare-earth * DyNiAl * magnetic anisotropy * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    6. Automatic identification of microcracks observed on microscopic images of coarse-grained sandstone

      Czech Academy of Sciences Publication Activity Database

      Obara, B.; Kožušníková, Alena; Ščučka, Jiří


      Roč. 48, č. 4 (2011), s. 681-686 ISSN 1365-1609 Institutional research plan: CEZ:AV0Z30860518 Keywords : image analysis * microcracks * optical fluorescence microscopy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.272, year: 2011

    7. 77 FR 26770 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


      ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis....271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272, Alcohol...

    8. 75 FR 36660 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting (United States)


      ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272...

    9. 38 CFR 17.52 - Hospital care and medical services in non-VA facilities. (United States)


      .... 19012, Pub. L. 99-272) (10) For any disability of a veteran receiving VA contract nursing home care. The veteran is receiving contract nursing home care and requires emergency treatment in non-VA facilities... provisions of this section. When demand is only for infrequent use, individual authorizations may be used...

    10. Molluscum contagiosum virus infection amongst plwha in ibadan ...

      African Journals Online (AJOL)

      Diagnosis of Molluscum Contagiosum infection was based on the clinical findings of typical lesions on the external genitalia, perianal, trunk, abdominal and facial regions. Results: ... Of the 542 PLWHAs with STIs, 3.3 % had undetectable viral load (< 200 copies/ ml) while 272 (50.1 %) had low CD4 count (< 200 cells / mm3.) ...

    11. Putative role of PTEN and FAK in the regulation of PI-3 kinase in colorectal cancer cells

      Czech Academy of Sciences Publication Activity Database

      Turečková, Jolana; Kučerová, Dana; Vojtěchová, Martina; Šloncová, Eva; Tuháčková, Zdena


      Roč. 272, Suppl. 1 (2005), s. 316-317 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Institutional research plan: CEZ:AV0Z50520514 Keywords : PTEN * FAK * colon adenocarcinoma Subject RIV: EB - Genetics ; Molecular Biology

    12. Solid-State Field-Assisted Ag Diffusion in Ge-Ga-Sb-S Glasses

      Czech Academy of Sciences Publication Activity Database

      Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.


      Roč. 94, č. 6 (2011), s. 1756-1760 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Ag diffusion * Diffusion method * Diffusion temperature Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

    13. The Professional Learning Needs and Priorities of Higher-Education-Based Teacher Educators in England, Ireland and Scotland (United States)

      Czerniawski, Gerry; Gray, Donald; MacPhail, Ann; Bain, Yvonne; Conway, Paul; Guberman, Ainat


      Against a rapidly changing policy landscape for teacher education, exacerbated by 'Brexit' in the UK, findings are presented from an electronic survey of 272 higher-education based teacher educators in England, the Republic of Ireland and Scotland about their experiences of, and priorities for, professional learning. While the data generated were…

    14. NPHS2 gene mutation, atopy, and gender as risk factors for steroid-resistant nephrotic syndrome in Indonesians

      Directory of Open Access Journals (Sweden)

      Dedi Rachmadi


      Conclusion NPHS2 412C→T and 419delG gene mutations, as well as male gender are risk factors for SRNS in Indonesian subjects. Atopic history was not significantly associated with SRNS in our subjects. [Paediatr Indones. 2011;51:272-6].

    15. 76 FR 20846 - Approval and Promulgation of Air Quality Implementation Plans; Indiana (United States)


      ... technologies and the implementation of emission reduction projects to meet a level of control specified for the... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those... State Line Energy, LLC.. 2/22/2008 4/30/2008, 73 FR 23356. 6.8-2-34 Huhtamaki Foodservice, 2/22/2008 4...

    16. HDPE/COC blends with fibrous morphology and their properties

      Czech Academy of Sciences Publication Activity Database

      Vacková, Taťana; Šlouf, Miroslav; Nevoralová, Martina; Kaprálková, Ludmila


      Roč. 48, č. 12 (2012), s. 2031-2039 ISSN 0014-3057 R&D Projects: GA ČR GP106/09/P272 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blend * phase morphology * fibrous structure Subject RIV: JI - Composite Materials Impact factor: 2.562, year: 2012

    17. On the periphery of the Magdalenian World. An open-air site in Klementowice (Lublin Upland, Eastern Poland)

      Czech Academy of Sciences Publication Activity Database

      Wisniewski, T.; Mroczek, P.; Rodzik, J.; Zagórski, P.; Wilczyński, J.; Nývltová Fišáková, Miriam


      Roč. 272, č. 2012 (2012), s. 308-321 ISSN 1040-6182 Institutional research plan: CEZ:AV0Z80010507 Keywords : Magdalénien * Seasonality * open-air site Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.962, year: 2012

    18. Dicty_cDB: Contig-U05606-1 [Dicty_cDB

      Lifescience Database Archive (English)

      Full Text Available odium falciparum 3D7 chromosome 13. 34 8.3 17 ( FG295791 ) 1108770741540 New World Screwworm Larvae 9387 EST...... 42 8.3 2 ( FG293345 ) 1108770669958 New World Screwworm Larvae 9387 EST... 42 8.3 2 ( GO218251 ) CAGB272

    19. sPLA2-IIA

      Indian Academy of Sciences (India)


      Mapping, and Expression of a Novel Human Secretory Phospholipase A2. J Biol Chem 272:15745–15752. 6. Curfs DM, Ghesquiere SA, Vergouwe MN, van der Made I, Gijbels MJ, Greaves DR, Verbeek JS, Hofker. MH, de Winther MP. (2008) Macrophage secretory phospholipase A2 group X enhances anti-inflammatory.

    20. 78 FR 58884 - Approval and Promulgation of Implementation Plans; Kentucky; Stage II Requirements for Enterprise... (United States)


      ... Regulation (KAR) 401 KAR 59:174 Stage II controls at gasoline dispensing facilities, and submitted the rule..., gasoline dispensing facilities with a monthly throughput of 25,000 gallons or more located in a Kentucky... Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

    1. Children's and Adolescents' Developing Perceptions of Gender Inequality (United States)

      Neff, Kristin D.; Cooper, Carey E.; Woodruff, Althea L.


      Two studies examined children's and adolescents' developing perceptions of gender inequality. The first study examined perceptions of inequality among 272 early, middle, and late adolescents, focusing on the spheres of politics, business, and the home. Results indicated an age-related increase in perceptions of male dominance. Men were seen to…

    2. Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü

      Czech Academy of Sciences Publication Activity Database

      Sládek, Ondřej; Dervişcemaloğlu, B.


      Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision

    3. Manipulating the autolytic pathway of a Bacillus protease

      NARCIS (Netherlands)

      VandenBurg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G; HopsuHavu, VK; Jarvinen, M; Kirschke, H


      Autolytic degradation of Bacillus subtilis thermolysin-like proteinase (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously, we reported five autolysis sites in B. subtilis neutral protease (Van den Burg et al., 1990, Biochem. J. 272:93-97).

    4. Rendering one autolysis site in Bacillus subtilis neutral protease resistant to cleavage reveals a new fission

      NARCIS (Netherlands)

      Van den Burg, B; Eijsink, VGH; Vriend, G; Veltman, OR; Venema, G

      Autolytic degradation of the thermolysin-like proteinase of Bacillus subtilis (TLP-sub) is responsible for the irreversible inactivation of the enzyme at elevated temperatures. Previously we have reported five cleavage sites in Tip-sub [Van den Burg et al, (1990) Biochem. J. 272, 93-97]. In an

    5. Socio-economic factors affecting the role of local leaders in rural ...

      African Journals Online (AJOL)

      The study examined the socio-economic factors affecting the role of local leaders in rural development in Delta State, Nigeria. Simple random sampling technique was used to collect data from 272 respondents in 30 communities. Mean, parentage and ordinary least square multiple regression were used to analyse data ...

    6. 76 FR 35787 - Updated Trafficking Definition and Supplemental Nutrition Assistance Program (SNAP)-FDPIR Dual... (United States)


      ... personal identification numbers (PINs), and subsequently debit benefits from client accounts using manual..., national origin, gender, age, disability, marital or family status. Regulations at 7 CFR 272.6 specifically..., race, color, sex, handicap, religious creed, national origin, or political beliefs. Discrimination in...

    7. Solid State Field-Assisted Diffusion of Copper in Multi-Component Tellurite Glass

      Czech Academy of Sciences Publication Activity Database

      Stepanov, B.; Ren, J.; Wágner, T.; Lorinčík, Jan; Frumar, M.; Churbanov, M.; Chigirinsky, Y.


      Roč. 94, č. 7 (2011), 1986-1988 ISSN 0002-7820 Institutional research plan: CEZ:AV0Z20670512 Keywords : Solid state diffusion * Secondary Ion Mass Spectrometry * Tellurite glass Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.272, year: 2011

    8. Inhibition of HIV protease by monoclonal antibodies

      Czech Academy of Sciences Publication Activity Database

      Řezáčová, Pavlína; Brynda, Jiří; Fábry, Milan; Hořejší, Magdalena; Štouračová, Renata; Lescar, J.; Riottot, M. M.; Sedláček, Juraj; Bentley, G. A.

      15(5), č. 15 (2002), s. 272-276 ISSN 0952-3499 R&D Projects: GA AV ČR IAA5052502; GA ČR GV203/98/K023 Institutional research plan: CEZ:AV0Z5052915 Keywords : monoclonal antibodies * HIV protease * crystal structure Subject RIV: CE - Biochemistry Impact factor: 2.838, year: 2002

    9. Integrase of Mason-Pfizer monkey virus

      Czech Academy of Sciences Publication Activity Database

      Snášel, Jan; Krejčík, Zdeněk; Jenčová, Věra; Rosenberg, Ivan; Ruml, Tomáš; Alexandratos, J.; Gustchina, A.; Pichová, Iva


      Roč. 272, č. 1 (2005), s. 203-216 ISSN 1742-464X R&D Projects: GA AV ČR(CZ) IAA4055304 Institutional research plan: CEZ:AV0Z4055905 Keywords : integrase * Mason-Pfizer monkey virus * HIV -1 Subject RIV: CE - Biochemistry

    10. Prospects of increasing the presence of Helianthemum kahiricum ...

      African Journals Online (AJOL)



      Feb 12, 2014 ... Sécheresse. 17(n°1-2):19-30. Al-Rahmah AN (2001). Truffle of Deserts and Jungles (In Arabic), King. Saud University Publications, Riyadh, Saudi Arabia. p. 272. Armstrong G, Jhonson K (2001). Micropropagation of Ceratopetalum gummiferum, an important Australian cut flower crop. In vitro Cell. Dev. Biol.

    11. Transnational System Building Across Geopolitical Shifts. The Danube-Oder-Elbe Canal, 1901-2015

      Czech Academy of Sciences Publication Activity Database

      Janáč, Jiří; van der Vleuten, E.


      Roč. 9, č. 2 (2016), s. 272-291 ISSN 1965-0175 R&D Projects: GA ČR GA15-04902S Institutional support: RVO:68378114 Keywords : large technical systems * water politics * environmental history Subject RIV: AB - History Impact factor: 2.500, year: 2016

    12. Journal of Earth System Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...

    13. Pokroky ve studiu interakce inzulinu s jeho receptorem

      Czech Academy of Sciences Publication Activity Database

      Žáková, Lenka; Jiráček, Jiří


      Roč. 108, č. 4 (2014), s. 368-374 ISSN 0009-2770 R&D Projects: GA ČR GPP207/11/P430 Institutional support: RVO:61388963 Keywords : insulin * insulin receptor * crystal structure * NMR structure * complex * diabetes Subject RIV: CE - Biochemistry Impact factor: 0.272, year: 2014

    14. Využití meandrového mikroreaktoru ke studiu enzymově katalyzované glycerolýzy

      Czech Academy of Sciences Publication Activity Database

      Drhová, Magdalena; Šabata, Stanislav; Sýkora, Jan; Hetflejš, Jiří; Křišťál, Jiří; Kuncová, Gabriela


      Roč. 108, č. 11 (2014), s. 1058-1066 ISSN 0009-2770 R&D Projects: GA AV ČR(CZ) IAAX08240901 Institutional support: RVO:67985858 Keywords : enzymatic glycerolysis * meandr microreactor * novozym 435 Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    15. Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23

      Czech Academy of Sciences Publication Activity Database

      Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.


      Roč. 36, - (2005), s. 272-273 ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005

    16. Residual resistivity of (Ga,Mn)As alloys from ab initio calculations

      Czech Academy of Sciences Publication Activity Database

      Turek, Ilja; Kudrnovský, Josef; Drchal, Václav; Weinberger, P.

      272-276, č. 3 (2004), s. 1987-1988 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943; GA ČR GA202/01/0764 Institutional research plan: CEZ:AV0Z2041904 Keywords : magnetic semiconductors * residual resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    17. Molekuly a ionty v pohybu: Počítačové simulace biochemických a biofyzikálních procesů

      Czech Academy of Sciences Publication Activity Database

      Jungwirth, Pavel


      Roč. 108, č. 4 (2014), s. 278-284 ISSN 0009-2770 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : molecular dynamics * proteins * ions * membranes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.272, year: 2014

    18. The Moderating Effect of the Negative Impact of Recent Life Events on the Relation between Intrinsic Religiosity and Death Ideation in Older Adults (United States)

      Jahn, Danielle R.; Poindexter, Erin K.; Graham, Ryan D.; Cukrowicz, Kelly C.


      Researchers tested the hypothesis that the negative impact of recent life events would moderate the relationship between intrinsic religiosity and death ideation in older adults. Participants (n = 272) completed assessments of death ideation, intrinsic religiosity, and negative impact of recent life events. We confirmed the presence of concurrent…

    19. Ectopic Pregnancy: Lagos University Teaching Hospital Experience ...

      African Journals Online (AJOL)

      Ectopic pregnancy remains one of the commonest gynaecological emergencies in developing countries. In a retrospective study of ectopic pregnancy carried out at Lagos University Teaching Hospital (LUTH), Lagos, Nigeria, over a five year period, 272 cases were managed with an incidence of 43.8/1000 deliveries.

    20. Seminational surveillance of fungemia in Denmark: notably high rates of fungemia and numbers of isolates with reduced azole susceptibility

      DEFF Research Database (Denmark)

      Arendrup, Maiken Cavling; Fuursted, Kurt; Gahrn-Hansen, Bente


      laboratory systems documented a continuous increase of candidemia cases since the early 1990s. For the 272 susceptibility-tested isolates, MICs of amphotericin B and caspofungin were within the limits expected for the species or genus. However, decreased azole susceptibility, defined as a fluconazole MIC...

    1. 48 CFR 652.242-70 - Contracting Officer's Representative (COR). (United States)


      ... Representative (COR). 652.242-70 Section 652.242-70 Federal Acquisition Regulations System DEPARTMENT OF STATE... Contracting Officer's Representative (COR). As prescribed in 642.272(a), insert a clause substantially the same as follows: Contracting Officer's Representative (COR) (AUG 1999) (a) The Contracting Officer may...

    2. Assessment of the Genetic Variation in Bone Fracture Healing (United States)


      with various mesenchymal stem cell lines that were focused on identifying the patterns of genes that are regulated by BMPs ( Balint et al., 2003; Stock...embryogenesis. J Biol Chem 272(41):25511-7. Balint E, Lapointe D, Drissi H, van der Meijden C, Young DW, van Wijnen AJ, Stein JL, Stein GS, Lian JB. 2003

    3. Direct Detection of the Asteroidal YORP Effect

      Czech Academy of Sciences Publication Activity Database

      Lowry, S.C.; Fitzsimmons, A.; Pravec, Petr; Vokrouhlický, D.; Boehnhardt, H.; Taylor, P.A.; Margot, J. L.; Galád, Adrián; Irwin, M.; Irwin, J.; Kušnirák, Peter


      Roč. 316, č. 5822 (2007), s. 272-274 ISSN 0036-8075 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

    4. Archivace sociálněvědních dat: principy, technologie, standardy

      Czech Academy of Sciences Publication Activity Database

      Krejčí, Jindřich; Vávra, Martin; Čížek, Tomáš


      Roč. 61, č. 3 (2011), s. 245-272 ISSN 0004-0398 R&D Projects: GA MŠk LA09010 Institutional research plan: CEZ:AV0Z70280505 Keywords : archiving social science data * data management * Nesstar software Subject RIV: AO - Sociology, Demography

    5. Influence of anticancer drugs on interactions of tumor suppressor protein p53 with DNA

      Czech Academy of Sciences Publication Activity Database

      Pivoňková, Hana; Němcová, Kateřina; Brázdová, Marie; Kašpárková, Jana; Brabec, Viktor; Fojta, Miroslav


      Roč. 272, Suppl. 1 (2005), s. 562 ISSN 1474-3833. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] R&D Projects: GA MZd(CZ) NC7574 Institutional research plan: CEZ:AV0Z50040507 Keywords : tumour suppressor protein p53 * anticancer drugs * interaction with DNA Subject RIV: BO - Biophysics

    6. Hardiness, sensation seeking, optimism and social support as ...

      African Journals Online (AJOL)

      This study investigated the extent to which hardiness, sensation seeking, optimism and social support predicts stress tolerance among private secondary school teachers in Lagos State, Nigeria. Using an ex post-facto design, 272 teachers (123 males; 149 females) were selected from 8 privates secondary schools in Lagos ...

    7. Nanovýroba v přírodovědném vzdělávání

      Czech Academy of Sciences Publication Activity Database

      Hájková, Zdeňka; Šmejkal, P.


      Roč. 108, MAR (2014), s. 892-896 ISSN 0009-2770 Institutional support: RVO:68378271 Keywords : nanotechnology * nanofabrication * nanocar * top-down * bottom-up * demonstration * education Subject RIV: AM - Education Impact factor: 0.272, year: 2014

    8. Do Trauma Symptoms Mediate the Relationship Between Childhood Physical Abuse and Adult Child Abuse Risk? (United States)


      Cadzow, Armstrong, & Fraser, 1999; Haskett, Johnson, & Miller, 1994) and mixed findings (Doumas, Margolin, & John , 1994; Haapasalo & Aaltonen, 1999... Bowlby , 1973; Hill & Safran, 1994;Main&Kaplan, 1985;Ryle, 1985; Shirk, 1998; Stern, 1985). These internalworkingmodelsprovideexpectations about...and disciplinary responses. Child Maltreatment, 10, 272–282. Bowlby , J. (1973). Attachment and loss: Vol. 2. Separation. New York: Basic Books. Briere

    9. The presence of Echinococcus multilocularis in the red fox (vulpes vulpes) in the Netherlands

      NARCIS (Netherlands)

      van der Giessen JWB; Rombout Y; Limper L; van der Veen; Moolenbeek C; Franchimont H; Homan W; MGB


      Er zijn onderzoekingen gedaan naar het voorkomen van Echinococcus multilocularis bij vossen in Nederland van 1996 tot 1998. Deze parasiet is de oorzaak van alveolaire echinococcose, een ernstige parasitaire zoonose. Hiervoor zijn eerst 272 vossen onderzocht in het grensgebied met Duitsland en

    10. Small towns: theoretical perspectives and socio-spatial transformations

      Directory of Open Access Journals (Sweden)

      Francisco John Lennon Alves Paixão Lima


      Full Text Available SPOSITO, Eliseu Savério; SILVA, Paulo Fernando Jurado da. Cidades Pequenas: perspectivas teóricas e transformações socioespaciais. Jundiaí: Paco Editorial, 2013, 148 p.

    11. Relationship Between Perception And Role Of Local Leaders In ...

      African Journals Online (AJOL)

      The study examined the relationship between perception of local leaders and their role in rural development in Delta State, Nigeria. A multi-stage sampling technique was used to collect data from 272 respondents in 30 communities. Means and simple regression were used to analyze data collected. Findings revealed that ...

    12. Biokemistri

      African Journals Online (AJOL)


      Hofmeister, R., Wiegmann, K., Korherr, C., Bernardo,K.,. Martin Kronke, M., and Falk, W. (1997) Activation of acid sphingomyelinase by interleukin-1 (IL-1) requires the IL-1 receptor accessory protein J. Biol. Chem. 272: 27730–27736. Ichi, I., Chiaki Kamikawa, C., Nakagawa, T., Kobayashi, K.,. Ryoko Kataoka, R., Nagata, E., ...

    13. Fulltext PDF

      Indian Academy of Sciences (India)

      Synchronization enhancement via an oscillatory bath in a network of self-excited cells. B R Nana Nbendjo, H G Enjieu Kadji and Hilda A Cerdeira. 257–272 ... Distribution of level spacing ratios using one- plus two-body random matrix ensembles. N D Chavda. 309–316. Analysing correlations after the financial crisis of 2008 ...

    14. Maternal and Paternal Parenting Styles in Adolescents: Associations with Self-Esteem, Depression and Life-Satisfaction (United States)

      Milevsky, Avidan; Schlechter, Melissa; Netter, Sarah; Keehn, Danielle


      Our study examined variations in adolescent adjustment as a function of maternal and paternal parenting styles. Participants included 272 students in grades 9 and 11 from a public high school in a metropolitan area of the Northeastern US. Participants completed measures of maternal and paternal parenting styles and indices of psychological…


      African Journals Online (AJOL)


      performing a public function or a natural or juristic person exercising a public power or performing a public .... 9 Rose v Johannesburg Local Road Transportation Board 1947 (4) SA 272 (W). 10 Parg v Ladysmith City ..... the institutional bias inherent in the state tender board was intended by the provisions of the State ...

    16. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

      African Journals Online (AJOL)



      May 18, 2009 ... Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and.

    17. 75 FR 50764 - Agency Information Collection Activities: Proposed Collection; Comment Request (United States)


      ... groups with participants of in-person SOAR trainings; Evaluative materials completed by participants of... survey 120 1 120 .17 20.4 Focus groups 88 1 88 1.5 132 Subtotal 328 -- 328 -- 272.4 In-person Training... through the use of automated collection techniques or other forms of information technology. Proposed...

    18. From genes to genomes: concepts and applications of DNA technology

      National Research Council Canada - National Science Library

      Dale, Jeremy, Professor; Schantz, Malcolm von; Plant, Nick


      ... gel electrophoresis 25 25 26 29 29 31 31 32 33 33 36vi CONTENTS 2.6 2.7 2.8 2.9 2.10 2.11 2.12 2.13 Restriction endonucleases 2.6.1 Specificity 2.6.2 Sticky and blunt ends Ligation 2.7.1 2.7.2 Opt...

    19. Download this PDF file

      African Journals Online (AJOL)

      3):272-278. Roberto, I.C., Sato, 8., Mancilha, I.M. and. Taqueda, M.E.S.,. Influence of Media. Composition on Xylitol Fennentation by. Candida guilliennondii Using Response. Smfaee Methodology, Biotechnology Letters. 1995', 17: 12234228.

    20. Dementia and Cancer: A Comparison of Spouse Caregivers. (United States)

      Clipp, Elizabeth C.; George, Linda K.


      Compared 272 spouse caregivers of dementia sufferers with 30 spouse caregivers of cancer victims on multiple indicators of well-being. Found that dementia caregivers were more adversely affected by their role than cancer caregivers. Illness duration and caregivers' employment status did not help to explain this difference. Younger spouse…

    1. Laser Bioeffects Resulting from Non-Linear Interactions of Ultrashort Pulses with Biological Systems (United States)


      antioxidants to p’rev~iii activation’ of!q-KB6as led to the, general hypothesis that reactive oxygen species (ROS) are somehow involved in triggering... phototherapy for retinal and choroidal tumors: A rational approach", Graeffe’s Arch Exp Ophthalmol, 238, 249-272, (2000). 7. J.A. Oosterhuis, H.G. Journee-de

    2. Impact of continental meteorology and atmospheric circulation in the ...

      Indian Academy of Sciences (India)

      continuous monitoring of aerosols on regional and global scale. Several authors have documented the ... Atmospheric aerosols; satellite remote sensing; Indian Ocean. J. Earth Syst. Sci. 121, No. 2, April 2012, pp. 263–272 ...... industrial air pollution; Science 287(5459) 1793–1796. Saha A, Moorthy K K and Niranjan K 2005 ...

    3. Vicarious Trauma: An Exploratory Study of the Impact of Providing Sexual Abuse Treatment on Clinicians' Trust and Intimacy (United States)

      VanDeusen, Karen M.; Way, Ineke


      This study examined vicarious trauma effects in male and female clinicians who treat sexual abuse survivors (n = 111) and sexual offenders (n = 272). The national survey was conducted using a random sample of clinical members of two professional organizations. Analyses tested the relationships between demographic variables, maltreatment history,…

    4. Journal of Agricultural Extension Vol. 17 (1) June, 2013 ISSN 1119 ...

      African Journals Online (AJOL)

      Onyii Ogbonna

      had formal education including HND (35.8%), OND (33.3%) and secondary school certificate (27.2%). Most of ... ICT world in Nigeria since it has the potential of transforming agriculture through agricultural extension in ... one and two were analyzed using frequency and percentage while objective three was analysed using ...


      African Journals Online (AJOL)


      economy for financing housing investment needs. Housing is a ... income groups in Nigeria depends on the availability of capital, particularly long-term loans at ..... Total Investments % of Real Estate to Growth in Real. Mortgage(N'm). (N'm). Total Investments Estate. Investments(%) a b. 2003 14,272.79. 54,642.84. 26.12.

    6. Bulletin of Materials Science | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      Home; Journals; Bulletin of Materials Science. Dinesh. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 267-272 Superconductors. Specific heat studies in Ho–Ba–CuO superconductors: Fermionic and bosonic contributions · Dinesh Varshney Sanjay Shah R K Singh · More Details Abstract ...

    7. Journal of Genetics | Indian Academy of Sciences

      Indian Academy of Sciences (India)

      pp 263-272 RESEARCH ARTICLE. Role of common sarcomeric gene polymorphisms in genetic susceptibility to left ventricular dysfunction · SURENDRA KUMAR AVSHESH MISHRA ANSHIKA SRIVASTAVA MANSI BHATT N. GARG S. K. AGARWAL SHANTANU PANDE BALRAJ MITTAL · More Details Abstract Fulltext ...

    8. What Have We Learned from the War on Drugs? An Assessment of Mexico’s Counternarcotics Strategy (United States)


      Mexicano de Derecho Comparado no.127 (2010), 349-351. Translated by Google. 272 Guillermo Zepeda Lecuona, ―La reforma constitucional en Derecho Comparado, no. 127 (April 2010): 347–357. Reagan, Ronald. ―Address Before a Joint Session of the Congress on the State of the Union

    9. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

      African Journals Online (AJOL)

      Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and P. viridis, ...

    10. Rational inattention to discrete choices: a new foundation for the multinomial logit model

      Czech Academy of Sciences Publication Activity Database

      Matějka, Filip; McKay, A.


      Roč. 105, č. 1 (2015), s. 272-298 ISSN 0002-8282 R&D Projects: GA ČR(CZ) GPP402/11/P236 Institutional support: RVO:67985998 Keywords : discrete choice behavior * rational inattention * multinomial logit model Subject RIV: AH - Economics Impact factor: 3.833, year: 2015

    11. Rational inattention to discrete choices: a new foundation for the multinomial logit model

      Czech Academy of Sciences Publication Activity Database

      Matějka, Filip; McKay, A.


      Roč. 105, č. 1 (2015), s. 272-298 ISSN 0002-8282 Institutional support: PRVOUK-P23 Keywords : discrete choice behavior * rational inattention * multinomial logit model Subject RIV: AH - Economics Impact factor: 3.833, year: 2015

    12. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

      NARCIS (Netherlands)

      Prins, M.; van Leeuwen, M.W.; Teske, E.


      Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

    13. 40 CFR 721.10094 - Decene, branched and linear. (United States)


      ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Decene, branched and linear. 721.10094... Substances § 721.10094 Decene, branched and linear. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as decene, branched and linear (PMN P-03-272; CAS...

    14. A reassessment of the taxonomy of Oligocarpia bellii (Late Pennsylvanian, Sydney Coalfield, Nova Scotia, Canada)

      Czech Academy of Sciences Publication Activity Database

      Zodrow, E.; Pšenička, J.; Bek, Jiří


      Roč. 272, 1-6 (2005), s. 51-65 ISSN 0375-0299 R&D Projects: GA AV ČR IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : Carboniferous * Oligocarpia * epidermis Subject RIV: EF - Botanics Impact factor: 0.429, year: 2005

    15. Sociolinguistic Bibliography of European Countries for 2008: CZ

      Czech Academy of Sciences Publication Activity Database

      Kaderka, Petr


      Roč. 24, č. 1 (2010), s. 267-272 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistic s * bibliography * Czech Republic Subject RIV: AI - Linguistics

    16. Physical Therapy Needs Assessment Survey. (United States)

      Allegany Community Coll., Cumberland, MD.

      To ensure that the new physical therapist assistant (PTA) curriculum at Allegany Community College (Maryland) met current professional needs, a survey was undertaken of establishments likely to employ PTAs. An employer needs questionnaire was returned by 272 establishments (of 1,250 surveyed). Findings indicated that more than half of the…

    17. Burn-out, Circumferential Film Flow Distribution and Pressure Drop for an Eccentric Annulus with Heated Rod

      DEFF Research Database (Denmark)

      Andersen, P. S.; Jensen, A.; Mannov, G.


      Measurements of (1) burn-out, (2) circumferential film flow distribution, and (3) pressure drop in a 17 × 27.2 × 3500 mm concentric and eccentric annulus geometry are presented. The eccentric displacement was varied between 0 and 3 mm. The working fluid was water. Burn-out curves at 70 bar...... flow variation on burn-out is discussed....

    18. Erratum: Erratum to: A Novel Approach to Determination of Threshold for Stress Corrosion Cracking (KISCC) using Round Tensile Specimens (United States)

      Singh Raman, R. K.; Rihan, R.; Ibrahim, R. N.


      Due to an error by the authors, the reference R. Rihan, R.K. Singh Raman, and R.N. Ibrahim: Materials Science and Engineering A, 2006, vol. 425, pp. 272-77 should have been included in the list of references as well as cited as a source of the data in Figures 11, 12 and 16.

    19. USSR Report, Cybernetics Computers and Automation Technology (United States)


      Materials from foreign-language sources are translated; those from English -language sources are transcribed or reprinted, with the original phrasing and...Informational Robot-Manipulator Systems." Moscow, Mashinostroyeniye, 1977, 272 pages. 2 Pratt U. "Digital Processing of Images." Translated from English ...adjectives. It provides for automatic formation of lexical- gramatical information necessary for natural language processing. The semant^ syntactic

    20. Molecular systematics of Indian Alysicarpus (Fabaceae) based on ...

      Indian Academy of Sciences (India)


      A. pubescens var. vasavadae. 1. 1. A. rugosus. 1. 0. A. scariosus. 1. 0. A. tetragonolobus. 1. 1. A. vaginalis. 0. 1. Coding for the character states is as follows: 0, microcalyx; 1, macrocalyx; 0, trans- versely rugose; 1, nonrugose. 1997) followed by manual adjustments in Mesquite ver. 2.72 (Maddison and Maddison 2009).

    1. Characterization and Classification of Soils on an Agricultural ...

      African Journals Online (AJOL)

      Organic matter, available P, total N and CEC contents of the soils were generally low. According to .... Cation Exchange Capacity. RESULTS AND ..... Mean. 27.2. 52. 44. MEIR. 20. 40. 32. MEIR=mean equilibrium infiltration rate. Chemical Characteristics. Results of the chemical characteristics of the soils of. Dingyadi District ...

    2. An evaluation of palaeogeography and palaeoecology in the Most Basin (Czech Republic) and Saxony (Germany) from the late Oligocene to the early Miocene

      Czech Academy of Sciences Publication Activity Database

      Mach, K.; Teodoridis, V.; Matys Grygar, Tomáš; Kvaček, Z.; Suhr, P.; Standke, G.


      Roč. 272, č. 1 (2014), s. 13-45 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GAP210/11/1357 Institutional support: RVO:61388980 Keywords : palaeogeography * geochemistry * floras * Most Basin Subject RIV: DD - Geochemistry Impact factor: 0.519, year: 2014

    3. Nucleotide binding to Na+/K+-ATPase

      Czech Academy of Sciences Publication Activity Database

      Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen


      Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics

    4. Deep sequencing of atrial fibrillation patients with mitral valve regurgitation shows no evidence of mosaicism but reveals novel rare germline variants

      DEFF Research Database (Denmark)

      Gregers, Emilie; Ahlberg, Gustav; Christensen, Thea


      variants in genes involved in cellular potassium handling. The variants KCNQ1 (p.G272S) and KCNH2 (p.A913V) resulted in gain of function due to faster activation (KCNQ1) and slowed deactivation kinetics (KCNQ1, KCNH2). CONCLUSION: We did not find any somatic variants in patients with AF and MVR...

    5. High-resolution magnetic measurements of HTSC

      Czech Academy of Sciences Publication Activity Database

      Janů, Zdeněk; Novák, Miloslav; Tsoi, G.

      272-276, - (2004), e1099-e1101 ISSN 0304-8853 R&D Projects: GA ČR GA102/02/0994; GA AV ČR IAA1010104 Institutional research plan: CEZ:AV0Z1010914 Keywords : superconductivity * low-dimensional systems * resonance scattering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    6. Spheroidal models of the exterior gravitational field of Asteroids Bennu and Castalia

      Czech Academy of Sciences Publication Activity Database

      Sebera, Josef; Bezděk, Aleš; Pešek, I.; Henych, Tomáš


      Roč. 272, July (2016), s. 70-79 ISSN 0019-1035 R&D Projects: GA MŠk LH13071 Institutional support: RVO:67985815 Keywords : asteroids surfaces * near-Earth objects * geophysics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016

    7. Aphasia, an acquired language disorder

      African Journals Online (AJOL)


      Oct 11, 2009 ... Affecting an estimated one in every 272 South Africans, or 0.37% of the population, aphasia is a neurological condition described as “any disturbance in the comprehension or expression of language caused by a brain lesion”. Despite extensive debate throughout the history of neuropsychology there is no ...

    8. Phase competition in Pr.sub.0.8 - x./sub.La.sub.x./sub.Na.sub.0.2./sub.Mn.sub.1 - y./sub.Me.sub.y./sub.O.sub.3./sub..

      Czech Academy of Sciences Publication Activity Database

      Hejtmánek, Jiří; Jirák, Zdeněk; Knížek, Karel; Pollert, Emil; Martin, C.; Maignan, A.

      272-276, - (2004), e287-e288 ISSN 0304-8853 R&D Projects: GA AV ČR IAA1010202; GA ČR GA203/03/0924 Institutional research plan: CEZ:AV0Z1010914 Keywords : phase separation * colossal magnetoresistance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

    9. Current Issue

      African Journals Online (AJOL)

      Hitting the Hot Spots: Literary Tourism as a Research Field with Particular Reference to KwaZulu-Natal, South Africa. Lindy Stiebel ... Book Review: Brian McNair, An Introduction to Political Communication (3rd edition), London: Routledge, 2003, ISBN 0415307082, 272pp. Phil Joffe ...

    10. A novel one-pot synthesis of spirooxindole derivatives catalyzed by ...

      African Journals Online (AJOL)

      Nano zinc oxide was explored as a heterogeneous and reusable catalyst for the one-pot synthesis of spirooxindoles via three-component reaction between urea, isatin, and 1,3-dicarbonyl compounds. KEY WORDS: Nano-ZnO, Spirooxindoles, Isatin. Bull. Chem. Soc. Ethiop. 2013, 27(2), 309-314.

    11. Chemie fosfonátových analogů nukleotidů a oligonukleotidů - stručná reminiscence a současnost

      Czech Academy of Sciences Publication Activity Database

      Rosenberg, Ivan


      Roč. 108, č. 4 (2014), s. 375-386 ISSN 0009-2770 R&D Projects: GA ČR GA13-26526S Institutional support: RVO:61388963 Keywords : oligonucleotides * phosphonates * RNase H * RNase L Subject RIV: CC - Organic Chemistry Impact factor: 0.272, year: 2014

    12. Research Article Genome-wide association study for economic traits ...

      Indian Academy of Sciences (India)

      Aiqiang Lin

      The PCR procedure was. 101. 95 °C for ..... Ethics statement. 270. The sample collection and experiments in the study was approved by the Animal Care and. 271. Use Committee of Fisheries College of Jimei University (Animal Ethics no. 1067). 272 .... Transport of fatty acids across the human placenta: a review. Prog Lipid ...

    13. Agrosearch 1 Vol. 1

      African Journals Online (AJOL)

      are kept outside of the formal banking system and are often lent to group members to finance emergencies and other expenses. .... 2.4599. 1. Coefficients obtained from multiple regression analysis. Model. Unstandardized coefficients. Standard coefficients t sig. $. Std error. Beta. (Constant). 7.107. 2.272. 3.128 .002. Age.

    14. 75 FR 54031 - Approval and Promulgation of Implementation Plans; Designation of Areas for Air Quality Planning... (United States)


      ... area pavement was enlarged to prevent kicking up dust at the edges. See July 20, 2010 e-mail from..., these actions: Are not ``significant regulatory actions'' subject to review by the Office of Management... National Technology Transfer and Advancement Act of 1995 (15 U.S.C. 272 note) because application of those...

    15. List of Participants

      Indian Academy of Sciences (India)

      Bordalo Paula, LIP, Av. Elios Garcia 14, 1000 Lisbon, Portugal Borel Herve, DAPNIA/SPhN, Bât. 703, CEA Saclay, F-91191 Gif sur Yvette, France Braun-Munzinger P, GSI, D-64220 Darmstadt, Germany Caines Helen, Physics Department, Yale University, 272 Whitney Avenue, ...

    16. Arbuscular mycorrhiza decreases cadmium phytoextraction by transgenic tobacco with inserted metallothionein

      Czech Academy of Sciences Publication Activity Database

      Janoušková, Martina; Pavlíková, D.; Macek, Tomáš; Vosátka, Miroslav


      Roč. 272, - (2005), s. 29-40 ISSN 0032-079X R&D Projects: GA ČR(CZ) GA526/02/0293 Institutional research plan: CEZ:AV0Z60050516 Keywords : CUP1 gene * heavy metals * soil microflora Subject RIV: EF - Botanics Impact factor: 1.703, year: 2005

    17. a panacea to food crisis among women farmers in imo state

      African Journals Online (AJOL)


      holder farmers on marginal soils of Aba Agricultural zone, Abia State. Five blocks were randomly selected out of ... The soil-types of this zone are inherently low in major soil nutrients and trace elements to support arable crop production .... your vegetable and garden egg farm. Overall Mean. 2.72. As seen from Table 5, the ...

    18. Aerobasics–An Introduction to Aeronautics

      Indian Academy of Sciences (India)

      Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. Aerobasics – An Introduction to Aeronautics - Supersonic Aerodynamics. S P Govinda Raju. Series Article Volume 14 Issue 3 March 2009 pp 272-289. Fulltext. Click here to view fulltext PDF. Permanent link:

    19. The Speargrass (Imperata cylindrica (L) Beauv.) menace in Ghana ...

      African Journals Online (AJOL)

      Farmers perceived average yield losses of 30–80% ha–1 due to speargrass interference, implying a national average crop loss ha-1 of $31–$84, $155–$414 and $272–$727 for maize, cassava and yam systems, respectively. Reductions in food quality due to the piercing nature of the rhizomes was also paramount.

    20. Odkaz díla Václava Machka soudobé slavistice

      Czech Academy of Sciences Publication Activity Database

      Janyšková, Ilona; Karlíková, Helena


      Roč. 50, č. 4 (2014), s. 63-69 ISSN 0557-272X. [Zilele culturilor slave in Romania. Bucuresti, 02.10.2014-04.10.2014] R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavistics * Slavonic languages * etymology * Václav Machek Subject RIV: AI - Linguistics