WorldWideScience

Sample records for bohrium 271

  1. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  2. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  4. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  5. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  6. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  7. 33 CFR 117.271 - Blackwater River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blackwater River. 117.271 Section 117.271 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.271 Blackwater River. The draw of...

  8. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  9. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  10. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  11. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  12. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  13. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  14. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  15. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  16. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  17. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  18. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  19. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  20. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  1. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  2. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  3. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  4. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  5. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  6. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  7. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  8. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  9. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  10. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  11. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  12. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  13. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  14. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  15. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  16. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  17. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  18. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  19. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  20. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  1. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  2. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  3. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  4. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  5. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  6. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  7. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  8. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  9. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  10. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  11. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  12. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  13. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  14. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  15. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  16. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  17. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  18. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  19. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  20. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  1. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  2. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  3. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  4. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  5. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  6. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  7. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  8. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  9. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  10. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  11. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  12. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  13. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  14. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  15. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  16. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  17. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  18. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  19. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  20. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  1. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  2. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  3. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  4. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  5. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  6. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  7. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  8. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  9. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  10. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  11. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  12. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  13. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  14. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  15. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  16. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  17. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  18. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  19. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  20. 12 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Definitions. 271.2 Section 271.2 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES REGARDING AVAILABILITY OF... results of which are not intended to promote any particular product or industry. (i) Records of...

  1. 12 CFR 271.6 - Processing requests.

    Science.gov (United States)

    2010-01-01

    ... AVAILABILITY OF INFORMATION § 271.6 Processing requests. (a) Receipt of requests. The date of receipt for any... reasonably be expected to pose an imminent threat to the life or physical safety of an individual; or...

  2. 7 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... forth at 20 CFR part 416, subpart I, Determining Disability and Blindness as defined in Title XVI...: For Federal Register citations affecting § 271.2, see the List of CFR Sections Affected, which appears... items including, but not limited to, coffee, tea, cocoa, carbonated and uncarbonated drinks,...

  3. 14 CFR 271.9 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 49 CFR part 21; and (3) The Rehabilitation Act of 1973, 49 CFR part 27, and part 382 of this chapter... assurances required by 49 CFR parts 20, 21, 27 and 29, and § 382.21 of this chapter. ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Discrimination prohibited. 271.9...

  4. 40 CFR 61.271 - Emission standard.

    Science.gov (United States)

    2010-07-01

    ... device requirements of 40 CFR 60.18. (3) The specifications and requirements listed in paragraphs (c)(1... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission standard. 61.271 Section 61...) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Benzene...

  5. 40 CFR 264.271 - Treatment program.

    Science.gov (United States)

    2010-07-01

    ...) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Land... land treatment program that is designed to ensure that hazardous constituents placed in or on the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Treatment program. 264.271 Section...

  6. 48 CFR 1352.271-76 - Performance.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-76 Performance. As prescribed in 48 CFR 1371.107, insert the following clause: Performance (APR 2010) (a) The contractor shall... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance....

  7. 36 CFR 271.7 - Power to revoke.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Power to revoke. 271.7 Section 271.7 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE USE OF âSMOKEY BEARâ SYMBOL § 271.7 Power to revoke. It is the intention of the regulations in this part that the...

  8. Dicty_cDB: VHD271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD271 (Link to dictyBase) - - - Contig-U15962-1 VHD271P (Link to Original ... *ntl fhihpldikdi*hlmllllv*lvplllfiqskqcnssskssnhiy*ngs ***scpygwlg isrknskv**qt*ketf*r*kyysmlpfn--- ---SVG ... *ilk Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value VHD271 (VHD271 ... 004.12.24 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AP008207 |AP ... 5.11 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value CP000113_3785( ...

  9. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  10. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  11. 14 CFR 271.7 - Subsidy payout formula.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Subsidy payout formula. 271.7 Section 271.7 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... payout formula. (a) Subsidy will be paid by the Department to the air carrier monthly, based on...

  12. Dicty_cDB: SSM271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AP009256_1251( AP009256 |pid:none) Bifidobacterium adolescentis AT... 64 3e-09 CP001022_2966( CP001022 |pid...SF/SFE2-D/SFE281Q.Seq.d/ 40 0.042 own update 2004. 7.29 Homology vs DNA Score E Sequences producing significant alignments: (bits...ogy vs Protein Score E Sequences producing significant alignments: (bits...1Z (Link to Original site) Representative DNA sequence >SSM271 (SSM271Q) /CSM/SS/SSM2-C/SSM271Q.Seq.d/ XXXXX... producing significant alignments: (bits) Value SSM271 (SSM271Q) /CSM/SS/SSM2-C/SSM27

  13. 48 CFR 1352.271-73 - Schedule of work.

    Science.gov (United States)

    2010-10-01

    ... of work. As prescribed in 48 CFR 1371.104, insert the following clause. Schedule of Work (APR 2010... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Schedule of work. 1352.271... arrival at the contractor's facility: (1) Production Schedule. (2) Work Package Network. (3)...

  14. 48 CFR 719.271-6 - Small business screening procedure.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business screening... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-6 Small business screening procedure. (a) General. All USAID/Washington proposed contract actions in excess of the...

  15. 48 CFR 719.271-4 - Heads of contracting activities.

    Science.gov (United States)

    2010-10-01

    ... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-4 Heads of contracting activities. In order for the agency small business program to be effective, the active support of top management... made by SDB; (b) Consulting with SDB in establishing small business and minority business...

  16. 48 CFR 719.271-3 - USAID contracting officers.

    Science.gov (United States)

    2010-10-01

    ... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-3 USAID contracting officers. With...) Being thoroughly familiar with part 19 of the FAR and this section dealing with the small business... procurements; (c) Assuring that small business concerns and minority business enterprises are...

  17. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  18. 48 CFR 719.271-2 - The USAID Office of Small and Disadvantaged Business Utilization (SDB).

    Science.gov (United States)

    2010-10-01

    ... and Disadvantaged Business Utilization (SDB). 719.271-2 Section 719.271-2 Federal Acquisition... Policies 719.271-2 The USAID Office of Small and Disadvantaged Business Utilization (SDB). (a) SDB is... other methods; (ii) Utilize every source available to determine if an item is obtainable from...

  19. 14 CFR 135.271 - Helicopter hospital emergency medical evacuation service (HEMES).

    Science.gov (United States)

    2010-01-01

    ... evacuation service (HEMES). 135.271 Section 135.271 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION....271 Helicopter hospital emergency medical evacuation service (HEMES). (a) No certificate holder may... 24-consecutive hour period of a HEMES assignment, unless an emergency medical evacuation operation...

  20. 48 CFR 852.271-73 - Use and publication of counseling results.

    Science.gov (United States)

    2010-10-01

    ... counseling results. 852.271-73 Section 852.271-73 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-73 Use and publication of counseling results. As prescribed in 871.212, insert the following clause: Use and Publication of Counseling Results (JAN 2008) The contractor agrees that none...

  1. 48 CFR 852.271-72 - Time spent by counselee in counseling process.

    Science.gov (United States)

    2010-10-01

    ... counseling process. 852.271-72 Section 852.271-72 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-72 Time spent by counselee in counseling process. As prescribed in 871.212, insert the following clause: Time Spent by Counselee in Counseling Process (APR 1984) The contractor agrees that...

  2. 27 CFR 27.1 - Imported distilled spirits, wines, and beer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Imported distilled spirits, wines, and beer. 27.1 Section 27.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Scope of Regulations § 27.1 Imported...

  3. CD271 Expression on Patient Melanoma Cells Is Unstable and Unlinked to Tumorigenicity.

    Science.gov (United States)

    Boyle, Samantha E; Fedele, Clare G; Corbin, Vincent; Wybacz, Elisha; Szeto, Pacman; Lewin, Jeremy; Young, Richard J; Wong, Annie; Fuller, Robert; Spillane, John; Speakman, David; Donahoe, Simon; Pohl, Miklos; Gyorki, David; Henderson, Michael A; Johnstone, Ricky W; Papenfuss, Anthony T; Shackleton, Mark

    2016-07-01

    The stability of markers that identify cancer cells that propagate disease is important to the outcomes of targeted therapy strategies. In human melanoma, conflicting data exist as to whether hierarchical expression of CD271/p75/NGFR (nerve growth factor receptor) marks cells with enriched tumorigenicity, which would compel their specific targeting in therapy. To test whether these discrepancies relate to differences among groups in assay approaches, we undertook side-by-side testing of published methods of patient-derived melanoma xenografting (PDX), including comparisons of tissue digestion procedures or coinjected Matrigel formulations. We found that CD271(-) and CD271(+) melanoma cells from each of seven patients were similarly tumorigenic, regardless of assay variations. Surprisingly variable CD271 expression patterns were observed in the analyses of sibling PDX tumors (n = 68) grown in the same experiments from either CD271(-) or CD271(+) cells obtained from patients. This indicates unstable intratumoral lineage relationships between CD271(-) and CD271(+) melanoma cells that are inconsistent with classical, epigenetically based theories of disease progression, such as the cancer stem cell and plasticity models. SNP genotyping of pairs of sibling PDX tumors grown from phenotypically identical CD271(-) or CD271(+) cells showed large pairwise differences in copy number (28%-48%). Differences were also apparent in the copy number profiles of CD271(-) and CD271(+) cells purified directly from each of the four melanomas (1.4%-23%). Thus, CD271 expression in patient melanomas is unstable, not consistently linked to increased tumorigenicity and associated with genetic heterogeneity, undermining its use as a marker in clinical studies. Cancer Res; 76(13); 3965-77. ©2016 AACR. PMID:27325642

  4. 49 CFR 40.271 - How are alcohol testing problems corrected?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false How are alcohol testing problems corrected? 40.271 Section 40.271 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION... problem promptly, if practicable. You may repeat the testing process as part of this effort. (2)...

  5. 27 CFR 70.271 - Procedure in the case of transferred assets.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Procedure in the case of transferred assets. 70.271 Section 70.271 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... transferred assets. (a) Method of collection. (1) The liability, at law or in equity, of a transferee...

  6. 48 CFR 1352.271-82 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1352.271-82 Section 1352.271-82 Federal Acquisition... of Provisions and Clauses 1352.271-82 Department of Labor occupational safety and health standards... Occupational Safety and Health Standards for Ship Repair (APR 2010) The contractor, in performance of all...

  7. Yeast Interacting Proteins Database: YDR271C, YOR128C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR271C - Dubious open reading frame unlikely to encode a protein, based on availab...ait (0) 2 54 2 2 0 0 0 0 0 - - - - - 0 0 11 - Show YDR271C Bait ORF YDR271C Bait gene name - Bait description Dubious open reading...is bait as bait (1) Rows with this bait as prey (0) YOR128C ADE2 Phosphoribosylaminoimidazole carboxylase, catalyzes a step in...e ADE2 Prey description Phosphoribosylaminoimidazole carb...ture shared by bait and prey 2 Literature sharing score 2 CuraGen (0 or 1) 0 S. F

  8. Intravenous Application of CD271-selected Mesenchymal Stem Cells during Fracture Healing

    Science.gov (United States)

    Dreger, Tina; Watson, John Tracy; DVM, Walter Akers; Molligan, Jeremy; Achilefu, Samuel; Schon, Lew C.; Zhang, Zijun

    2014-01-01

    Objectives Circulating mesenchymal stem cells (MSCs) participate in fracture healing and can be used to enhance fracture healing. This study investigated how CD271-selected MSCs travel in circulation and when it is the optimal time to apply MSCs intravenously during fracture healing. Methods Based on the expression of CD271, MSCs were isolated from human bone marrow and labeled with cypate, a near infrared fluorochrome. A unilateral closed fracture was created at the femur in immunodeficient mice. The cypate-labeled MSCs were injected into the tail vein of the mice at days 1 and 3 after fracture, and were tracked by near infrared imaging. The mice were euthanized at 3 weeks after fracture. Immunohistochemistry was performed to detect human MSCs at the fracture sites. Migration of CD271-selected MSCs, under the influence of stem cell derived factor-1 (SDF-1), was assessed in vitro. Results Intravenously injected at day1, but not day 3, after fracture, CD271-selected MSCs accumulated at the fracture sites significantly and that lasted for at least 7 days. All fractures, with or without MSC injections, healed in 3 weeks. Human cells were localized at the fracture sites in mice by immunohistochemistry. CD271-selected MSCs migrated toward the medium contained SDF-1 in vitro. Conclusions After intravenous injection, CD271-selected MSCs were recruited to fracture sites. The stages of fracture healing influenced the homing of culture-expanded MSCs. In mice, an optimal window of intravenous injection of MSCs was around 24 hours after fracture. Clinical Relevance Intravenous application of MSCs may serve as a practical route to deliver stem cells for the treatment of fracture non-union and delayed union. Levels of evidence Level I PMID:24378433

  9. Growth Of 222Rn By Using Merlin Gerin, Vinten 271/671 And Centronic Ionization Chambers

    International Nuclear Information System (INIS)

    Growth measurements of exp.222 Rn by using Merlin Gerin, Vinten 271/671 and Centronic 1G 11/A20 ionization chamber have been studied. The aim of this measurement is to determine the optimum growth in the seculer equilibrium of exp.222 Rn by using three ionization chambers. The optimum growth of exp.222 Rn by using merlin Gerin ionization chamber was (19.06 n 0.07) days, by using Vinten 271/671 ionization chamber was (19.20 n 0.01) days and with Centronic 1G 11/A20 ionization chamber was (19.64 n 0.43) days

  10. Light Variations of the Anomalous Central Star of Planetary Nebula Sh 2-71

    CERN Document Server

    Mikulasek, Z; Zejda, M; Pejcha, O; Kohoutek, L; Motl, D; Vittone, A A; Errico, L A; Mikulasek, Zdenek; Skopal, Augustin; Zejda, Miloslav; Pejcha, Ondrej; Kohoutek, Lubos; Motl, David

    2005-01-01

    We present an analysis of light variations in UBVRI of the anomalous object in the center of planetary nebula Sh 2-71. We refined the linear ephemeris of the light maxima to JD{max} = 2449862.0 + 68.101 (E-96), but also identified long-term, obviously non-periodic variations. The latter manifest themselves in large O-C shifts, a variable profile of light curves (hereafter LC) and changes in the mean brightness of the object. Our spectroscopic observations suggested the presence of a superdense nebula in the center of Sh 2-71.

  11. Atomic Mass and NuclearBinding Energy for Uup-271(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-271 (Ununpentium, atomic number Z = 115, mass number A = 271).

  12. 7 CFR 2.71 - Director, Office of Risk Assessment and Cost-Benefit Analysis.

    Science.gov (United States)

    2010-01-01

    ... Chief Economist § 2.71 Director, Office of Risk Assessment and Cost-Benefit Analysis. (a) Delegations..., Office of Risk Assessment and Cost-Benefit Analysis: (1) Responsible for assessing the risks to human... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Risk Assessment and...

  13. 49 CFR 234.271 - Insulated rail joints, bond wires, and track connections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Insulated rail joints, bond wires, and track...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Inspections and Tests § 234.271 Insulated...

  14. 48 CFR 2923.271 - Purchase and use of environmentally sound and energy efficient products and services.

    Science.gov (United States)

    2010-10-01

    ... environmentally sound and energy efficient products and services. 2923.271 Section 2923.271 Federal Acquisition Regulations System DEPARTMENT OF LABOR SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Energy And Water Efficiency...

  15. 42 CFR 137.271 - Why is there a separate subpart in these regulations for construction project agreements?

    Science.gov (United States)

    2010-10-01

    ... regulations for construction project agreements? 137.271 Section 137.271 Public Health PUBLIC HEALTH SERVICE... regulations for construction project agreements? Construction projects are separately defined in Title V and are subject to a separate proposal and review process. Provisions of a construction project...

  16. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-05-12

    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  17. u271gm.m77t - MGD77 data file for Geophysical data from field activity U-2-71-GM in East Margin Yucatan Peninsula from 06/23/1971 to 07/08/1971

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam, bathymetry, gravity, and magnetic data along with transit satellite navigation data was collected as part of the U.S. Geological Survey cruise U271GM....

  18. Plutonium isotopic abundance measurements on CBNM NRM 271 analyzed with the FRAM and MGA codes

    Energy Technology Data Exchange (ETDEWEB)

    Friar, R.J.; Sampson, T.E.

    1992-05-01

    We report results of gamma-ray spectroscopy measurements of the isotopic distributions of plutonium in the reference-material set CBNM NRM 271 as analyzed by the FRAM and MGA plutonium isotopic codes. We acquired high-quality spectral data under measurement conditions approximating field-use conditions recommended by the code developers. Bias and precision results from these measurements are presented for both codes. Both codes performed very well for these measurements. These standards have proven to be very useful for testing the Los Alamos FRAM code in the high-burnup region where well-characterized materials have been unavailable at Los Alamos.

  19. COST 271 Action - Effects of the upper atmosphere on terrestrial and Earth-space communications: introduction

    Directory of Open Access Journals (Sweden)

    L. R. Cander

    2004-06-01

    Full Text Available The COST 271 Action («Effects of the Upper Atmosphere on Terrestrial and Earth-space Communications » within the European ionospheric community has the objectives, embodied in the Memorandum of Understanding (MoU: to study the influence of upper atmospheric conditions on terrestrial and Earth-space communications, to develop methods and techniques to improve ionospheric models over Europe for telecommunication and navigation applications and to transfer the results to the appropriate Radiocommunication Study Groups of the International Telecommunication Union (ITU-R and other national and international organizations dealing with the modern communication systems. This introductory paper summarises briefly the background and historical context of COST 271 and outlines the main objectives, working methods and structure. It also lists the participating countries and institutions, the Management Committee (MC Meetings, Workshops and Short-term Scientific Missions. In addition, the paper discusses the dissemination of the results and the collaboration among the participating institutions and researchers, before outlining the content of the Final Report.

  20. Long-term trends in the ionosphere and upper atmosphere parameters - Results derived in the WP1.5 of the COST 271 project

    Czech Academy of Sciences Publication Activity Database

    Bremer, J.; Alfonsi, L.; Pal, B.; Cannon, P. S.; Franceschi de, G.; Hall, B. M.; Laštovička, Jan; Marin, D.; Materassi, M.; Mikhailov, A. V.; Morena de la, B. A.; Perrone, L.; Rodgers, N.; Ulich, Th.

    Chilton : Rutherford Appleton Laboratory, 2004, s. -. [Workshop "Significant results in COST271 action" /3./.. Spetses (GR), 23.09.2003-25.09.2003] R&D Projects: GA MŠk OC 271.10; GA AV ČR IAA3042101 Institutional research plan: CEZ:AV0Z3042911 Keywords : long-term trends * ionosphere Subject RIV: DG - Athmosphere Sciences, Meteorology http://www.COST271.rl.ac.uk

  1. The Central Star Candidate of the Planetary Nebula Sh2-71: Photometric and Spectroscopic Variability

    CERN Document Server

    Močnik, Teo; Pollacco, Don; Street, Rachel A

    2015-01-01

    We present the analysis of several newly obtained and archived photometric and spectroscopic datasets of the intriguing and yet poorly understood 13.5-mag central star candidate of the bipolar planetary nebula Sh2-71. Photometric observations confirmed the previously determined quasi-sinusoidal lightcurve with a period of 68 days and also indicated periodic sharp brightness dips, possibly eclipses, with a period of 17.2 days. In addition, the comparison between U and V lightcurves revealed that the 68-day brightness variations are accompanied by a variable reddening effect of $\\Delta E(U-V)=0.38$. Spectroscopic datasets demonstrated pronounced variations in spectral profiles of Balmer, helium and singly ionised metal lines and indicated that these variations occur on a time-scale of a few days. The most accurate verification to date revealed that spectral variability is not correlated with the 68-day brightness variations. The mean radial velocity of the observed star was measured to be $\\sim$26 km/s with an ...

  2. Corrective Action Plan for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    R. B. Jackson

    2003-05-01

    The Areas 25, 26 and 27 Septic Systems are in the Federal Facility Agreement and Consent Order (FFACO) of 1996 as Corrective Action Unit (CAU) 271. This Corrective Action Plan (CAP) provides selected corrective action alternatives and proposes the closure methodology for CAU 271. CAU 271 is located on the Nevada Test Site (NTS) approximately 105 kilometers (65 miles) northwest of Las Vegas, Nevada, and consists of the following 15 Corrective Action Sites (CAS): CAS 25-04-1, Septic System; CAS 25-04-03, Septic System; CAS25-04-04, Septic System; CAS 25-04-08, Septic System; CAS 25-04-09, Septic System; CAS 25-04-10, Septic System; CAS 25-04-11, Septic System; CAS 26-03-01, Contaminated Water Reservoir; CAS 26-04-1, Septic System; CAS 26-04-02, Septic System; CAS 26-05-01, Radioactive Leachfield; CAS-26-05-03, Septic System; CAS 26-05-04, Septic System; CAS 26-05-05, Septic System; and CAS 27-05-02, Leachfield.

  3. Rates of upgrade to malignancy for 271 cases of flat epithelial atypia (FEA) diagnosed by breast core biopsy.

    Science.gov (United States)

    Peres, Alexandre; Barranger, Emmanuel; Becette, Véronique; Boudinet, Alain; Guinebretiere, Jean-Marc; Cherel, Pascal

    2012-06-01

    Flat epithelial atypia (FEA) is a borderline lesion that might represent an early stage in the development of certain low-grade carcinomas in situ and invasive cancers. There are no guidelines on its management. Our objectives were to determine the upgrade to malignancy rate and identify a subpopulation of patients that might undergo just mammographic surveillance. We retrospectively reviewed the data for 271 FEA cases among 5,555 breast core biopsies obtained over a 7-year period (January 2003-2010). We collated clinical data (age, history of cancer, menopausal status), radiological data (lesion type, size, Bi-Rads category), technical data (number of biopsies, needle gauge, excision quality) and histological data and sought correlations between these factors and upgrade rate. The 271 FEA comprised 128 cases of pure FEA, 135 cases of FEA + atypical ductal hyperplasia, and 8 cases of FEA + atypical lobular hyperplasia. Overall, 184 patients underwent surgery and 46 mammographic surveillance. Surgery detected 34 cases of malignancy (23 CIS, 7 invasive cancers, and 4 mixed cases) giving a 15% upgrade rate. Quality of excision was the only factor associated with under-diagnosis. The presence of FEA at biopsy warrants surgery. PMID:22042365

  4. Antibody Therapy Targeting CD47 and CD271 Effectively Suppresses Melanoma Metastasis in Patient-Derived Xenografts.

    Science.gov (United States)

    Ngo, Michael; Han, Arum; Lakatos, Anita; Sahoo, Debashis; Hachey, Stephanie J; Weiskopf, Kipp; Beck, Andrew H; Weissman, Irving L; Boiko, Alexander D

    2016-08-01

    The high rate of metastasis and recurrence among melanoma patients indicates the existence of cells within melanoma that have the ability to both initiate metastatic programs and bypass immune recognition. Here, we identify CD47 as a regulator of melanoma tumor metastasis and immune evasion. Protein and gene expression analysis of clinical melanoma samples reveals that CD47, an anti-phagocytic signal, correlates with melanoma metastasis. Antibody-mediated blockade of CD47 coupled with targeting of CD271(+) melanoma cells strongly inhibits tumor metastasis in patient-derived xenografts. This therapeutic effect is mediated by drastic changes in the tumor and metastatic site immune microenvironments, both of whichwhich exhibit greatly increased density of differentiated macrophages and significantly fewer inflammatory monocytes, pro-metastatic macrophages (CCR2(+)/VEGFR1(+)), and neutrophils, all of which are associated with disease progression. Thus, antibody therapy that activates the innate immune response in combination with selective targeting of CD271(+) melanoma cells represents a powerful therapeutic approach against metastatic melanoma. PMID:27477289

  5. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    Directory of Open Access Journals (Sweden)

    Yan-Ling Liang

    2014-01-01

    Full Text Available From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36.36% of all the 22 strains. Three isolates among the 22 strains showed higher carboxymethyl cellulase (CMCase activity, and isolate ME27-1 exhibited the highest CMCase activity in liquid culture. The strain ME27-1 was identified as Paenibacillus terrae on the basis of 16S rRNA gene sequence analysis as well as physiological and biochemical properties. The optimum pH and temperature for CMCase activity produced by the strain ME27-1 were 5.5 and 50°C, respectively, and the enzyme was stable at a wide pH range of 5.0–9.5. A 12-fold improvement in the CMCase activity (2.08 U/mL of ME27-1 was obtained under optimal conditions for CMCase production. Thus, this study provided further information about the diversity of cellulose-degrading bacteria in the subtropical region of China and found P. terrae ME27-1 to be highly cellulolytic.

  6. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail: yoshim@nr.titech.ac.jp

    2015-06-12

    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4{sup K271R} mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4{sup K210R} mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4{sup K271R} was defective in the nuclear localization of itself and LIG4, whereas XRCC4{sup K210R} was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4{sup K271R}, but not M10-XRCC4{sup K210R}, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4{sup WT}. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4{sup K271R} than in M10-XRCC4{sup WT}, whereas it was only marginally increased in M10-XRCC4{sup K210R} as compared to M10-XRCC4{sup WT}. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4{sup K271R} is defective in the nuclear localization of itself and LIG4. • XRCC4{sup K210R} is competent for the nuclear localization of itself and LIG4. • XRCC4{sup K271R} is deficient in DSB repair function. • XRCC4{sup K210R} is mostly normal in DSB repair function.

  7. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

    International Nuclear Information System (INIS)

    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4K271R mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4K210R mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4K271R was defective in the nuclear localization of itself and LIG4, whereas XRCC4K210R was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4K271R, but not M10-XRCC4K210R, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4WT. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4K271R than in M10-XRCC4WT, whereas it was only marginally increased in M10-XRCC4K210R as compared to M10-XRCC4WT. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4K271R is defective in the nuclear localization of itself and LIG4. • XRCC4K210R is competent for the nuclear localization of itself and LIG4. • XRCC4K271R is deficient in DSB repair function. • XRCC4K210R is mostly normal in DSB repair function

  8. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    International Nuclear Information System (INIS)

    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins

  9. Crystal Growth in Al72.9Ge27.1 Alloy Melt under Acoustic Levitation Conditions

    Institute of Scientific and Technical Information of China (English)

    YAN Na; DAI Fu-Ping; WANG Wei-Li; WEI Bing-Bo

    2011-01-01

    The nonequilibrium solidification of liquid Al72.9Ge27.1 hypoeutectic alloy is accomplished by using single-axis acoustic levitation.A maximum undercooling of 112K (0.16TL) is obtained for the alloy melt at a coofing rate of 50 K/s. The primary (Al) phase displays a morphological transition from coarse dendrite under a normal conditions to equiaxed grain under acoustic levitation.In the (Al)+(Ge) eutectic,the (Ge) phase exhibits a conspicuous branched growth morphology.Both the primary (Al) dendrites and (Al)+(Ge) eutectics are well refined and the solute content of the primary (Al) phase is extended under acoustic levitation.The calculated and experimental results indicate that the solute trapping effect becomes more intensive with the enhancement of bulk undercooling.

  10. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Timofeev, V. I., E-mail: inna@ns.crys.ras.ru, E-mail: tostars@mail.ru, E-mail: ugama@yandex.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Abramchik, Yu. A. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Zhukhlistova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Muravieva, T. I.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

    2016-01-15

    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

  11. Phosphodiesterase 4 in inflammatory diseases: Effects of apremilast in psoriatic blood and in dermal myofibroblasts through the PDE4/CD271 complex.

    Science.gov (United States)

    Schafer, Peter H; Truzzi, Francesca; Parton, Anastasia; Wu, Lei; Kosek, Jolanta; Zhang, Ling-Hua; Horan, Gerald; Saltari, Annalisa; Quadri, Marika; Lotti, Roberta; Marconi, Alessandra; Pincelli, Carlo

    2016-07-01

    Phosphodiesterases 4 (PDE4) act as proinflammatory enzymes via degradation of cAMP, whereas PDE4 inhibitors play an anti-inflammatory role in vitro and in vivo. In particular, apremilast has been recently approved for the treatment of psoriasis and psoriatic arthritis. However, little is known on the expression pattern of PDE4 in psoriasis. We report that PDE4B and PDE4D mRNA are overexpressed in peripheral blood mononuclear cells (PBMC) from psoriasis, as compared with normal controls, while apremilast reduces PBMC production of a number of pro-inflammatory cytokines and increases the levels of anti-inflammatory mediators. PDE4 expression is up-regulated in psoriatic dermis as compared with normal skin, with particular regard to fibroblasts. This is confirmed in vitro, where both dermal fibroblasts (DF) and, to a greater extent, myofibroblasts (DM) express all PDE4 isoforms at the mRNA and protein level. Because PDE4 interacts with the nerve growth factor (NGF) receptor CD271 in lung fibroblasts, we evaluated the relationship and function of PDE4 and CD271 in normal human skin fibroblasts. All PDE4 isoforms co-immunoprecipitate with CD271 in DM, while apremilast inhibits apoptosis induced by β-amyloid, a CD271 ligand, in DM. Furthermore, apremilast significantly reduces NGF- and transforming growth factor-β1 (TGF-β1)-induced fibroblast migration, and inhibits DF differentiation into DM mediated by NGF or TGF-β1. Finally, in DM, apremilast significantly reduces cAMP degradation induced by treatment with β-amyloid. Taken together, these results indicate that PDE4 play an important role in psoriasis. In addition, the study reveals that the PDE4/CD271 complex could be important in modulating fibroblast functions. PMID:26806620

  12. Studies on some agronomic and quality characteristics of 271 induced early mutants of rice (Oryza sativa L. cv. Nizersail)

    International Nuclear Information System (INIS)

    Nizersail, the most popular, recommended rice variety in Bangladesh, was subjected to gamma-irradiation (10 - 25 kR) or ethyl methane sulfonate (EMS) (0.75 - 1.50%) treatments to obtain the mutants with stiff straw and early maturity. In the M2 generation, 29 gamma-ray- and 8 EMS-induced mutants were selected mainly for short culm length and earliness. Further selections were made in the segregating M3 and M4 populations, and finally 400 plants with short culm length were obtained. These 400 selections were grown in M5 lines, and 271 of these lines were analyzed for several characters. Heading time had singificantly shifted towards earliness in 40 lines. Yield per plant, 1,000-kernel weight, the length/breadth ratio of kernels, alkali spreading index value (indicator of amylose content) and dye-binding capacity (indicator of protein content) were significantly higher than those in the mother variety in 10 - 30% of the lines examined. However, no positive correlation among these characters was observed. Significant negative correlations were observed between heading time and 1,000-kernel weight, and between yield per plant and dye-binding capacity. These results suggest that the early heading plants may produce fewer tillers with bolder seeds, and that high yielding types may not simultaneously show high protein content. (Kaihara, S.)

  13. Clinical Significance of Serum NGF Level and CD271 Expression in Patients with Acute B Lymphoid Leukemia%急性B淋巴系白血病细胞CD271表达和血清神经生长因子水平的临床意义

    Institute of Scientific and Technical Information of China (English)

    韩秀华; 徐开林; 曾令宇; 李振宇

    2011-01-01

    The aim of this study was to detect the nerve growth factor (NGF) level in serum and NGF low affinity acceptor CD271 expression on bone marrow leukemic cells in acute B lymphoid leukemia (B-ALL) patients and to analyze their clinical significance. The NGF level in serum and CD271 expression on leukemic cells in bone marrow were detected by enzyme linked immunosorbent assay and flow cytometry in B-ALL patients respectively. The results indicated that compared with control group, the NGF level in serum of patient group significantly increased (r = 4.191, p 0. 05 vs t = 1. 150, p > 0. 05) as compared with control group. The CD271 expression before and after chemotherapy between CR and NR groups showed statistically significant differences (/ = 3. 889 ,p 0. 05). 50% (8/16) patients relapsed during following up, and of their NGF level [(168.00 ±61.66) pg/ml] and CD271 expression ((52. 29 ± 13.00)% ] showed the significantly differences, compared with those in control group (t =5. 284, p 0. 05 vs t = 1. 144 ,p > 0.05). Compared with low NGF level and CD271 low expression groups, the survival time of B-ALL patients with high NGF level and CD271 expression was not changed significantly (p = 0. 750 vs p = 0. 170). It is concluded that the increased NGF level in serum and decreased CD271 expression on bone marrow leukemic cells in B-ALL patients are related with leukemia development and may be the useful indexes to evaluate curative effect and prognosis.%本研究检测惠性B淋巴系白血病( B-ALL)患者血清神经生长因子(NGF)水平及骨髓白血病细胞群表面NGF低亲和性受体CD271的表达,并探讨两者的临床意义.应用酶标记免疫吸附分析法测定B-ALL患者血清NGF水平,应用流式细胞术测定患者骨髓白血病细胞群表面CD271的表达水平.结果表明,病例组患者NGF水平与对照组比较明显升高(t=4.191,p<0.05),而白血病细胞表面CD271表达与对照组比较明显降低(t=4.898,p<0.05).25例

  14. The -271 G>A polymorphism of kinase insert domain-containing receptor gene regulates its transcription level in patients with non-small cell lung cancer

    International Nuclear Information System (INIS)

    Kinase insert domain-containing receptor (KDR) plays a critical role in the metastasis of cancer and is used as a molecular target in cancer therapy. We investigated the characteristics of the -271 G>A polymorphism of the KDR gene to gain information that may benefit the development of individualized therapies for patients with non-small cell lung cancer (NSCLC). The -271 G>A polymorphism of the KDR gene in 106 lung cancer patients and 203 healthy control individuals was analyzed by polymerase chain reaction (PCR) and DNA sequencing methods. Real-time quantitative PCR and immunohistochemical methods were used to evaluate KDR mRNA and protein expression levels, respectively, in frozen tumor specimens. The -271 G>A polymorphism was associated with the mRNA expression level of the KDR gene in tumor tissues (t = 2.178, P = 0.032, independent samples t-test). Compared with the AG/GG genotype, the AA genotype was associated with higher KDR mRNA expression in tumor tissues. We found no relationship between the genotype and the KDR protein expression level and no significant difference in the distribution of the KDR gene polymorphism genotypes between lung cancer patients and the control group (χ2 = 1.269, P = 0.264, Fisher's exact test). This study is the first to show that the -271 G>A polymorphism of the KDR gene may be a functional polymorphism related to the regulation of gene transcription. These findings may have important implications for therapies targeting KDR in patients with NSCLC

  15. Early maladaptive schema factors, chronic pain and depressiveness: a study with 271 chronic pain patients and 331 control participants.

    Science.gov (United States)

    Saariaho, Tom; Saariaho, Anita; Karila, Irma; Joukamaa, Matti

    2012-01-01

    Chronic pain and depression are coexisting entities with high simultaneous prevalence. Both are linked with early adversities. Early maladaptive schemas (EMS) can be seen as a reflection of these adversities. EMSs extensively indicate underlying psychic patterns and provide a good opportunity to detect covert processes and psychic shapes (latent factors), which create the basis of how people rate their schemas. The purpose of this study was to explore these latent, higher order schema factors (SF) and to find out how they are associated with pain intensity or depression in chronic pain patients and a control sample. The study subjects consisted of 271 first-visit pain patients and 331 control participants. Sociodemographic and pain data were gathered by questionnaire; 18 EMSs were measured with the Young Schema Questionnaire (short form) and depressiveness was measured with the Beck Depression Inventory, Version II. Exploratory factor and regression analyses were used. The chronic pain patient group showed two SFs. The first SF showed a shameful, defective, socially isolated, failure, emotionally inhibited, deprived, submissive and resigned pattern. The second SF showed a demanding, approval seeking, self-sacrificing and punitive pattern. SF1 predicted more than half of the depressiveness in the pain patient sample. A three-factor structure was found in the control sample, and SFs 1 and 3 together predicted almost one-third of depressiveness. The pain patient and the control groups had a different, higher order factor structure. We assume that SF1 in the pain patients reflected a rather serious, undefined early psychic trauma and was also associated with their depressiveness. PMID:21210495

  16. The Study of Platelet Volume Indices in Platelet Aphaeresis Procedure: An Experience Of 271 Platelet Aphaeresis Procedures

    Directory of Open Access Journals (Sweden)

    Arpit C Patel

    2015-09-01

    Full Text Available Background: Platelet activity can be assessed by platelet volume indices like MPV, PDW and P-LCR. Aim: To develop an approach in blood bank professional, a habit of looking at platelet indices in hematology analyzer report of aphaeresis donors and QC samples of platelet aphaeresis products. Methods and materials: A retrospective data analysis was done for 271 platelet aphaeresis procedures conducted on CS3000 plus with AMS cell separator, Fenwal, USA and COM.TEC, Fresenius Kabi, Germany. Samples of the donors were collected before aphaeresis and 1 to 2 ml sample from each bag was collected in the satellite pouch attached to bag and analysis was done on day 0 and day 7. Platelet parameters were measured on automated hematology analyzers SYSMEX KX-21 and Horiba Micros 60.Statistical analysis: Statistical analysis was done by calculating and lsquo;r value' and a paired t test at 95 % confidence interval. A P value of <0.05 was taken as significant. Results: The mean platelet yield was 3.39+/-0.88 x 1011/unit. The platelet yield correlated negatively with MPV, PDW and PLCR (r value -0.224, -0.045 and -0.159 respectively for correlation between MPV, PDW and PLCR with the yield, P <0.0001.The mean values of PVI of SDP were significantly smaller than that of donor pre-donation samples (paired t test P value < 0.05.The size of stored single donor platelet on day 7 were significantly larger than that of day 0 (P value < 0.05. Conclusion: The platelet indices are useful to study - selectively smaller platelet separation by automated cell separators, storage lesions and yield prediction. [Natl J Med Res 2015; 5(3.000: 207-210

  17. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    Energy Technology Data Exchange (ETDEWEB)

    NNSA/NV

    2002-09-16

    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  18. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    International Nuclear Information System (INIS)

    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  19. Corrective Action Investigation Plan for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada (Rev. 0, April 2001); FINAL

    International Nuclear Information System (INIS)

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 271 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 271 consists of 15 Corrective Action Sites (CASs) including: thirteen Septic Systems (25-04-01, 25-04-03, 25-04-04, 25-04-08, 25-04-09, 25-04-10, 25-04-11, 26-04-01, 26-04-02, 26-05-03, 26-05-04, 26-05-05, and 27-05-02), one Contaminated Water Reservoir (26-03-01), and one Radioactive Leachfield (26-05-01). The CASs addressed by CAU 271 are located at Guard Station 500, the Reactor Control Point (RCP), Bare Reactor Experiment - Nevada Tower, and Engine Test State-1 (ETS-1) facilities in Area 25; the Port Gaston and Project Pluto facilities in Area 26; and the Baker Site in Area 27 of the Nevada Test Site. Between 1 958 and 1973, the RCP and ETS-1 facilities supported the development and testing of nuclear reactors for space propulsion as part of the Nuclear Rocket Development Station. The Project Pluto facilities supported nuclear reactor testing for use as a ramjet propulsion system between 1961 and 1964, followed by similar use for other projects through the early 1980s. The Baker Site facilities were constructed in the 1960s to serve as the staging point where the manufactured components of nuclear devices were assembled, disassembled, and modified. The scope of the investigation strategy at these sites will involve biased and random soil sampling in leachfields using excavation (with drilling as a contingency), collection of soil samples underlying the base of proximal and distal ends of septic tanks and distal ends of distribution structures, defining the lateral and vertical extent of contamination through discrete field and possible stepout location sampling, collection system line

  20. Corrective Action Investigation Plan for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada (Rev. 0, April 2001)

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office

    2001-04-09

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 271 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 271 consists of 15 Corrective Action Sites (CASs) including: thirteen Septic Systems (25-04-01, 25-04-03, 25-04-04, 25-04-08, 25-04-09, 25-04-10, 25-04-11, 26-04-01, 26-04-02, 26-05-03, 26-05-04, 26-05-05, and 27-05-02), one Contaminated Water Reservoir (26-03-01), and one Radioactive Leachfield (26-05-01). The CASs addressed by CAU 271 are located at Guard Station 500, the Reactor Control Point (RCP), Bare Reactor Experiment - Nevada Tower, and Engine Test State-1 (ETS-1) facilities in Area 25; the Port Gaston and Project Pluto facilities in Area 26; and the Baker Site in Area 27 of the Nevada Test Site. Between 1 958 and 1973, the RCP and ETS-1 facilities supported the development and testing of nuclear reactors for space propulsion as part of the Nuclear Rocket Development Station. The Project Pluto facilities supported nuclear reactor testing for use as a ramjet propulsion system between 1961 and 1964, followed by similar use for other projects through the early 1980s. The Baker Site facilities were constructed in the 1960s to serve as the staging point where the manufactured components of nuclear devices were assembled, disassembled, and modified. The scope of the investigation strategy at these sites will involve biased and random soil sampling in leachfields using excavation (with drilling as a contingency), collection of soil samples underlying the base of proximal and distal ends of septic tanks and distal ends of distribution structures, defining the lateral and vertical extent of contamination through discrete field and possible stepout location sampling, collection system line

  1. Generation of 1.5 W average power, 18 kHz repetition rate coherent mid-ultraviolet radiation at 271.2 nm.

    Science.gov (United States)

    Biswal, Ramakanta; Agrawal, Praveen K; Dixit, Sudhir K; Nakhe, Shankar V

    2015-11-10

    This paper presents to our knowledge a first time study on the generation of 1.5 W average power, 18 kHz repetition rate coherent mid-ultraviolet (UV) radiation at 271.2 nm. The work is based on frequency summing of coherent green (G: 510.6 nm) and yellow (Y: 578.2 nm) radiations of a copper-HBr laser in a β-barium borate crystal. Average and peak sum frequency conversion efficiencies of about 13% and 16%, respectively, are obtained. The sum frequency results are experimentally analyzed in terms of the extent of matching of green and yellow pump radiations in space, time, and frequency domains. The result is of high significance for many applications in photonics components fabrication, semiconductor technology, and spectroscopy. PMID:26560794

  2. Closure Report for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada with Errata Sheet, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Mark Krauss

    2004-08-01

    The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.

  3. Identification of urban agglomerations according to Directive 91/271/EC on urban wastewaters treatment: methodological proposal and application to the territory of Veneto Region

    International Nuclear Information System (INIS)

    The study discusses the problem of the identification and definition of the agglomerations for the Veneto regional territory according to Directive 91/271/EC to guarantee an adequate level of treatment for urban wastewaters and the achievement of the quality objectives for water bodies. The followed methodology, taking account of the existing planning in the water service sector, has been based on available data from ISTAT (National Statistical Institute) relative to the census sections, on the Regional Water Restoration Plan (PRRA), plan to be substituted with the Water Protection Plan, on the predictions of Water Service Plans prepared by each Water Authority (AATO and on the detailed indications of the same AATO. Moreover some considerations on the obtained results are presented and discussed.

  4. Development of an odd-Z-projectile reaction for heavy element synthesis: 208Pb(64Ni, n)271Ds and 208Pb(65Cu, n)272111

    International Nuclear Information System (INIS)

    Seven 271Ds decay chains were identified in the bombardment of 208Pb targets with 311.5- and 314.3-MeV 64Ni projectiles using the Berkeley Gas-filled Separator. These data, combined with previous results, provide an excitation function for this reaction. From these results, an optimum energy of 321 MeV was estimated for the production of 272111 in the reaction 208Pb(65Cu, n). One decay chain was observed, resulting in a cross section of 1.7-1.4+3.9 pb. This experiment confirms the discovery of element 111 by the Darmstadt group who used the 209Bi(64Ni, n)272111 reaction

  5. Glioma invasion mediated by the p75 neurotrophin receptor (p75(NTR)/CD271) requires regulated interaction with PDLIM1.

    Science.gov (United States)

    Ahn, B Y; Saldanha-Gama, R F G; Rahn, J J; Hao, X; Zhang, J; Dang, N-H; Alshehri, M; Robbins, S M; Senger, D L

    2016-03-17

    The invasive nature of glioblastoma renders them incurable by current therapeutic interventions. Using a novel invasive human glioma model, we previously identified the neurotrophin receptor p75(NTR) (aka CD271) as a mediator of glioma invasion. Herein, we provide evidence that preventing phosphorylation of p75(NTR) on S303 by pharmacological inhibition of PKA, or by a mutational strategy (S303G), cripples p75(NTR)-mediated glioma invasion resulting in serine phosphorylation within the C-terminal PDZ-binding motif (SPV) of p75(NTR). Consistent with this, deletion (ΔSPV) or mutation (SPM) of the PDZ motif results in abrogation of p75(NTR)-mediated invasion. Using a peptide-based strategy, we identified PDLIM1 as a novel signaling adaptor for p75(NTR) and provide the first evidence for a regulated interaction via S425 phosphorylation. Importantly, PDLIM1 was shown to interact with p75(NTR) in highly invasive patient-derived glioma stem cells/tumor-initiating cells and shRNA knockdown of PDLIM1 in vitro and in vivo results in complete ablation of p75(NTR)-mediated invasion. Collectively, these data demonstrate a requirement for a regulated interaction of p75(NTR) with PDLIM1 and suggest that targeting either the PDZ domain interactions and/or the phosphorylation of p75(NTR) by PKA could provide therapeutic strategies for patients with glioblastoma. PMID:26119933

  6. A new reading for the Abbasid dinar in the name of caliph Al-Mu tamid Ala Allah (AH 256-279) minted in Al-Ma Suq 271 AH

    OpenAIRE

    Atef Mansour, M. Ramadan

    2016-01-01

    The case of a dinar minted ill 271 AH recording the he Caliph al-Mu'tainid 'ala Allah (256-279 AH), al-Mufawwatj ila Allah (256-278 H), and an enigmatic mint place is discussed in the paper. The Author attempts to offer a new reading of the toponym of the mint using literary sources. The love story between al-Mu'tamid and a Bedouin girl, seems to unveil the identity of the mysterious mint.

  7. Antibody activity in ankylosing spondylitis sera to two sites on HLA B27.1 at the MHC groove region (within sequence 65-85), and to a Klebsiella pneumoniae nitrogenase reductase peptide (within sequence 181-199)

    OpenAIRE

    1990-01-01

    74 overlapping peptides of varying lengths from Klebsiella pneumoniae nitrogenase reductase (residues 181-199) and from the HLA B27.1 molecule (residues 65-85) were synthesized and tested by ELISA against sera from HLA B27+ ankylosing spondylitis (AS) patients, and sera from HLA B27+ and HLA B27- healthy first-degree relatives. Antibody activity in AS sera to Klebsiella peptides of four to eight amino acids was maximal with the peptide NSRQTDR. Activity to HLA B27 peptides was maximal with th...

  8. Paternity testing with VNTR DNA systems. II. Evaluation of 271 cases of disputed paternity with the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11

    DEFF Research Database (Denmark)

    Hansen, Hanna Elsebeth; Morling, N

    1993-01-01

    Paternity testing was carried out in 271 cases of disputed paternity using the 5 VNTR systems D2S44 (YNH24), D5S43 (MS8), D7S21 (MS31), D7S22 (g3), and D12S11 (MS43a), and 10-15 conventional marker systems including the HLA-A,B system. By means of the matching criteria for the VNTR systems...... established elsewhere (Morling & Hansen 1992), all 70 unrelated men who had been excluded by conventional typing were also excluded with 2 or more VNTR systems. Based on the observed exclusion frequencies for the 5 VNTR systems, a theoretical exclusion rate exceeding 0.999 could be obtained. A total of 350...

  9. Xylose reductase from the thermophilic fungus Talaromyces emersonii: cloning and heterologous expression of the native gene (Texr) and a double mutant (TexrK271R+N273D) with altered coenzyme specificity

    Indian Academy of Sciences (India)

    Sara Fernandes; Maria G Tuohy; Patrick G Murray

    2009-12-01

    Xylose reductase is involved in the first step of the fungal pentose catabolic pathway. The gene encoding xylose reductase (Texr) was isolated from the thermophilic fungus Talaromyces emersonii, expressed in Escherichia coli and purified to homogeneity. Texr encodes a 320 amino acid protein with a molecular weight of 36 kDa, which exhibited high sequence identity with other xylose reductase sequences and was shown to be a member of the aldoketoreductase (AKR) superfamily with a preference for reduced nicotinamide adenine dinucleotide phosphate (NADPH) as coenzyme. Given the potential application of xylose reductase enzymes that preferentially utilize the reduced form of nicotinamide adenine dinucleotide (NADH) rather than NADPH in the fermentation of five carbon sugars by genetically engineered microorganisms, the coenzyme selectivity of TeXR was altered by site-directed mutagenesis. The TeXRK271R+N273D double mutant displayed an altered coenzyme preference with a 16-fold improvement in NADH utilization relative to the wild type and therefore has the potential to reduce redox imbalance of xylose fermentation in recombinant S. cerevisiae strains. Expression of Texr was shown to be inducible by the same carbon sources responsible for the induction of genes encoding enzymes relevant to lignocellulose hydrolysis, suggesting a coordinated expression of intracellular and extracellular enzymes relevant to hydrolysis and metabolism of pentose sugars in T. emersonii in adaptation to its natural habitat. This indicates a potential advantage in survival and response to a nutrient-poor environment.

  10. AB271. Sexual dysfunction in chronic prostatitis

    Science.gov (United States)

    Cho, In-Rae

    2016-01-01

    Chronic prostatitis/ chronic pelvic pain syndrome (CP/CPPS), or NIH category III prostatitis, is a clinical syndrome characterized by genital/ pelvic pain and lower urinary tract symptoms in the absence of urinary tract infection. CPPS is the most common prostatic disease in men younger than 50 years of age and the third most common in men older than 50 years of age. CP/CPPS is a complex entity with unclear etiology. Many articles reported that the high percentage of patients with CP/CPPS had sexual dysfunction. The most common symptoms of sexual dysfunction in chronic prostatitis patients are erectile dysfunction (ED), painful ejaculation and premature ejaculation. So we will discuss about ED and ejaculation problems in CP/CPPS patients.

  11. AB271. Sexual dysfunction in chronic prostatitis

    OpenAIRE

    Cho, In-Rae

    2016-01-01

    Chronic prostatitis/ chronic pelvic pain syndrome (CP/CPPS), or NIH category III prostatitis, is a clinical syndrome characterized by genital/ pelvic pain and lower urinary tract symptoms in the absence of urinary tract infection. CPPS is the most common prostatic disease in men younger than 50 years of age and the third most common in men older than 50 years of age. CP/CPPS is a complex entity with unclear etiology. Many articles reported that the high percentage of patients with CP/CPPS had...

  12. 40 CFR 421.271 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... definitions, abbreviations, and methods of analysis set forth in 40 CFR part 401 shall apply to this subpart. (b) The term rare earth metals refers to the elements scandium, yttrium, and lanthanum to...

  13. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  14. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  15. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  16. 40 CFR 271.1 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... Emergency Revision of the Land Disposal Restrictions (LDR) Phase III Treatment Standards for Listed.... Sept. 4, 1998 Emergency Revision of the Land Disposal Restrictions (LDR) Phase III Treatment Standards..., 1985 Standards for the management of the burning of specific wastes in specific types of facilities...

  17. Dicty_cDB: SHL271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 091 8 BB822673 |BB822673.1 Mus musculus mammary gland RCB-0526 Jyg-MC(A) cDNA, RIKEN full-length enriched li...1 protein KIAA1033; 167 3e-49 AK145000_1( AK145000 |pid:none) Mus musculus mammary gland RCB-052... 167 3e-4...mpshl kqfklvpiwiqsfiifqiiyqrvlntlrcw*tfslqsfeislini*risissylpwpqit sii*sivkinslrnqkqsvlklyyslmmalqlvwlis*ny*...ue N BU746157 |BU746157.1 CH3#002_C07T7 Canine heart normalized cDNA Library in pBluescriptCanis fam...AFVNRCYSLIRNIISQFASI YQSQKNIHTQFFKNVHLQAVYYSMIDIFSVLINLDSIITQNTALD--- ---f*iildf*slilvmlwvildwsdpvvytivvmlsnsyqt*kkipkfqdltskdals

  18. Natural hazard phenomena and mitigation. PVP-Volume 271

    International Nuclear Information System (INIS)

    The intent of this volume is to serve as a focal point for researchers and engineers in state-of-the-art research and investigative development in natural hazard phenomena and mitigation, particularly relating to the engineering activities conducted at various waste facilities. This volume is heavily oriented towards seismic analysis. However, it is intended that over time, other natural hazard phenomena such as tornado and flood may also become significant topics of discussion. Papers are arranged in the following sections: Brookhaven, Argonne, and eastern regional natural hazards phenomena and mitigation programs; Oak Ridge and southern regional natural hazard phenomena and mitigation programs; and Hanford Site and western regional natural hazards phenomena and mitigation programs. Twenty papers have been processed separately for inclusion on the data base

  19. Dicty_cDB: VSA271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .ad.cDNA1 Anopheles gambiae cDNA clone 19600448419669 5', mRNA sequence. 54 8e-06 2 AQ874658 |AQ874658.1 V112D8 mTn-3xHA/lacZ Inse...q. 494 Connected seq. ID - Connected seq. - Length of connected se...) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15950-1 Original site URL http://dictycdb.biol.ts...lvyfvslqfniphswsihwlii*vtlhtm mnilqriql*lly*hlvkviitsimnsqmtietlinsinmiqlng*slqcii*awlmi*k lspkmklkkv*fkctkn...i*tqrnnqsigvsikkiyhq*qsmnliiwl Frame C: ---nrhfygsrfpnigswfrlg*lgwwlfllwctssrysst

  20. 48 CFR 1352.271-89 - Temporary services.

    Science.gov (United States)

    2010-10-01

    ... services. As prescribed in 48 CFR 1371.120, insert the following clause: Temporary Services (APR 2010) (a) Temporary services are services incidental to the performance of work which are required in the schedule or... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Temporary services....

  1. 77 FR 271 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2012-01-04

    ... February 8, 1996 (February 20, 1996, 61 FR 6427). Dated: December 29, 2011. Aaron Siegel, Alternate OSD... (December 4, 2009, 74 FR 63734). Changes: * * * * * System location(s): Delete entry and replace with... Division, Defense Threat Reduction Agency, Kleber Kaserne, Mannheimer Strasse, Building 3211, Room...

  2. 7 CFR 205.271 - Facility pest management practice standard.

    Science.gov (United States)

    2010-01-01

    ...) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling...) Management of environmental factors, such as temperature, light, humidity, atmosphere, and air circulation... controls including but not limited to traps, light, or sound; or (2) Lures and repellents...

  3. 1935 15' Quad #271 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  4. 40 CFR 52.271 - Malfunction, startup, and shutdown regulations.

    Science.gov (United States)

    2010-07-01

    ... on April 21, 1976. (ii) Rule 4f, submitted on June 30, 1972, and previously approved under 40 CFR 52... approved under 40 CFR 52.223 (37 FR 10842). (3) Calaveras County APCD. (i) Rules 110 and 402(f), submitted..., submitted on July 25, 1973, and Rule 4.4g, submitted on June 30, 1972, and previously approved under 40...

  5. 48 CFR 536.271 - Project labor agreements.

    Science.gov (United States)

    2010-10-01

    ..., subcontractors, and the union(s) representing workers. Under a PLA, the contractor and subcontractors on a project and the union(s) agree on terms and conditions of employment for the project, establishing...

  6. 7 CFR 271.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ..., in part: Congress hereby finds that the limited food purchasing power of low-income households... households to obtain a more nutritious diet through normal channels of trade by increasing food purchasing power for all eligible households who apply for participation. (b) Scope of the regulations. Part...

  7. 7 CFR 271.5 - Coupons as obligations of the United States, crimes and offenses.

    Science.gov (United States)

    2010-01-01

    ...) Coupons as obligations. Pursuant to section 15(d) of the Food Stamp Act, coupons are an obligation of the... nonfood items, moneys, negotiable instruments, securities, or other things of value furnished or...

  8. The isolated interacting galaxy pair NGC 5426/27 (Arp 271)

    CERN Document Server

    Fuentes-Carrera, I; Amram, P; Dultzin-Hacyan, D; Cruz-Gonzalez, I; Salo, H; Laurikainen, E; Bernal, A; Ambrocio-Cruz, P; Le Coarer, E

    2003-01-01

    We present H alpha observations of the isolated interacting galaxy pair NGC 5426/27 using the scanning Fabry-Perot interferometer PUMA. The velocity field, various kinematical parameters and rotation curve for each galaxy were derived. The FWHM map and the residual velocities map were also computed to study the role of non-circular motions of the gas. Most of these motions can be associated with the presence of spiral arms and structure such as central bars. We found a small bar-like structure in NGC 5426, a distorted velocity field for NGC 5427 and a bridge-like feature between both galaxies which seems to be associated with NGC 5426. Using the observed rotation curves, a range of possible masses was computed for each galaxy. These were compared with the orbital mass of the pair derived from the relative motion of the participants. The rotation curve of each galaxy was also used to fit different mass distribution models considering the most common theoretical dark halo models. An analysis of the interaction ...

  9. Dominance of multidrug resistant CC271 clones in macrolide-resistant streptococcus pneumoniae in Arizona

    Directory of Open Access Journals (Sweden)

    Bowers Jolene R

    2012-01-01

    Full Text Available Abstract Background Rates of resistance to macrolide antibiotics in Streptococcus pneumoniae are rising around the world due to the spread of mobile genetic elements harboring mef(E and erm(B genes and post-vaccine clonal expansion of strains that carry them. Results Characterization of 592 clinical isolates collected in Arizona over a 10 year period shows 23.6% are macrolide resistant. The largest portion of the macrolide-resistant population, 52%, is dual mef(E/erm(B-positive. All dual-positive isolates are multidrug-resistant clonal lineages of Taiwan19F-14, mostly multilocus sequence type 320, carrying the recently described transposon Tn2010. The remainder of the macrolide resistant S. pneumoniae collection includes 31% mef(E-positive, and 9% erm(B-positive strains. Conclusions The dual-positive, multidrug-resistant S. pneumoniae clones have likely expanded by switching to non-vaccine serotypes after the heptavalent pneumococcal conjugate vaccine release, and their success limits therapy options. This upsurge could have a considerable clinical impact in Arizona.

  10. 34 CFR 271.11 - Who may receive desegregation assistance under this program?

    Science.gov (United States)

    2010-07-01

    ... assistance only to the following persons: (1) Public school personnel. (2) Students enrolled in public schools, parents of those students, and other community members. (Authority: 42 U.S.C. 2000c-2)...

  11. Safety Study of MGA271 in Combination With Ipilimumab in Refractory Cancer

    Science.gov (United States)

    2016-05-03

    Melanoma; Head and Neck Cancer; Non Small Cell Lung Cancer; Mesothelioma; Urothelial Carcinoma; Clear Cell Renal Cell Carcinoma; Ovarian Cancer; Thyroid Cancer; Triple Negative Breast Cancer; Pancreatic Cancer; Colon Cancer; Soft Tissue Sarcoma; Prostate Cancer

  12. Safety Study of MGA271 in Combination With Pembrolizumab in Refractory Cancer

    Science.gov (United States)

    2016-05-03

    Melanoma; Head and Neck Cancer; Non Small Cell Lung Cancer; Mesothelioma; Urethelial Carcinoma; Clear Cell Renal Cell Carcinoma; Ovarian Cancer; Thyroid Cancer; Triple Negative Breast Cancer; Pancreatic Cancer; Colon Cancer; Soft Tissue Sarcoma; Prostate Cancer

  13. People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September

  14. IAEA Newsbriefs. V. 11, no. 2(71). Apr-May 1996

    International Nuclear Information System (INIS)

    This issue gives brief information on the following topics: Chernobyl Conference sums up Scientific Understanding, International Forum on the Safety of RBMK Reactors, IAEA Board of Governors, Radiological Study of the Mururoa and Fangataufa Atolls, Safeguards Support, Workshop on Modelling Methods for Water Systems, Uranium Market Trends, Security Council Resolution on Iraq, South East Asian NWFZ, Radioactive Waste Management, Nuclear Seminar in Poland, and other short information

  15. 48 CFR 1352.271-71 - Method of payment and invoicing instructions for ship repair.

    Science.gov (United States)

    2010-10-01

    ... prescribed in 48 CFR 1371.102, insert the following clause: Method of Payment and Invoicing Instructions for... of completion. The contractor may invoice for the percentage completed for each work item as work... work item may not be invoiced until the percentage complete reaches 25 percent. Future invoices...

  16. 271 A New Approach in the Social Field – Law No. 62/2011

    Directory of Open Access Journals (Sweden)

    Radu Răzvan Popescu

    2012-05-01

    Full Text Available Law no. 62/2011 of social dialogue, as it was regulated by the lawmaker, comes and reuniteswithin it a series of fundamental institutions in social matters, such as: social dialogue (trade unions,employees’ representatives, owners’ associations, the Economic and Social Council, the collectiveemployment contract, labour conflicts and, not lastly, a series of elements pertaining to labour jurisdiction. Itthus abrogates the old regulations in the matter: Law no. 54/2003 with respect to trade unions, Law no.356/2001 regarding owners’ associations, Law no. 109/1997 regarding the organizing and functioning of theEconomic and Social Council, Law no. 130/1996 with respect to the collective employment contracts, Lawno. 168/1999 regarding the settling of labour conflicts and Government Decision (G.D. no. 369/2009regarding the establishment and functioning of the social dialogue commissions at the level of the centralpublic administration and at the territorial level.

  17. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  18. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  19. Kinetics of Severe Acute Respiratory Syndrome (SARS) Coronavirus-Specific Antibodies in 271 Laboratory-Confirmed Cases of SARS

    OpenAIRE

    He, Zhongping; Dong, Qingming; Zhuang, Hui; Song, Shujing; Peng, Guoai; Luo, Guangxiang; Dwyer, Dominic E.

    2004-01-01

    The sensitivities and specificities of an immunofluorescence assay and an enzyme immunoassay for detection of antibodies specific for severe acute respiratory syndrome coronavirus (SARS-CoV) were compared for 148 laboratory-confirmed SARS cases. The appearance and persistence of SARS-CoV-specific antibodies were assessed, with immunoglobulin G detected in 59% of samples collected within 14 days and persisting for 60 to 95 days after the onset of illness.

  20. SU-E-J-271: Correlation of CT Number Change with Radiation Treatment Response for Pancreatic Cancer

    International Nuclear Information System (INIS)

    Purpose: It has been reported recently that radiation can induce CT number (CTN) change during radiation therapy (RT) delivery. In the effort to explore whether CTN can be used to assess RT response, we analyze the relationship between the pathological treatment response (PTR) and the changes of CTN, MRI, and PET before and after the neoadjuvant chemoradiation (nCR) for pancreatic adenocarcinoma. Methods: The preand post-nCR CT, MRI, and PET data for a total of 8 patients with resectable, or borderline resectable pancreatic head adenocarcinoma treated with nCR were retrospectively analyzed. Radiographic characteristics were correlated to PTR data. The histograms, means and standard derivations (SD) of the CTNs in pancreatic head (CTNPH), the GTV defined by ADC (CTNGTV), and the rest of pancreatic head (CTNPH-CTNGTV) were compared. Changes before and after nCR were correlated with the corresponding changes of ADC, lean body mass normalized SUV (SUVlb), and PTR using Pearson’ s correlation coefficient test. Results: The average mean and SD in CTPH for all the patients analyzed were higher in post-nCR (53.17 ± 31.05 HU) compared to those at pre-nCR (28.09 ± 4.253 HU). The CTNGTV were generally higher than CTNPH and CTNPH-CTNGTV, though the differences were not significant. The post-nCR changes of mean CTN, ADC, and SUVlb values in pancreatic head were correlated with PTR (R=0.3273/P=0.5357, R=−0.5455/P<0.0001, and R=0.7638/P=0.0357, respectively). The mean difference in the maximum tumor dimension measured from CTN, ADC, and SUVlb as compared with pathological measurements was −2.1, −0.5, and 0.22 cm, respectively. Conclusion: The radiation-induced change of CTN in pancreas head after chemoradiation therapy of pancreatic cancer was observed, which may be related to treatment responses as assessed by biological imaging and pathology. More data are needed to determine whether the CTN can be used as a quantitative biomarker for response to neoadjuvant therapy

  1. Tomato (Lycopersicon esculentum, cv CXD271BIO) yield and quality during converion from conventional to organic production

    OpenAIRE

    Nardo, N; Foddai, MS; E.Azzini; Baiamonte, I; Di Ferdinando, S; Paoletti, S.; Vizioli, V; Paoletti, F.

    2011-01-01

    The conversion of a conventional farm to the methods of the organic farming is a very critical stage of technical and economical investment. From an agronomical point of view, usually the conversion needs a very different length of time with respect to that set by the regulation, because the organic farming is based on the soil fertility and, in general, on the preservation at the equilibrium of the farm’s ecosystem. These elements affect time and method of the conversions that, although base...

  2. SU-E-J-271: Correlation of CT Number Change with Radiation Treatment Response for Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Dalah, E; Tai, A; Oshima, K; Hall, W; Knechtges, P; Erickson, B; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2015-06-15

    Purpose: It has been reported recently that radiation can induce CT number (CTN) change during radiation therapy (RT) delivery. In the effort to explore whether CTN can be used to assess RT response, we analyze the relationship between the pathological treatment response (PTR) and the changes of CTN, MRI, and PET before and after the neoadjuvant chemoradiation (nCR) for pancreatic adenocarcinoma. Methods: The preand post-nCR CT, MRI, and PET data for a total of 8 patients with resectable, or borderline resectable pancreatic head adenocarcinoma treated with nCR were retrospectively analyzed. Radiographic characteristics were correlated to PTR data. The histograms, means and standard derivations (SD) of the CTNs in pancreatic head (CTNPH), the GTV defined by ADC (CTNGTV), and the rest of pancreatic head (CTNPH-CTNGTV) were compared. Changes before and after nCR were correlated with the corresponding changes of ADC, lean body mass normalized SUV (SUVlb), and PTR using Pearson’ s correlation coefficient test. Results: The average mean and SD in CTPH for all the patients analyzed were higher in post-nCR (53.17 ± 31.05 HU) compared to those at pre-nCR (28.09 ± 4.253 HU). The CTNGTV were generally higher than CTNPH and CTNPH-CTNGTV, though the differences were not significant. The post-nCR changes of mean CTN, ADC, and SUVlb values in pancreatic head were correlated with PTR (R=0.3273/P=0.5357, R=−0.5455/P<0.0001, and R=0.7638/P=0.0357, respectively). The mean difference in the maximum tumor dimension measured from CTN, ADC, and SUVlb as compared with pathological measurements was −2.1, −0.5, and 0.22 cm, respectively. Conclusion: The radiation-induced change of CTN in pancreas head after chemoradiation therapy of pancreatic cancer was observed, which may be related to treatment responses as assessed by biological imaging and pathology. More data are needed to determine whether the CTN can be used as a quantitative biomarker for response to neoadjuvant therapy.

  3. Synthesis of carbon-14 labelled CD 271 (6-[3-(1-adamantyl)-4-methoxyphenyl]-2-naphthoic acid): a potential new agent for dermatology

    International Nuclear Information System (INIS)

    6-[3-(1-Adamantyl)-4-methoxyphenyl]-2-naphthoic acid, a promising new compound for the treatment of disorders of keratinization, has been synthesized in [14C]-labelled form from barium[14C]-carbonate via labelled benzene. Benzene-[U-14C] was converted to 4-bromo-methoxybenzene-[phenyl-U-14C] in six steps. Introduction of the adamantyl ring was carried out using 1-acetoxyadamantane under acid catalysis. 2-(1-Adamantyl)-4-bromo-methoxybenzene-[phenyl-U-14C] was converted to a zincate and coupled with methyl 6-bromo-2-naphthoate using a nickel catalyst. The product of the aryl coupling reaction was then saponified to give 6-[3-(1-adamantyl)-4-methoxyphenyl-[phenyl-U-14C

  4. External control of fluoridation of public water supplies of the city of Jaguaribara, Ceará, Brazil - doi: 10.5020/18061230.2012.p271

    Directory of Open Access Journals (Sweden)

    Daniel Fernandes Peixoto

    2012-11-01

    Full Text Available Objective: To monitor the levels of fluoride (F in public water supplies in the city of Jaguaribara, Ceará, Brazil. Methods: Water samples were collected from the urban area, at three different points. Samples were collected twice a month, from August 2010 to July 2011. The samples were analyzed in triplicate, using the combined electrode connected to a meter, previously calibrated with standards containing 0.2 to 6.4 ppm F, with Tisab II. Data was analyzed by three criteria: I (Brazil, 1975, II (Ramires et al., 2006 and III (Technical Consensus, 2011. results: Among a total of 72 water samples, we observed an average of 0.55 (± 0.19 ppm F, median of 0.61. According to Criterion I, acceptable levels of fluoride were found in 47.2% of samples, while 44,4% were underfluoridated ( 0.84 ppm F. Based on criterion III, 25% of samples showed negligible risk and benefits concerning dental fluorosis and prevention of dental caries, while 11.1% of the samples presented low risk and benefit and 63.9% pointed to low risk and maximum benefit. Conclusions: Altered levels of fluoride were observed in public water supplies in the studied period. It is suggested the need to improve operational control and also the external control of water fluoridation in Jaguaribara, Ceará, Brazil

  5. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    OpenAIRE

    Yan-Ling Liang; Zheng Zhang; Min Wu; Yuan Wu; Jia-Xun Feng

    2014-01-01

    From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36...

  6. SU-E-J-271: A Feasibility Study to Utilize XR-QA2 Radiochromic Films as An Alternative Tool for Measuring Beam Parameters of Kilovoltage CBCT Systems

    Energy Technology Data Exchange (ETDEWEB)

    Morales-Paliza, M; Ding, G [Vanderbilt University, Nashville, TN (United States)

    2014-06-01

    Purpose: The beam parameters of the x-ray beams used in image guidance are difficult to measure in water due to the low exposure. This study is to investigate if XR-QA2 radiochromic films can be used in obtaining beam parameters, such as beam profiles and outputs for kV-CBCT systems. Methods: The kV-CBCT beams were from a Varian OBI system. The films used were XR-QA2-GAFCHROMICTM films placed in the middle of two Plastic -Water slab phantoms at isocenter. The scanner used to analyze the films was an Epson Expression 1680 flat-bed scanner. Pre and 24 h-post-irradiated scans of films were obtained by using the reflective mode. The corresponding pixel-by-pixel dose in the films was obtained using a dose calibration equation as a function of net reflectance from the literature. Beam profiles of different scan protocols with and without bow-tie filters were measured. Monte Carlo simulations were used to compare the accuracy of the measured dose profiles. Results: The beam profiles measured from XR-QA2 films for different clinical default kV-CBCT scan protocols were benchmarked against Monte Carlo simulated profiles which have been validated by measurements performed in water phantom. We confirmed that a minimum post-irradiated time of 24 hours is necessary to pass to scan the films to account for light scatter stability. We found that the uncertainties of the results depend on the scan orientation of the film when analyzed in different directions. Conclusion: The XR-QA2 radiochromic films are sensitive to measure the x-ray beam profiles with irradiated dose ranging 1–5 cGy. The film measurements can be performed with an easy setup compared to ion chamber measurements in a water phantom. These films provide an alternative method to obtain the beam profiles for kV-CBCT beams.

  7. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  8. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  9. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  10. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  11. Dependence theories: approaches on the development of Latin America - doi: 10.4025/dialogos.v11i1e2.71 Teorías de la dependencia: enfoques sobre el desarrollo Latinoamericano Teorias da dependência: abordagens sobre o desenvolvimento Latino-Americano - doi: 10.4025/dialogos.v11i1e2.71

    Directory of Open Access Journals (Sweden)

    Paulo José Koling

    2010-05-01

    Full Text Available Elements on the theoretical approaches with regard to Latin American development and analyses of its international economic insertion are provided. Periphery, revision of dependence theories and aspects of the debate among “dependentists” are analyzed. The dual focus of civilization and barbarity was dominant during the 19th century and within the context of traditional Latin American intellectual thought on the insertion of the new countries within world economy. This was corroborated by the Ricardian theory of comparative advantages within the international work division, criticized by the Economical Commission for Latin America (CEPAL. In the context of dependence revision, critique on Rostowian and Cepal structuralism will be undertaken. Aspects of the discussion among intellectuals on dependence theories with regard to the relationship between dependence and development and nuances on its publicity in Brazil will be given and investigatedEn este artículo presentamos algunos elementos de los enfoques teóricos realizados sobre el desarrollo latinoamericano y sus análisis de las formas de inserción económica internacional, destacando la visión del pensamiento periférico, la revisión de las teorías de la dependencia y los aspectos del debate entre los dependentistas. Para el estudio de la inserción de los nuevos países de la región en la economía mundial del siglo XIX, en la “tradición” latinoamericana predominó el enfoque dualista de “civilización o barbarie” y la teoría ricardiana sobre las ventajas comparativas de la división internacional del trabajo que, por su parte, fue la base de la crítica producida por la Comisión Económica para América Latina (CEPAL. Inicialmente, de la revisión dependentista analizamos su crítica al estructuralismo rostowiano y al cepalino; luego, situamos los aspectos de la discusión realizada entre los intelectuales de las teorías de la dependencia, en lo que se refiere a la relación entre dependencia y desarrollo y los matices de su divulgación en Brasil.Neste artigo apresentamos alguns elementos das abordagens teóricas realizadas sobre o desenvolvimento latino-americano e suas análises das formas de inserção econômica internacional, destacando a visão do pensamento periférico, a revisão das teorias da dependência e aspectos do debate entre dependentistas. Tratando-se do século XIX, na “tradição” intelectual latino-americana sobre a inserção dos novos países da região na economia mundial predominou o enfoque dualista da civilização ou da barbárie e a teoria ricardiana das vantagens comparativas na divisão internacional do trabalho, que, por sua vez, foi base da crítica produzida pela Comissão Econômica para a América Latina (CEPAL. Da revisão dependentista analisamos, inicialmente, sua crítica ao estruturalismo rostowiano e ao cepalino, e, em seguida, situaremos aspectos da discussão realizada entre intelectuais das teorias da dependência, no que se refere à relação entre a dependência e o desenvolvimento, e nuanças de sua publicização no Brasil.

  12. Protein (Viridiplantae): 308800386 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available XP_003074974.1 33090:9081 3041:2946 1035538:271 13792:271 70447:342 70448:116 repli...EYFQEVTDTQFIPIQFCQSQTCNKNFALFIETRASKFAKYQELRIQELSEDVPVGHVPRSMSVTLIGDMTRKLSPGDIANISGIFLPRQSAGYSGSSSLVSTTYLYAMSVEPLKSQQAESEETPELIKRX ...

  13. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  14. Has the Constitutional Court found the lost ball in the high weeds? The interpretation of section 231 of the South African Constitution' The Comparative and International Law Journal of Southern Africa (2009) 264-271

    OpenAIRE

    Ferreira, Gerrit; Scholtz, Werner

    2009-01-01

    A critical discussion of President of the Republic of South Africa and Others v Quagliani and Others case CCT 24/08 (CC)(unreported) decided on 21 January 2009 http://search.sabinet.co.za/WebZ/Authorize?sessionid=0&next=ej/ej_content_cilsa.html&bad=error/authofail.html

  15. Erratum: Correction to Table 3, in: Equivalent threshold sound pressure levels (ETSPL) for Sennheiser HDA 280 supra-aural audiometric earphones in the frequency range 125 Hz to 8000 Hz (International Journal of Audiology (2009) 48 (271-276))

    DEFF Research Database (Denmark)

    Poulsen, Torben

    2014-01-01

    The main results in Poulsen & Oakley (2009) are given as the equivalent threshold sound pressure level, ETSPL, measured in an acoustic coupler specifi ed in IEC 60318-3. These results are all correct. The ETSPL values for the ear simulator specifi ed in IEC 60318-1 were calculated from acoustic l...

  16. Final Report of a CRADA Between Pacific Northwest National Laboratory and the General Motors Company (CRADA No. PNNL/271): “Degradation Mechanisms of Urea Selective Catalytic Reduction Technology”

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Do Heui; Lee, Jong H.; Peden, Charles HF; Howden, Ken; Kim, Chang H.; Oh, Se H.; Schmieg, Steven J.; Wiebenga, Michelle H.

    2011-12-13

    Diesel engines can offer substantially higher fuel efficiency, good driving performance characteristics, and reduced carbon dioxide (CO2) emission compared to stoichiometric gasoline engines. Despite the increasing public demand for higher fuel economy and reduced dependency on imported oil, however, meeting the stringent emission standards with affordable methods has been a major challenge for the wide application of these fuel-efficient engines in the US market. The selective catalytic reduction of NOx by urea (urea-SCR) is one of the most promising technologies for NOx emission control for diesel engine exhausts. To ensure successful NOx emission control in the urea-SCR technology, both a diesel oxidation catalyst (DOC) and a urea-SCR catalyst with high activity and durability are critical for the emission control system. Because the use of this technology for light-duty diesel vehicle applications is new, the relative lack of experience makes it especially challenging to satisfy the durability requirements. Of particular concern is being able to realistically simulate actual field aging of the catalyst systems under laboratory conditions, which is necessary both as a rapid assessment tool for verifying improved performance and certifiability of new catalyst formulations. In addition, it is imperative to develop a good understanding of deactivation mechanisms to help develop improved catalyst materials. In this CRADA program, General Motors Company and PNNL have investigated fresh, laboratory- and vehicle-aged DOC and SCR catalysts. The studies have led to a better understanding of various aging factors that impact the long-term performance of catalysts used in the urea-SCR technology, and have improved the correlation between laboratory and vehicle aging for reduced development time and cost. This Final Report briefly highlights many of the technical accomplishments and documents the productivity of the program in terms of peer-reviewed scientific publications (2 total), reports (3 total including this Final Report), and presentations (5 total).

  17. Logical analysis of biological systems

    DEFF Research Database (Denmark)

    Mardare, Radu Iulian

    2005-01-01

    R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005.......R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005....

  18. A new Doppler type system for measuring the ionospheric effects of infrasound developed in the IAP

    Czech Academy of Sciences Publication Activity Database

    Hruška, František; Chum, Jaroslav; Maděra, Jiří; Laštovička, Jan; Burešová, Dalia; Šindelářová, Tereza

    Chilton: Rutherford Appleton Laboratory, 2004, s. -. [Workshop "Significant results in COST271 action" /3./.. Spetses (GR), 23.09.2003-25.09.2003] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere * infrasound Subject RIV: DG - Athmosphere Sciences, Meteorology http://www.COST271.rl.ac.uk

  19. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  20. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  1. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  2. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  3. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  4. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  5. Existing Analytical Frameworks for Information Behaviour Don’t Fully Explain HIV/AIDS Information Exchange in Rural Communities in Ontario, Canada. A Review of: Veinot, T., Harris, R., Bella, L., Rootman, I., & Krajnak, J. (2006). HIV/AIDS Information exchange in rural communities: Preliminary findings from a three‐province study. Canadian Journal of Information and Library Science, 30(3/4), 271‐290.

    OpenAIRE

    Kate Kelly

    2010-01-01

    Objective – To explore and analyze, against three theoretical frameworks of information behaviours, how people with HIV/AIDS, their friends, and their family living in rural communities find information on HIV/AIDS.Design – Qualitative, individual, in‐depth, semi‐structured interviews.Setting – Two rural regions in Ontario, Canada.Subjects – Sixteen participants; 10 people with HIV/AIDS (PHAs) and 6 family members or friends.Methods – Participants were recruited through health care providers,...

  6. Existing Analytical Frameworks for Information Behaviour Don’t Fully Explain HIV/AIDS Information Exchange in Rural Communities in Ontario, Canada. A Review of: Veinot, T., Harris, R., Bella, L., Rootman, I., & Krajnak, J. (2006. HIV/AIDS Information exchange in rural communities: Preliminary findings from a three‐province study. Canadian Journal of Information and Library Science, 30(3/4, 271‐290.

    Directory of Open Access Journals (Sweden)

    Kate Kelly

    2010-03-01

    Full Text Available Objective – To explore and analyze, against three theoretical frameworks of information behaviours, how people with HIV/AIDS, their friends, and their family living in rural communities find information on HIV/AIDS.Design – Qualitative, individual, in‐depth, semi‐structured interviews.Setting – Two rural regions in Ontario, Canada.Subjects – Sixteen participants; 10 people with HIV/AIDS (PHAs and 6 family members or friends.Methods – Participants were recruited through health care providers, social service agencies and through snowball sampling. Semi‐structure interviews were conducted focusing on participants’ experience with HIV/AIDS, how they find and use information on HIV/AIDS, networks for information exchange and the effect of technology on information exchange. Interviews were taped, transcribed, analyzed qualitatively using NVivo software. Results were compared to three theoretical frameworks for information behaviour: 1. purposeful information seeking (i.e., the idea that people purposefully seek information to bridge perceived knowledge gaps; 2. non‐purposeful or incidental information acquisition (i.e., the idea that people absorb information from going about daily activities; and 3. information gate keeping (i.e., the concept of private individuals who act as community links and filters for information gathering and dissemination.Main Results – Consistent with the theories:•PHAs prefer to receive information from people they have a personal relationship with, particularly their physician and especially other PHAs.•PHAs’ friends and families rely on their friends and family for information, and are particularly reliant upon the PHA in their lives.•Fear of stigma and discrimination cause some to avoid seeking information or to prefer certain sources of information, such as healthcare providers, who are bound by codes of professional conduct.•Emotional support is important in information provision and its presence supersedes the professional role of the provider (social workers and counsellors were identified as key information sources over medical professionals in this instance. Participants responded negatively to the perceived lack of support from providers including doubting the information provided.•PHAs monitor their worlds and keep up to date about HIV/AIDS.Inconsistent with theories:•Reliance on caregivers for information is not solely explained by fear of stigma or exposure. Rather, it is the specialized knowledge and immersion in HIV/AIDS which is valued.•The distinction between peer or kin sources of information and institutional information sources is less clear and relationships with professionals can turn personal over time.•Inter‐personal connections include organisations, not just individuals, particularly AIDS Service Organizations and HIV specialist clinics.•Relatively few incidents of finding useful information about HIV/AIDS incidentally were described. The concept of information just being “out there” was not really applicable to rural settings, likely due to the lack of discussion within participant communities and local media. When it was discussed, participants reported being more likely to gain misinformation through their personal networks.•Incidental information acquisition originates mostly from professional and organisational sources. Participants identified posters, leaflets, and, for those who interacted with organisations, information via mail as contributing to current awareness.•The gate keeping concept does not capture all the information sharing activities undertaken by “gate keepers” in rural areas, and neither does it include formal providers of information, yet all PHAs interviewed identified formal providers as key sources.Conclusion – The findings reinforce some of the existing analytical framework theories, particularly the importance of affective components (i.e. emotional supports of information seeking, the presence of monitoring behaviours, and of interpersonal sources of information. However, alternate theories may need to be explored as the role of institutional information sources in the lives of PHAs doesn’t match the theoretical predication and the “gate keeper” concept doesn’t capture a significant portion of that role in rural HIV/AIDS information exchange.

  7. Fracture Analysis of Functionally Graded Materials by a BEM

    OpenAIRE

    Gao, X.W.; Zhang, Ch.; Sladek, J.; Sladek, V.

    2009-01-01

    Fracture Analysis of Functionally Graded Materials by a BEM correspondance: Corresponding author. Tel.: +49 271 7402173; fax: +49 271 7404074. (Zhang, Ch.) (Zhang, Ch.) Department of Engineering Mechanics--> , Southeast University--> , Nanjing--> - CHINA (Gao, X.W.) Department of Civil Engineering--> , University of Siegen--> , D-57068 Siegen--> - GERMANY (Zhang, ...

  8. 12 CFR 707.9 - Enforcement and record retention.

    Science.gov (United States)

    2010-01-01

    ... TISA (12 U.S.C. 4309) contains the provisions relating to administrative sanctions for failure to comply with the requirements of TISA and this part. (b) Civil liability. Section 271 of TISA (12 U.S.C... of TISA and this part; Section 271 is repealed effective September 30, 2001. (c) Record retention....

  9. Unigene BLAST: CBRC-CELE-05-0263 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0263 gnl|UG|Cel#S5711007 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-271) (srh-271) mRNA, complete cds /cds=p(87,1091) /gb=NM_071317 /gi=72000840 /ug=Cel.2035 /len=1091 1e-55 34% ...

  10. Moulting and moult quality in eye-stalk ablated penaeid prawn, Metapenaeus monoceros (Fabricius)

    Digital Repository Service at National Institute of Oceanography (India)

    Venkitaraman, P.R.; Sivadas, P.

    stream_size 3 stream_content_type text/plain stream_name 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt stream_source_info 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  11. Field measurement on longshore current variation between Ratnagiri and Mangalore, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Chandramohan, P.; Nayak, B.U.; Anand, N.M.; SanilKumar, V.

    stream_size 12 stream_content_type text/plain stream_name 8_Conf_Int_Assoc_Hydraulic_Res_Proc_1992_D.271.pdf.txt stream_source_info 8_Conf_Int_Assoc_Hydraulic_Res_Proc_1992_D.271.pdf.txt Content-Encoding ISO-8859-1 Content...

  12. Fresh water influx and particle flux variability in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Schafer, P.; Ittekkot, V.; Bartsch, M.; Nair, R.R.; Tiemann, J.

    stream_size 22 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  13. Use of acoustic systems for underwater archaeology

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.

    stream_size 2 stream_content_type text/plain stream_name J_Mar_Archaeol_2_71.pdf.txt stream_source_info J_Mar_Archaeol_2_71.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Drug: D03742 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03742 Drug Dextromethorphan (USP) C18H25NO 271.1936 271.3972 D03742.gif Antitussive Same as: C0 ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ...

  15. Trends in the ionospheric D and E regions using results of different radio propagation experiments

    Czech Academy of Sciences Publication Activity Database

    Bremer, J.; Laštovička, Jan

    Oxford: AppletonRutherford Laboratory, 2003, s. -. [ Communications COST 271. Faro (PT), 02.10.2003-04.10.2003] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : trends * ionosphere Subject RIV: DG - Athmosphere Sciences, Meteorology

  16. Oriented stochastic data envelopment models: ranking comparison to stochastic frontier approach

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František

    -, č. 271 (2005), s. 1-46. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : stochastic data envelopment analysis * linear programming * rice farm Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp271.pdf

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  18. PDB: CBRC-GGOR-01-0300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0300 3ODU,3OE0,3OE6,3OE8,3OE9, Region:8-271(Identity=98%) PDB:3ODU Chain:A (X-ray Resolution...=2.5),Region:8-271(Identity=98%) PDB:3OE0 Chain:A (X-ray Resolution=2.9),Region:8-271(...Identity=98%) PDB:3OE6 Chain:A (X-ray Resolution=3.2),Region:8-271(Identity=98%) PDB:3OE8 Chain:A (X-ray Resolution...=3.1),Region:8-271(Identity=98%) PDB:3OE9 Chain:A (X-ray Resolution=3.1), ...

  19. Dicty_cDB: Contig-U03262-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available entities = 271/271 (100%) Strand = Plus / Plus Query: 1 actagattaagaaagttttatccttaaatatttccgcataatacagtgtactttttata...tg 271 Score = 339 bits (171), Expect = 3e-93 Identities = 171/171 (100%) Strand = Plus / Plus Query: 723 tgaaaaaggaaata... 42.1 bits (21), Expect = 0.001 Identities = 21/21 (100%) Strand = Plus / Plus Query: 381 tgtaaatat...Number of successful extensions: 1914 Number of sequences better than 10.0: 199 length of query: 893 length of data... ( FF897966 ) CBWU31571.g1 Yutaka Satou unpublished cDNA librar... 30 1.1 4 ( CP001161 ) Buchnera aphidicola

  20. Structural analysis of an HLA-B27 functional variant: identification of residues that contribute to the specificity of recognition by cytolytic T lymphocytes.

    OpenAIRE

    Vega, M A; Ezquerra, A.; S Rojo; Aparicio, P.; Bragado, R; López de Castro, J. A.

    1985-01-01

    The structure of a variant HLA-B27 antigen, B27.2, that is distinguished from the HLA-B27.1 and HLA-B27.3 subgroups by specific cytolytic T lymphocytes has been established by comparative peptide mapping and sequence analysis. There are only three amino acid substitutions between B27.1 and B27.2: aspartate-77, threonine-80, and leucine-81 in HLA-B27.1 are changed to asparagine-77, isoleucine-80, and alanine-81 in HLA-B27.2. These changes account for their single charge difference detectable b...

  1. ОВСЯНОВ А. П. У НИХ ЕСТЬ РОДИНА: СУДЬБЫ ПЕРЕМЕЩЕННЫХ ЦЕННОСТЕЙ. М.: РОССИЙСКАЯ ПОЛИТИЧЕСКАЯ ЭНЦИКЛОПЕДИЯ (РОССПЭН), 2010. 271 С. ISBN 978-5-8243-1244-7

    OpenAIRE

    Чебаненко, Сергей

    2011-01-01

    Книга А. П. Овсянова посвящена проблемам поиска культурных ценностей, перемещенных во время Второй мировой войны. В центре внимания Калининградская область, территория бывшей Восточной Пруссии со столицей в Кенигсберге. В работе рассматриваются вопросы, связанные как с поиском вещей, вывезенных немцами с территории Советского Союза и укрытых ими перед наступлением советских войск, так и предметами, входившими в состав музейных собраний Восточной Пруссии....

  2. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  3. Raně středověké pohřebiště v Mělníku-Rousovicích

    Czech Academy of Sciences Publication Activity Database

    Tomková, Kateřina; Košta, J.

    2015-01-01

    Roč. 19, č. 1 (2015), s. 271-318. ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Early Middle Age * Bohemia * cemetery * jewellery Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Protein (Viridiplantae): 255079266 [

    Lifescience Database Archive (English)

    Full Text Available XP_002503213.1 33090:2493 3041:1776 1035538:1226 13792:1226 38832:601 296587:271 ubiquitin prote ... in ligase, gene model ... incomplete Micromonas sp. RCC299 MVESWGLAPEHHIQINR ...

  5. Shorelines Extracted from 1984-2015 Landsat Imagery: Petit Bois Island, Mississippi (Polygon: Individual Dates)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Shorelines Extracted from 1984-2015 Landsat Imagery: Petit Bois Island, Mississippi (Polygon: Individual Dates) is a dataset consisting of 271 polygon shapefiles...

  6. Replication of recently identified systemic lupus erythematosus genetic associations: a case-control study

    Czech Academy of Sciences Publication Activity Database

    Suarez-Gestal, M.; Calaza, M.; Endreffy, E.; Pullmann, R.; Ordi-Ros, J.; Sebastiani, D.G.; Růžičková, Šárka; Santos, J.M.; Papasteriades, C.; Marchini, M.; Skopouli, F.N.; Suarez, A.; Blanco, F.J.; D'Alfonso, S.; Bijl, M.; Carreira, P.; Witte, T.; Migliaresi, S.; Gomez-Reino, J.J.; Gonzalez, A.

    2009-01-01

    Roč. 11, č. 3 (2009), R69. ISSN 1478-6362 Keywords : Single nucleotide polymorphism susceptibility * sytemic lupus erythematosus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.271, year: 2009

  7. Kostel Nanebevzetí Panny Marie v Andělské Hoře (okr. Bruntál) a jeho renesanční podoba

    Czech Academy of Sciences Publication Activity Database

    Dvorská, H.; Prix, Dalibor

    Praha : Arte factum, 2002 - (Prix, D.), s. 271-282 ISBN 80-903230-1-4 Institutional research plan: CEZ:AV0Z8033913 Keywords : Renaissance * architecture * church Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Positive solutions and singular discrete boundary value problems

    Czech Academy of Sciences Publication Activity Database

    Cecchi, M.; Došlá, Zuzana; Marini, M.

    2004-01-01

    Roč. 4, - (2004), s. 271-283. ISSN 1085-3375 Institutional research plan: CEZ:AV0Z1019905 Keywords : second - order nonlinear difference equation * singular nonlinearities * decaying solution Subject RIV: BA - General Mathematics

  9. Stimulating Personal Development and Knowledge Sharing (editorial special issue)

    OpenAIRE

    Koper, Rob; Stefanov, Krassen; Dicheva, Darina

    2010-01-01

    Koper, R., Stefanov, K., & Dicheva, D. (2009). Stimulating Personal Development and Knowledge Sharing (editorial) [Special issue]. International Journal of Continuing Engineering Education and Life-Long Learning (IJCEELL), 19(Nos. 4/5/6), 271-275.

  10. Juhatuse liikmed kui usaldusisikud ja nende fidutsiaarkohustused : [bakalaureusetöö] / Tanel Kalaus ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Kalaus, Tanel, 1978-

    2000-01-01

    Juhatuse liikme fidutsiaarkohustuse olemus, hoolsuskohustus, ärilise otsuse reegel, lojaalsuskohustus, isikute huvidega arvestamise põhimõtted, kontinentaal-Euroopa seisud ja arengud. Vt. ka Juridica (2000) nr. 5, lk. 271-280

  11. Vodní hmyz

    Czech Academy of Sciences Publication Activity Database

    Papáček, Miroslav; Soldán, Tomáš

    Praha : Baset, 2003, s. 271-280. ISBN 80-7340-021-9 Institutional research plan: CEZ:AV0Z5007907 Keywords : Aquatic insects of the Šumava Mountains * biodiversity * role in aquatic ecosystems Subject RIV: EG - Zoology

  12. Kuidas kirjutatakse ajalugu? / Carlo Ginzburg ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Ginzburg, Carlo

    2007-01-01

    Ülevaade Pisa Euroopa kultuuride professori C. Ginzburg'i teostest. Varem. ilm.: Märgid, jäljed ja tõendid : intervjuu Carlo Ginzburgiga // Ginzburg, Carlo. Juust ja vaglad. - Tallinn, 2000. - Lk. 262-271

  13. Structure and Bonding in Binuclear Metal Carbonyls. Classical Paradigms vs. Insights from Modern Theoretical Calculations

    Czech Academy of Sciences Publication Activity Database

    Ponec, Robert

    2015-01-01

    Roč. 1053, SI (2015), s. 195-213. ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.545, year: 2014

  14. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 259-271. ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 1.930, year: 2014

  15. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2014-01-01

    Roč. 61, č. 6 (2014), s. 265-271. ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  16. The Ancient Sumerians in the Tides of Time

    Czech Academy of Sciences Publication Activity Database

    Charvát, Petr

    Malden : Blackwell Publishing, 2005 - (Pollock, S.), s. 271-285 ISBN 0-631-23001-7. - (Blackwell studies in global archaeology. 4) Institutional research plan: CEZ:AV0Z90210515 Keywords : Sumerians Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Krajanská lidová léčba a ritualizované praktiky u Čechů z Ukrajiny a Kazachstánu přesídlených do České republiky

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2013-01-01

    Roč. 23, č. 4 (2013), s. 264-271. ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Ukraine * Kazakhstan * Czech Republic * migration * folk medicine * ethno-medicine * complementary medicine * compatriots Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  19. La temperatura alcanzada es casi un grado más frio que el universo, informó el centro de investigaciones CERN

    CERN Multimedia

    2007-01-01

    The first section of what will be the biggest particle accelerator in the world, the LHC, near Geneva, reached the temperature in which it will work: -271 degre Celsius, about one degree colder than the Universe. (1/2 page)

  20. Measurements of seismic vibrations induced by Quarry blasts at the Mostecká basin

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk

    -, č. 271 (2006), s. 49-58. ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : seismic vibration * slope stability * quarry blast Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  1. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  2. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  3. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  4. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  5. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  6. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  7. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  8. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  9. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  10. Drug: D01905 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01905 Drug Mercuric chloride (JAN) HgCl2 271.9083 271.496 D01905.gif Same as: C13377 ATC code: ... D08AK03 Anatom ical Therapeutic Chemical (ATC) classification [BR: ... ) CAS: 7487-94-7 PubChem: 7848967 NIKKAJI: J3.741I ATOM ... 3 1 Z Hg 25.6815 -19.0570 2 X Cl 27.5715 -19.0570 ...

  11. Drug: D07396 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07396 Drug Nepinalone (INN) C18H25NO 271.1936 271.3972 D07396.gif Antitussive ATC code: R05DB26 ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ... L. COMBINATIONS WITH EXPECTORANTS R05DB Other cough ... suppressants R05DB26 Nepinalone D07396 Nepinalone ...

  12. AcEST: DK954927 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_L24 605 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_L24. 5' end seq ... 29/168 (76%) Frame = +2 Query: 92 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 271 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +2 Query: 92 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 271 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  13. AcEST: DK960198 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_M07 658 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_M07. 5' end seq ... 29/168 (76%) Frame = +2 Query: 92 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 271 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +2 Query: 92 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 271 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  14. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  15. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  17. Dicty_cDB: CHR651 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR651 (Link to dictyBase) - - - Contig-U10796-1 - (Link to Original site) - - CHR6...51Z 721 - - - - Show CHR651 Library CH (Link to library) Clone ID CHR651 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR6-C/CHR651Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR651 (CHR651Q) /CSM/CH/CHR6-C/CHR651Q.Seq.d/ XXXXXXXXXXTTTCACT...Q.Seq.d/ 1403 0.0 VHA271 (VHA271Q) /CSM/VH/VHA2-C/VHA271Q.Seq.d/ 1403 0.0 CHR651 (CHR651Q) /CSM/CH/CHR6-C/CHR6

  18. Isolation and characterisation of mesenchymal stem/stromal cells in the ovine endometrium.

    Directory of Open Access Journals (Sweden)

    Vincent Letouzey

    Full Text Available Mesenchymal stem/stromal cells (MSC were recently discovered in the human endometrium. These cells possess key stem cell properties and show promising results in small animal models when used for preclinical tissue engineering studies. A small number of surface markers have been identified that enrich for MSC from bone marrow and human endometrium, including the Sushi Domain-containing 2 (SUSD2; W5C5 and CD271 markers. In preparation for developing a large animal preclinical model for urological and gynecological tissue engineering applications we aimed to identify and characterise MSC in ovine endometrium and determine surface markers to enable their prospective isolation.Ovine endometrium was obtained from hysterectomised ewes following progesterone synchronisation, dissociated into single cell suspensions and tested for MSC surface markers and key stem cell properties. Purified stromal cells were obtained by flow cytometry sorting with CD49f and CD45 to remove epithelial cells and leukocytes respectively, and MSC properties investigated.There was a small population CD271+ stromal cells (4.5 ± 2.3% in the ovine endometrium. Double labelling with CD271 and CD49f showed that the sorted CD271+CD49f- stromal cell population possessed significantly higher cloning efficiency, serial cloning capacity and a qualitative increased ability to differentiate into 4 mesodermal lineages (adipocytic, smooth muscle, chondrocytic and osteoblastic than CD271-CD49f- cells. Immunolabelling studies identified an adventitial perivascular location for ovine endometrial CD271+ cells.This is the first study to characterise MSC in the ovine endometrium and identify a surface marker profile identifying their location and enabling their prospective isolation. This knowledge will allow future preclinical studies with a large animal model that is well established for pelvic organ prolapse research.

  19. Dicty_cDB: CFF579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available o sapiens cDNA, FLJ79296 comple... 271 3e-71 BC153468_1( BC153468 |pid:none) Danio rerio chaperonin containin...g ... 271 3e-71 BC059558_1( BC059558 |pid:none) Danio rerio chaperonin containing...lkn*vslnhlklnnkf *ylltkplkxs*eliylkscsktek*sstlk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bi... Score E Sequences producing significant alignments: (bits) Value (Q54ES9) RecName: Full=T-complex protein 1 subuni...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF442546 |

  20. AcEST: BP915034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_G02 383 Adiantum capillus-veneris mRNA. clone: YMU001_000065_G02. BP915034 CL3621C ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ I +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEFIAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ + +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier ...

  1. The newly observed 113th element

    International Nuclear Information System (INIS)

    The convincing candidate event of the isotope of the 113th element, 278113, and its daughter nuclei, 274111 and 271Mt, were observed, for the first time, in the 209Bi + 70Zn reaction. The experiment was performed at RIKEN (The Institute of Physical and Chemical Research) Linear Accelerator Facility using a GAs-filled Recoil Ion Separator GARIS. The experiments to confirm the productions and decays of isotopes 265Hs(Z=108), 271Ds(Z=110), 272Rg(Z=111), and 277112(Z=112) were also done. (author)

  2. Planetary and gravity wave signatures in the F region ionosphere with impact on radio propagation predictions and variability

    Czech Academy of Sciences Publication Activity Database

    Altadill, D.; Apostolov, E. M.; Boška, Josef; Laštovička, Jan; Šauli, Petra

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1109-1119. ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS).. Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA ČR GA205/01/1071; GA ČR GP205/02/P077 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere * planetary waves * gravity waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  3. Ionospheric effects on terrestrial communications: Working Group 3 overview

    Czech Academy of Sciences Publication Activity Database

    Laštovička, Jan; Bourdillon, A.

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1269-1277. ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS).. Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA AV ČR IBS3012007 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionospheric reflection * telecommunications * gravity waves * planetary waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004 http://www.annalsofgeophysics.eu/index.php/annals/article/view/3299/3345

  4. Behaviour of the F1-region, and Es and spread-F phenomena at European middle latitudes

    Czech Academy of Sciences Publication Activity Database

    Pal, B.; Burešová, Dalia; Laštovička, Jan; Marcz, F.

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1131-1143. ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS).. Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA AV ČR IAA3042102; GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere- radio propagation * F1 region * ionospheric irregularities Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  5. Drug: D05478 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05478 Drug Pilocarpine nitrate (USP); Pilagan (TN) C11H16N2O2. HNO3 271.1168 271.2...homimetics N07AX01 Pilocarpine D05478 Pilocarpine nitrate (USP) S SENSORY OR...ocarpine D05478 Pilocarpine nitrate (USP) USP drug classification [BR:br08302] Dental and Oral Agents Piloca...rpine D05478 Pilocarpine nitrate (USP) Ophthalmic Agents Ophthalmic Antiglaucoma Agents Pilocarpine D05478 Pilocarpine nitrat...1129 1131 1132 1133] [KO:K04129 K04130 K04131 K04132 K04133] Pilocarpine [ATC:N07AX01 S01EB01] D05478 Pilocarpine nitrat

  6. Results of Survey for 1975-76 on Labor Market for Handicapped Persons in Manatee and Sarasota Counties.

    Science.gov (United States)

    Florida Learning Resources System/Suncoast Associate Center, Sarasota.

    Presented are the results of a survey involving personnel directors from 271 local firms in Manatee and Sarasota Counties (Florida) on the employment of the physically impaired, visually impaired, hearing impaired, and mentally retarded. Included are brief descriptions of the goals of the survey and the sampling technique used, and a sample survey…

  7. [State of the autonomic nervous system after induced abortion in the lst trimester].

    Science.gov (United States)

    Bakuleva, L P; Gatina, G A; Kuz'mina, T I; Solov'eva, A D

    1990-04-01

    The autonomic nervous system has been examined in 271 patients with a history of first-trimester induced abortion. It was ascertained that induced abortion affected the autonomic nervous system, thus impairing adaptive potentials and entailing the onset or aggravation of preexisting autonomic vascular dystonia. PMID:2378404

  8. 75 FR 60398 - California: Proposed Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2010-09-30

    ... Management Unit program. 2. Changes California Identified as Relating to Land Disposal Restrictions Phases 3... Restrictions Phase III--Decharacterized Wastewaters; (2) Emergency Extension of the K088 Capacity Variance; (3... AGENCY 40 CFR Part 271 California: Proposed Authorization of State Hazardous Waste Management...

  9. 76 FR 30322 - Notice of Availability of Government-Owned Inventions; Available for Licensing

    Science.gov (United States)

    2011-05-25

    ... Number 7,661,271 entitled ``Integrated Electric Gas Turbine'' issued on February 16, 2010; U.S. Patent..., 2004; U.S. Patent Number 6,624,780 entitled ``False Target Radar Image Generator for Countering... 7,675,198 entitled ``Inductive Pulse Forming Network for High-current, High-power...

  10. Zkoumání vlivu různého procentního plnění nanočásticemi na elektrické vlastnosti epoxidové pryskyřice

    Czech Academy of Sciences Publication Activity Database

    Hudec, Jiří; Neděla, Vilém; Polsterová, H.

    2015-01-01

    Roč. 60, č. 9 (2015), s. 268-271. ISSN 0447-6441 R&D Projects: GA ČR(CZ) GA14-22777S; GA MŠk ED0017/01/01; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : epoxy resin * nanoparticles * oxides * spectral analysis * SEM Subject RIV: BH - Optics, Masers, Lasers

  11. The evolutionary history of kinetoplastids and their kinetoplasts

    Czech Academy of Sciences Publication Activity Database

    Simpson, A. G. B.; Lukeš, Julius; Roger, A. J.

    2002-01-01

    Roč. 19, č. 12 (2002), s. 2071-2083. ISSN 0737-4038 R&D Projects: GA ČR GA204/00/1212 Institutional research plan: CEZ:AV0Z6022909 Keywords : Kinetoplastida * kinetoplast * evolution Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.271, year: 2002

  12. Impact of Supernova and Cosmic-Ray Driving on the Surface Brightness of the Galactic Halo in Soft X-Rays

    Czech Academy of Sciences Publication Activity Database

    Thomas, P.; Girichidis, P.; Gatto, A.; Naab, T.; Walch, S.; Wünsch, Richard; Glover, S.C.O.; Clark, P.C.; Klessen, R.S.; Baczynski, C.

    2015-01-01

    Roč. 813, č. 2 (2015), L27/1-L27/7. ISSN 2041-8205 R&D Projects: GA ČR GAP209/12/1795 Institutional support: RVO:67985815 Keywords : galaxy halo * ISM kinematics and dynamics * stars formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.339, year: 2014

  13. 78 FR 51136 - Request for Information: Supplemental Nutrition Assistance Program (SNAP) Enhancing Retail Food...

    Science.gov (United States)

    2013-08-20

    .... (2) ``Staple foods'' do not include accessory food items, such as coffee, tea, cocoa, carbonated and un-carbonated drinks, candy, condiments, and spices. 7 CFR Part 271 General Information and... limited to, coffee, tea, cocoa, carbonated and un-carbonated drinks, candy, condiments, and spices...

  14. Transformation of lignin and humic acids by extracellular enzymes of saprotrophic basidiomycetes

    Czech Academy of Sciences Publication Activity Database

    Šnajdr, Jaroslav; Steffen, K. T.; Hofrichter, M.; Baldrian, Petr

    Gent : Universiteit Gent, 2009, s. 271-272. ISBN 978-90-813924-1-9. [International Conference on Textile and Polymer Biotechnology /6./. Gent (BE), 23.09.2009-25.09.2009] R&D Projects: GA MŠk OC 155 Institutional research plan: CEZ:AV0Z50200510 Keywords : soil * fungi * enzyme Subject RIV: EE - Microbiology, Virology

  15. Dicty_cDB: VFC491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC491 (Link to dictyBase) - - - Contig-U15867-1 VFC491P (Link to Original ... lobacter glycolsyltransferases for biosynthesis of gangliosides ... and ganglioside mimics. 44 0.019 2 AR271699 |AR271 ...

  16. Effects of gravity and planetary waves on the lower ionosphere

    Czech Academy of Sciences Publication Activity Database

    Laštovička, Jan

    Praha: Institute of Atmospheric Physics, 2000. s. -. [IAGA Workshop "Lower Atmosphere Effects on the Ionosphere and Upper Atmosphere". 25.07.2000-27.07.2000, Praha] R&D Projects: GA ČR GA205/98/0058; GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Subject RIV: BL - Plasma and Gas Discharge Physics

  17. SEREN - a new SPH code for star and planet formation simulations Algorithms and tests

    Czech Academy of Sciences Publication Activity Database

    Hubber, D.A.; Batty, C.P.; McLeod, Andrew; Whitworth, A.

    2011-01-01

    Roč. 529, May (2011), A27/1-A27/28. ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : hydrodynamics * numerical methods * stars formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

  18. Developing College Students' Civic Identity: The Role of Social Perspective Taking and Sociocultural Issues Discussions

    Science.gov (United States)

    Johnson, Matthew

    2015-01-01

    The development of college students' civic identity is understudied, but worthy of attention because of its salience to many students and higher education's commitment to fostering an engaged citizenry. Using 45,271 participants from the 2009 Multi-Institutional Study of Leadership, this study uses structural equation modeling to explore…

  19. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status

    Science.gov (United States)

    Wolters, Nina; Knoors, Harry; Cillessen, Antonius H. N.; Verhoeven, Ludo

    2014-01-01

    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of deaf adolescents' peer status in Grade 8 from…

  20. Application of capillary electrochromatography using macroporous polyacrylamide columns for the analysis of lignans from seeds of Schisandra chinensis

    Czech Academy of Sciences Publication Activity Database

    Kvasničková, L.; Glatz, O.; Štěrbová, H.; Kahle, Vladislav; Slanina, J.; Musil, P.

    2001-01-01

    Roč. 916, 1-2 (2001), s. 265-271. ISSN 0021-9673 R&D Projects: GA ČR GA303/00/D062 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrochromatography * Schisandra chinensis * plant materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.793, year: 2001

  1. 7 CFR 273.18 - Claims against households.

    Science.gov (United States)

    2010-01-01

    ..., and credit or debit cards You do not have to accept credit or debit cards if you do not have the... overpaid or (ii) Benefits that are trafficked. Trafficking is defined in 7 CFR 271.2. (2) This claim is a... by a household transacting an untampered expired Authorization to Participate (ATP) card....

  2. Capitalism. Grade Ten. Unit One, 10.1. Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Burch, Norman

    The tenth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) deals with the political-economic systems in the United States. The first unit of the sequence focuses specifically on capitalism in a democracy. The document deals with both the theoretical and practical aspects of capitalism. The theoretical section…

  3. Single-molecule manipulation of double-stranded DNA using optical tweezers: Interaction studies of DNA with RecA and YOYO-1

    NARCIS (Netherlands)

    Bennink, Martin L.; Scharer, Orlando D.; Kanaar, Ronald; Sakata-Sogawa, Kumiko; Schins, Juleon M.; Kanger, Johannes S.; Grooth, de Bart G.; Greve, Jan

    1999-01-01

    By using optical tweezers and a specially designed flow cell with an integrated glass micropipette, we constructed a setup similar to that of Smith et al. (Science 271:795-799, 1996) in which an individual double-stranded DNA (dsDNA) molecule can be captured between two polystyrene beads. The first

  4. An expertise reversal effect of segmentation in learning from animated worked-out examples

    NARCIS (Netherlands)

    Spanjers, Ingrid; Wouters, Pieter; Van Gog, Tamara; Van Merriënboer, Jeroen

    2010-01-01

    Spanjers, I. A. E., Wouters, P., Van Gog, T., & Van Merriënboer, J. J. G. (2011). An expertise reversal effect of segmentation in learning from animated worked-out examples. Computers in Human Behavior, 27(1), 46-52. doi:10.1016/j.chb.2010.05.011

  5. Proměny českého strukturalismu v exilu

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej

    Praha : Ústav pro českou literaturu AV ČR, 2006, s. 271-280. ISBN 80-85778-51-3 R&D Projects: GA AV ČR KJB9056305 Institutional research plan: CEZ:AV0Z90560517 Keywords : structuralism * exile Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Serotonin and dopamine in the parabrachial nucleus of rats during conditioned taste aversion learning

    Czech Academy of Sciences Publication Activity Database

    Zach, P.; Křivánek, Jiří; Valeš, Karel

    2006-01-01

    Roč. 170, č. 2 (2006), s. 271-276. ISSN 0166-4328 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z5011922 Keywords : taste aversion * microdialysis * parabrachial nucleus Subject RIV: FH - Neurology Impact factor: 2.591, year: 2006

  7. Data Acquisition System of FlashADC on GTAF Facility

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Qi-wei; HE; Guo-zhu; HUANG; Xing; RUAN; Xi-chao; ZHOU; Zu-ying; ZHU; Xing-hua

    2013-01-01

    The data acquisition system of GTAF facility bases on the digitizer of FlashADC(DC271A,made by Acqiris Technologies Inc.),which can achieve the acquisition of experimental data and real-time monitoring of on-line measure by the capture of digital full pulse waveform from 40 BaF2 detectors.Fig.1

  8. Crystal structure, spectroscopic and theoretical studies on two Schiff base compounds of 2,6-dichlorobenzylidene-2,4-dichloroaniline and 2,4-dichlorobenzylidene-2,4-dichloroaniline

    Czech Academy of Sciences Publication Activity Database

    Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.

    2015-01-01

    Roč. 139, Mar (2015), s. 271-278. ISSN 1386-1425 Grant ostatní: AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.353, year: 2014

  9. Lipothymia and Syncope—Aetiology and Outcome in a Prehospital Setting: A Retrospective Study

    DEFF Research Database (Denmark)

    Zwisler, Stine Thorhauge; Mikkelsen, Søren

    2012-01-01

    MECU runs registered, 678 were assignments in which the patients were diagnosed with lipothymia or syncope (3.8%). 578 patients (85%) were admitted to hospital. 278 of the patients were discharged directly from the emergency department, while 271 were admitted to a ward. 112 patients refused treatment...

  10. Comparing pollen spectra from modified Tauber traps and moss samples: examples from a selection of woodlands across Europe

    Czech Academy of Sciences Publication Activity Database

    Pardoe, H. S.; Giesecke, T.; van der Knaap, W. O.; Svitavská-Svobodová, Helena; Kavavadze, E.; Panajiotidis, S.; Gerasimidis, A.; Pidek, I. A.; Zimny, M.; Swieta-Musznicka, J.; Latalova, M.; Noryskiewicz, A. M.; Bozilova, E.; Tonkov, S.; Filipova-Marinova, M.; van Leeuwen, J. F. N.; Kalnina, L.

    2010-01-01

    Roč. 19, č. 4 (2010), s. 271-283. ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00130801 Institutional research plan: CEZ:AV0Z60050516 Keywords : moss samples * surface pollen deposition * representation of tree taxa Subject RIV: EF - Botanics Impact factor: 1.656, year: 2010

  11. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo

    2009-01-01

    Roč. 135, 3-4 (2009), s. 267-271. ISSN 0378-1135 Grant ostatní: 6th Framework Programme EC(XE) GOCE-2003-010284 EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  12. The Faculty Perspective on Universal Design for Learning

    Science.gov (United States)

    Izzo, Margaretha Vreeburg; Murray, Alexa; Novak, Jeanne

    2008-01-01

    This article presents the results of two studies on the applicability and use of universal design in higher education. In Study 1, the instructional climate for students with disabilities was assessed through a survey of 271 faculty members and teaching associates (TAs) and focus groups with 92 additional faculty members and TAs. Survey…

  13. Magnetic fabric and modeled strain distribution in the head of a nested granite diapir, the Melechov pluton, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Trubač, Jakub; Žák, J.; Chlupáčová, M.; Janoušek, V.

    2014-01-01

    Roč. 66, September (2014), s. 271-283. ISSN 0191-8141 Institutional support: RVO:67985831 Keywords : anisotropy of magnetic susceptibility (AMS) * diapir * emplecement * fabric * granite * strain Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.884, year: 2014

  14. EST Table: FY017740 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY017740 rbmov20g11 11/11/04 62 %/209 aa pir||S52242 protein kinase \\(EC 2.7.1.-\\) p46XlEg22 - A ... frican clawed frog ... emb|CAA78914.1| p46XlEg22 [Xenopus laevis] 11/11/0 ...

  15. Development of the Ethmoidal Structures of the Endocranium in Discoglossus pictus (Anura: Discoglossidae)

    Czech Academy of Sciences Publication Activity Database

    Královec, K.; Roček, Zbyněk; Žáková, P.; Mužáková, V.

    2010-01-01

    Roč. 271, č. 9 (2010), s. 1078-1093. ISSN 0362-2525 Institutional research plan: CEZ:AV0Z30130516 Keywords : Anura * Discoglossidae * Discoglossus * development * cranium Subject RIV: EA - Cell Biology Impact factor: 1.773, year: 2010

  16. Equilibrium of phases with interfacial energy : a variational approach

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav

    2011-01-01

    Roč. 105, 1-2 (2011), s. 271-303. ISSN 0374-3535 Institutional research plan: CEZ:AV0Z10190503 Keywords : phase transitions * phase interface * interface polyconvexity Subject RIV: BA - General Mathematics Impact factor: 1.110, year: 2011 http://www.springerlink.com/content/w4p16v37t032v632/

  17. Measurements of phytoplankton of sub-nanomolar chlorophyll concentrations by a modified double-modulation fluorometer

    Czech Academy of Sciences Publication Activity Database

    Dijkman, N.; Kaftan, David; Trtílek, M.; Nedbal, Ladislav

    1999-01-01

    Roč. 37, č. 2 (1999), s. 249-254. ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA MŠk OK 271 Grant ostatní: INCO-COPERNICUS(EC) IC15CT95-0105 Subject RIV: BO - Biophysics Impact factor: 0.734, year: 1999

  18. Sociální hnutí na hraně mezi organizací a neformální iniciativou

    Czech Academy of Sciences Publication Activity Database

    Stachová, Jana

    Praha : Sociologický ústav AV ČR, 2002 - (Mansfeldová, Z.; Tuček, M.), s. 271-289 ISBN 80-7330-009-5 Institutional research plan: CEZ:AV0Z7028912 Keywords : social movements * organisational structure Subject RIV: AO - Sociology, Demography

  19. Midway Atoll Site P20 12/6/2002 49-50M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P20 28.271 N, 177.385 W, between 49 and 50 meters along a permanent transect.

  20. French Frigate Shoals Site P16 10/4/2002 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 7 and 8 meters along a permanent transect.

  1. Enhanced personal protection at the PS

    CERN Multimedia

    Samuel Morier Genoud

    2013-01-01

    Pictures 03, 06, 07 08 : Pierre Ninin, deputy group leader of GS-ASE and responsible for the installation of the new PS complex safety system, in front of a new access control system.Pictures 10, 12 ,13 : View of Building 271, the future control centre of the new PS complex safety system.

  2. Geology and Re-Os molybdenite geochronology of the Kurišková U-Mo deposit (Western Carpathians, Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Kohút, M.; Trubač, J.; Novotný, L.; Ackerman, Lukáš; Demko, R.; Bartalský, B.; Erban, V.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 271-282. ISSN 1802-6222 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : U–Mo ore deposit * Re–Os * molybdenite geochronology * genetic model * Gemeric Unit * Western Carpathians Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.744, year: 2013

  3. Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk

    2014-01-01

    Roč. 65, č. 4 (2014), s. 257-271. ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP-MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

  4. 76 FR 68064 - Reserve Requirements of Depository Institutions

    Science.gov (United States)

    2011-11-03

    ... reporting, and must file a Report of Transaction Accounts, Other Deposits and Vault Cash (FR 2900 report... required to file the FR 2900 report each week, while those with total transaction accounts, savings deposits, and small time deposits less than $271.5 million are required to file the FR 2900 report...

  5. Linking Emotion Regulation Strategies to Affective Events and Negative Emotions at Work

    Science.gov (United States)

    Diefendorff, James M.; Richard, Erin M.; Yang, Jixia

    2008-01-01

    This study examined the use of specific forms of emotion regulation at work, utilizing Gross's [Gross, J. J. (1998). "The emerging field of emotion regulation: An integrative review." "Review of General Psychology" 2, 271-299] process-based framework of emotion regulation as a guiding structure. In addition to examining employee self-reported…

  6. Learner-controlled selection of tasks with different surface and structural features: effects on transfer and efficiency

    NARCIS (Netherlands)

    Corbalan, Gemma; Kester, Liesbeth; Van Merriënboer, Jeroen

    2010-01-01

    Corbalan, G., Kester, L., & Van Merriënboer, J. J. G. (2011). Learner-controlled selection of tasks with different surface and structural features: Effects on transfer and efficiency. Computers in Human Behavior, 27(1), 76-81. doi:10.1016/j.chb.2010.05.026

  7. Strontium substitution for Barium in superconductors Hg1-yVyBa2-xSrxCam-+CumO2m+2+d(m=1 , 2)

    Czech Academy of Sciences Publication Activity Database

    Knížek, Karel; Pollert, Emil; Malo, S.; Michel, C.; Hervieu, M.; Maignan, A.; Raveau, B.

    Delphi : Narosa Publishing House, 1998 - (Bose, S.), s. 267-271 ISBN 81-7319-155-7. [High Temperature Superconductivity - Ten Years after its Discovery (IN), 00.12.1996-00.12.1996] R&D Projects: GA ČR GA203/96/0448 Grant ostatní: CNRS(FR) 280

  8. Phenolic acid content and radical scavenging activity of extracts from medlar (Mespilus germanica L.) fruit at different stages of ripening

    Czech Academy of Sciences Publication Activity Database

    Grúz, Jiří; Ayaz, F. A.; Torun, H.; Strnad, Miroslav

    2011-01-01

    Roč. 124, č. 1 (2011), s. 271-277. ISSN 0308-8146 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phenolic acids * HPLC * Mass spectrometry * Fruit * Ripening Subject RIV: EF - Botanics Impact factor: 3.655, year: 2011

  9. 76 FR 10388 - Notice of Public Meeting, North Slope Science Initiative-Science Technical Advisory Panel

    Science.gov (United States)

    2011-02-24

    ... indicated below: DATES: The meeting will be held March 28 through April 1, 2011, in Barrow, Alaska. The... Monday, March 28 2011. FOR FURTHER INFORMATION CONTACT: John F. Payne, Executive Director, North Slope..., (907) 271-3431 or e-mail john_f_payne@blm.gov . SUPPLEMENTARY INFORMATION: The NSSI-STAP...

  10. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Fauman 1,271 views 1:05:13 Phoebe's Cancer Story - Duration: 7:46. Family A-Fair 622, ... 3:02 Pediatric Palliative Care: helping children with cancer survive and thrive - Duration: 3:29. American Cancer ...

  11. 77 FR 14023 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-08

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272,...

  12. 77 FR 28889 - National Institute on Alcohol Abuse and Alcoholism Notice of Closed Meeting

    Science.gov (United States)

    2012-05-16

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis...-2067, srinivar@mail.nih.gov . (Catalogue of Federal Domestic Assistance Program Nos. 93.271,...

  13. 77 FR 26770 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-05-07

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis....271, Alcohol Research Career Development Awards for Scientists and Clinicians; 93.272,...

  14. 75 FR 36660 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2010-06-28

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians;...

  15. 77 FR 14024 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-08

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians;...

  16. 76 FR 22717 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2011-04-22

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

  17. Effect of montmorillonite on properties of nanocomposite coatings

    Czech Academy of Sciences Publication Activity Database

    Špírková, Milena; Strachota, Adam; Strachotová, Beata; Urbanová, Martina

    2008-01-01

    Roč. 24, č. 4 (2008), s. 268-271. ISSN 0267-0844 R&D Projects: GA AV ČR IAA400500505 Institutional research plan: CEZ:AV0Z40500505 Keywords : nanocomposite * montmorillonite * coating Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.354, year: 2008

  18. 48 CFR 1371.120 - Temporary services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Temporary services. 1371.120 Section 1371.120 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT....120 Temporary services. Insert clause 1352.271-89, Temporary Services, in all solicitations...

  19. On two-point boundary value problems for second order singular functional differential equations

    Czech Academy of Sciences Publication Activity Database

    Kiguradze, I.; Půža, Bedřich

    2005-01-01

    Roč. 12, 3-4 (2005), s. 271-294. ISSN 0793-1786 Institutional research plan: CEZ:AV0Z10190503 Keywords : second order singular functional differential equation * two-point boundary value problem * solvability Subject RIV: BA - General Mathematics

  20. Multicenter validation of the analytical accuracy of Salmonella PCR: towards an international standard

    DEFF Research Database (Denmark)

    Malorny, B.; Hoorfar, Jeffrey; Bunge, C.;

    2003-01-01

    Salmonella spp. and 47 non-Salmonella strains. The most selective primer set was found to be 139-141 (K. Rahn, S. A. De Grandis, R. C. Clarke, S. A. McEwen, J. E. Galan, C. Ginocchio, R. Curtiss 111, and C. L. Gyles, Mol. Cell. Probes 6:271-279, 1992), which targets the invA gene. An extended determination...

  1. Viet Nam. Grade Six, Unit One. 6.1. Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Thompson, Fred

    This sixth grade unit is one of a sequential learning series of the Focus On Inner City Social Studies (FICSS) project developed in accordance with the needs and problems of an urban society. A description of the project is provided in SO 008 271. The units are designed to help students investigate the conditions under which people in other…

  2. Relationship of Family Socialization Processes to Adolescent Moral Thought.

    Science.gov (United States)

    White, Fiona A.

    2000-01-01

    Investigates the relationship between family socialization processes, focusing on adaptability, cohesion, and parent-child communication, and adolescent moral thought. Used a sample of 271 Australian adolescents and their parents. Presents the findings. The results suggest that there is a relationship between family-socialization processes and…

  3. 75 FR 41121 - Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes...

    Science.gov (United States)

    2010-07-15

    ... AGENCY 40 CFR Parts 257, 261, 264, 265, 268, 271 and 302 RIN 2050-AE81 Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes; Disposal of Coal Combustion Residuals From...), 3001, 3004, 3005, and 4004 of the Solid Waste Disposal Act of 1970, as amended by the...

  4. Cell viability and protein turnover in nongrowing Bacillus megaterium at sporulation suppressing temperature

    Czech Academy of Sciences Publication Activity Database

    Kučerová, Helena; Strnadová, M.; Ludvík, J.; Chaloupka, Jiří

    1999-01-01

    Roč. 44, č. 3 (1999), s. 271-275. ISSN 0015-5632 R&D Projects: GA ČR GA204/95/1050; GA ČR GA204/96/1261 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 0.402, year: 1999

  5. Lesson study - Could it work for you?

    Czech Academy of Sciences Publication Activity Database

    Doing, B.; Groves, S.; Macháčková, Jana

    Praha : Pedagogická fakulta UK, 2009 - (Novotná, J.; Moraová, H.), s. 271-272 ISBN 978-80-7290-398-6. [SEMT'09 - International Symposium, Elementary Maths Teaching. Praha (CZ), 23.08.2009-28.08.2009] Institutional research plan: CEZ:AV0Z10190503 Keywords : lesson study - research lesson * elementary level * mathematics education Subject RIV: AM - Education

  6. Drug: D07435 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07435 Mixture, Drug Papaveretum (BAN); Omnopon (TN) Morphine hydrochloride [DR:D02...271], Papaverine hydrochloride [DR:D02218], Codeine hydrochloride [DR:D07740] ATC code: N02AA10 A mixture of 253 parts of Morphine

  7. EST Table: FS910501 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS910501 E_FL_fufe_20G17_F_0 10/09/28 79 %/271 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  8. The Relationships between Teacher Empowerment, Teachers' Sense of Responsibility for Student Outcomes, and Student Achievement.

    Science.gov (United States)

    Martin, Barbara N.; Crossland, Barbara J.

    Relationships between the level of teachers' perceived empowerment, the degree of teachers' perceived responsibility for student outcomes, and student achievement were studied with 271 elementary school teachers. The Responsibility for Student Achievement Scale (RSA) (T. Guskey, 1981) and the School Participant Empowerment Scales (SPES) (P. Short…

  9. Geochemical characteristics and petrogenesis of phonolites and trachytic rocks from the České Středohoří Volcanic Complex, the Ohře Rift, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Ulrych, Jaromír; Řanda, Zdeněk; Erban, V.; Hegner, E.; Magna, T.; Balogh, K.; Frána, Jaroslav; Lang, Miloš; Novák, Jiří Karel

    224/225, May (2015), s. 256-271. ISSN 0024-4937 R&D Projects: GA AV ČR IAA3048201 Institutional support: RVO:67985831 ; RVO:61389005 Keywords : phonolite * trachyte * Sr–Nd–Li isotopes * Cenozoic alkaline volcanism * Ohře (Eger) Rift * Bohemian Massif Subject RIV: DD - Geochemistry Impact factor: 4.482, year: 2014

  10. French Frigate Shoals Site P16 9/14/2001 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 27 and 28 meters along a permanent transect.

  11. UniProt search blastx result: AK289181 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289181 J100029B03 Q83GX6|PPNK_TROWT Probable inorganic polyphosphate/ATP-NAD kinase (EC 2.7.1. ... 23) (Poly(P)/ATP NAD kinase) - Tropheryma whipple i (strain Twist) (Whipple 's bacillus) 1.00E-16 ...

  12. UniProt search blastx result: AK289181 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289181 J100029B03 Q83IC3|PPNK_TROW8 Probable inorganic polyphosphate/ATP-NAD kinase (EC 2.7.1. ... 23) (Poly(P)/ATP NAD kinase) - Tropheryma whipple i (strain TW08/27) (Whipple 's bacillus) 1.00E-16 ...

  13. Main: 1S6I [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein 2.7.1.- (Calcium-Dependent Protein Kinase Sk5) A.M.Weljie, H.J.Vogel A.M.Weljie, H.J.Vogel Unexpect...ed Structure Of The Ca2+-Regulatory Region From Soybean Calcium-Dependent Protein K

  14. French Frigate Shoals Site P16 9/14/2001 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 38 and 39 meters along a permanent transect.

  15. French Frigate Shoals Site P16 9/14/2001 48-49M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 48 and 49 meters along a permanent transect.

  16. French Frigate Shoals Site P16 9/14/2001 45-46M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 45 and 46 meters along a permanent transect.

  17. French Frigate Shoals Site P16 9/14/2001 46-47M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 46 and 47 meters along a permanent transect.

  18. French Frigate Shoals Site P16 9/14/2001 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 37 and 38 meters along a permanent transect.

  19. French Frigate Shoals Site P16 9/14/2001 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 23 and 24 meters along a permanent transect.

  20. French Frigate Shoals Site P16 9/14/2001 30-31M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 30 and 31 meters along a permanent transect.

  1. French Frigate Shoals Site P16 9/14/2001 42-43M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 42 and 43 meters along a permanent transect.

  2. French Frigate Shoals Site P16 9/14/2001 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 47 and 48 meters along a permanent transect.

  3. French Frigate Shoals Site P16 9/14/2001 24-25M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 24 and 25 meters along a permanent transect.

  4. French Frigate Shoals Site P16 9/14/2001 34-35M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 34 and 35 meters along a permanent transect.

  5. French Frigate Shoals Site P16 9/14/2001 49-50M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 49 and 50 meters along a permanent transect.

  6. French Frigate Shoals Site P16 9/14/2001 31-32M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 31 and 32 meters along a permanent transect.

  7. French Frigate Shoals Site P16 10/4/2002 0-1M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 0 and 1 meters along a permanent transect.

  8. French Frigate Shoals Site P16 9/14/2001 29-30M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 29 and 30 meters along a permanent transect.

  9. French Frigate Shoals Site P16 9/14/2001 25-26M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 25 and 26 meters along a permanent transect.

  10. French Frigate Shoals Site P16 9/14/2001 28-29M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 28 and 29 meters along a permanent transect.

  11. French Frigate Shoals Site P16 9/14/2001 44-45M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 44 and 45 meters along a permanent transect.

  12. French Frigate Shoals Site P16 9/14/2001 26-27M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 26 and 27 meters along a permanent transect.

  13. French Frigate Shoals Site P16 9/14/2001 33-34M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 33 and 34 meters along a permanent transect.

  14. French Frigate Shoals Site P16 9/14/2001 40-41M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 40 and 41 meters along a permanent transect.

  15. French Frigate Shoals Site P16 9/14/2001 35-36M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 35 and 36 meters along a permanent transect.

  16. French Frigate Shoals Site P16 9/14/2001 32-33M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P16 23.857 N, 166.271 W, between 32 and 33 meters along a permanent transect.

  17. Dicty_cDB: Contig-U12511-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bda Zap Express Library Gossyp... 46 2.4 1 ( DN802401 ) G.hir-15-20 DAA bolls irr...igated 604 15-20 DAA bol... 46 2.4 1 ( DN802068 ) G.hir-15-20 DAA bolls irrigated 271 15-20 DAA bol... 46 2.

  18. Výchova k novému věku. Komenského filozofie výchovy ve výkladu Jana Patočky

    Czech Academy of Sciences Publication Activity Database

    Schifferová, Věra

    Praha : Academia, 2009 - (Chocholová, S.; Pánková, M.; Steiner, M.), s. 271-277 ISBN 978-80-200-1700-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : Patočka * Comenius * philosophy of education Subject RIV: AA - Philosophy ; Religion

  19. Přechylování příjmení v češtině jako případ jazykového managementu

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Jakub

    2014-01-01

    Roč. 75, č. 4 (2014), s. 271-293. ISSN 0037-7031 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : language management * feminine * derivation * surname Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

  20. Parental Employment and Child Behaviors: Do Parenting Practices Underlie These Relationships?

    Science.gov (United States)

    Hadzic, Renata; Magee, Christopher A.; Robinson, Laura

    2013-01-01

    This study examined whether hours of parental employment were associated with child behaviors via parenting practices. The sample included 2,271 Australian children aged 4-5 years at baseline. Two-wave panel mediation models tested whether parenting practices that were warm, hostile, or characterized by inductive reasoning linked parent's…

  1. Development of Soft Tissue Sarcomas in Ribosomal Proteins L5 and S24 Heterozygous Mice

    Czech Academy of Sciences Publication Activity Database

    Kazerounian, S.; Ciarlini, P.D.S.C.; Yuan, D.; Ghazvinian, R.; Alberich-Jorda, Meritxell; Joshi, M.; Zhang, H.; Beggs, A.H.; Gazda, H.T.

    2016-01-01

    Roč. 7, č. 1 (2016), s. 32-36. ISSN 1837-9664 R&D Projects: GA MŠk LK21307 Institutional support: RVO:68378050 Keywords : Ribosomal proteins RPL5 and RPS24 * Diamond-Blackfan anemia * Soft tissue sarcoma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.271, year: 2014

  2. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M; de Nijs, Robin; Svarer, Claus; Wagner, Aase; Pinborg, Lars H

    2007-01-01

    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  3. Protein (Viridiplantae): 356520860 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 24:441 3398:441 71240:3539 91827:3539 71275:632 91835:271 72025:690 3803:690 3814:690 163735:1365 3846:1365 3847:1365 PREDICTED: grav...es disease carrier protein-like Glycine max MAKQRQEDGKKGVVDLMPLFAKELLAGGVAGGFAKTVVA

  4. Freshwater epiphitic Chamaesiphonaceae from Central Mexico

    Czech Academy of Sciences Publication Activity Database

    Gold-Morgan, M.; Montejano, G.; Komárek, Jiří

    1996-01-01

    Roč. 117, č. 83 (1996), s. 257-271. ISSN 0342-1120. [Symposium of the International Association for Cyanophyte Research /13./. Frascati, 26.08.1995-03.09.1995] R&D Projects: GA AV ČR IAA6005704 Impact factor: 1.881, year: 1996

  5. Hypolipidemic effect of beer proteins in experiment on rats

    Czech Academy of Sciences Publication Activity Database

    Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.

    2002-01-01

    Roč. 35, č. 3 (2002), s. 265-271. ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

  6. Drug: D08689 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08689 Drug Zoledronic acid (INN); Zometa (TN); Reclast (TN) C5H10N2O7P2 271.9963 272.0896 D0868 ... 900(2224) Terpenoid backbone biosynthesis map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  7. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.

    2011-01-01

    Roč. 18, č. 2 (2011), s. 267-271. ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 http://hrcak.srce.hr/search/?q=Using+waterjet+in+reverse+logistic+operations+in+discarded+munitions+processing

  8. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

    2015-01-01

    Roč. 747, JUL (2015), s. 265-271. ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.131, year: 2014

  9. The Effects of Mass Media Exposure on Acceptance of Violence against Women: A Field Experiment.

    Science.gov (United States)

    Malamuth, Neil M.; Check, James V. P.

    1981-01-01

    Students (N=271) were subjects in an experiment on the effects of exposure to films that portray sexual violence as having positive consequences. Results indicated that exposure to the films portraying violent sexuality increased male subjects' acceptance of interpersonal violence against women. Females exhibited tendencies in the opposite…

  10. Bubble Size Distribution and Two-Phase Pressure Drop in Thin-Gap Microchannel.

    Czech Academy of Sciences Publication Activity Database

    Křišťál, Jiří; Havlica, Jaromír; Jiřičný, Vladimír

    - : Norhaven Book , 2007 - (Gani, R.; Dam-Johansen, K.), s. 271-272 ISBN 978-87-91435-56-0. [European Congress of Chemical Engineering ECCE-6. Copenhagen (DK), 16.09.2007-20.09.2007] Institutional research plan: CEZ:AV0Z40720504 Keywords : rectangular microchannel * bubble size distribution * pressure drop Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  11. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.; Garraffo, H. Martin; Kaneko, Tetsuo; Schultz, Ted R.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......, the DHQs were accompanied by six histrionicotoxins (HTXs), viz., 283A, 285A, 285B, 285C, 287A, and 287D. This co-occurrence of the HTX and DHQ alkaloids is the usual pattern seen in dendrobatid frogs. This finding contrasts with our earlier study, where workers of a Brazilian ant, Solenopsis...... (Diplorhoptrum) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...

  12. Mesophyll conductance to CO2 transport estimated by two independent methods: effect of variable CO2 concentration and abscisic acid

    Czech Academy of Sciences Publication Activity Database

    Vrábl, D.; Vašková, M.; Hronková, Marie; Flexas, J.; Šantrůček, Jiří

    2009-01-01

    Roč. 60, č. 8 (2009), s. 2315-2323. ISSN 0022-0957 R&D Projects: GA AV ČR(CZ) IAA601410505 Institutional research plan: CEZ:AV0Z50510513 Keywords : Carbon dioxide * mesophyll conductance * Helianthus annuus Subject RIV: ED - Physiology Impact factor: 4.271, year: 2009

  13. Midway Atoll Site P20 12/6/2002 22-23M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P20 28.271 N, 177.385 W, between 22 and 23 meters along a permanent transect.

  14. Pollution of agricultural crops with lanthanides, thorium and uranium studied

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Mizera, Jiří; Řanda, Zdeněk; Vávrová, M.

    2007-01-01

    Roč. 271, č. 3 (2007), s. 581-587. ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : thorium, uranium * agricultural crops * neutron activation analysis Subject RIV: BE - Theoretical Physics Impact factor: 0.499, year: 2007

  15. Saturation of Hadron Production in Proton-(anti)Proton Collisions at Low PT

    Czech Academy of Sciences Publication Activity Database

    Zborovský, Imrich; Tokarev, M. V.

    Dubna: JIRN, 2011, s. 265-271. ISBN 978-5-9530-0308-7. [XX International Baldin Seminar on High Energy Physics Problems. Dubna (RU), 04.10.2010-09.10.2010] R&D Projects: GA MŠk LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : hadron production * Tevatron * scaling Subject RIV: BE - Theoretical Physics

  16. Changing compositon of human capital: the Czech Republic, Hungary and Poland

    Czech Academy of Sciences Publication Activity Database

    Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav

    2008-01-01

    Roč. 16, č. 2 (2008), s. 247-271. ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * occupation * education Subject RIV: AH - Economics Impact factor: 0.614, year: 2008

  17. hca: an Arabidopsis mutant exhibiting unusual cambial activity and altered vascular patterning

    Czech Academy of Sciences Publication Activity Database

    Pineau, C.; Amandine, F.; Ranocha, P.; Jauneau, A.; Turner, S.; Lemonnier, G.; Renou, J.P.; Tarkowski, Petr; Sandberg, G.; Jouanin, L.; Sundberg, B.; Boudet, A.M.; Goffner, D.; Pichon, M.

    2005-01-01

    Roč. 44, č. 2 (2005), s. 271-289. ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis thaliana * cambium * secondary xylem Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.969, year: 2005

  18. Balones que inspiran

    Directory of Open Access Journals (Sweden)

    Daniel Samper Pizano

    2014-03-01

    Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

  19. Does Cd36 gene play a key role in disturbed glucose and fatty acid metabolism in Prague hypertensive hypertriglyceridemic rats?

    Czech Academy of Sciences Publication Activity Database

    Kadlecová, Michaela; Čejka, Jakub; Zicha, Josef; Kuneš, Jaroslav

    2004-01-01

    Roč. 53, č. 3 (2004), s. 265-271. ISSN 0862-8408 R&D Projects: GA ČR GA305/03/0769; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : hypertension * insulin resistance * metabolic syndrome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.140, year: 2004

  20. 7 CFR 1948.94 - Reporting requirements.

    Science.gov (United States)

    2010-01-01

    ...) PROGRAM REGULATIONS (CONTINUED) RURAL DEVELOPMENT Section 601 Energy Impacted Area Development Assistance... assistance needed to resolve the situation; and (4) Objectives established for the next reporting period. (b) For site development and land acquisition grants, grantees shall submit Form SF-271 for payment...

  1. High-Frequency Network Activity, Global Increase in Neuronal Activity, and Synchrony Expansion Precede Epileptic Seizures in Vitro

    Czech Academy of Sciences Publication Activity Database

    Jiruška, P.; Csicsvari, J.; Powell, A.V.; Fox, J.E.; Chang, W.C.; Vreugdenhil, M.; Li, X.; Paluš, Milan; Bujan, A.F.; Dearden, R.W.; Jefferys, J. G. R.

    2010-01-01

    Roč. 30, č. 16 (2010), s. 5690-5701. ISSN 0270-6474 Institutional research plan: CEZ:AV0Z10300504 Keywords : mammalian hippocampus invitro * temporal-lobe epilepsy * nonsynaptic epileptogenesis * spatiotemporal dynamics * after-discharges * pyramidal cells * oscillations * rat * calcium * slice Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

  2. Radio activity measurements

    International Nuclear Information System (INIS)

    The following leaflets are contained in this folder concerning radioactivity measurements and standards, and calibration services available at the National Physical Laboratory: Calibration of 226Ra Standards, Radioactivity Standards available, Type-271 radionuclide calibrator, Surface-contamination standards, Absolute counting, Gas counting, Gamma-ray spectrometry, Beta-ray spectrometry, Mass separator, On-line computing and electronic instrumentation. (U.K.)

  3. Oikonyma jako prostředek pro poznání historického vývoje češtiny (aneb k výzkumu náslovného ou-)

    Czech Academy of Sciences Publication Activity Database

    Šimečková, Marta

    Bratislava : Veda, 2015 - (Valentová, I.), s. 267-271 ISBN 978-80-224-1426-5. [Slovenská onomastická konferencia /19./. Bratislava (SK), 28.04.2014-30.04.2014] R&D Projects: GA ČR GAP406/11/1786 Keywords : linguistics * onomastics * oikonyms * diachronic phonology * diphthongization * Czech Subject RIV: AI - Linguistics

  4. Assessment set for evaluation of clinical outcomes in multiple sclerosis: psychometric properties

    Czech Academy of Sciences Publication Activity Database

    Řasová, K.; Martinková, Patrícia; Vyškovská, J.; Šedová, Michaela

    -, č. 3 (2012), s. 59-70. ISSN 1179-271X R&D Projects: GA MŠk(CZ) 1M06014 Grant ostatní: GA MZd(CZ) 1A8628 Institutional support: RVO:67985807 Keywords : outcome assessment * reproducibility of results * psychometric properties * test–retest reliability * internal consistency Subject RIV: FP - Other Medical Disciplines

  5. 48 CFR 1371.104 - Schedule of work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Schedule of work. 1371.104 Section 1371.104 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL... of work. Insert clause 1352.271-73, Schedule of Work, in all solicitations and contracts for...

  6. Pollution: Problems and Solutions. Grade Nine, Unit One, 9.1 Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Jamison, Sandra; Campbell, Bruce

    The ninth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) studies the economic and political realities of the inner city. This document, the first unit of the 9th grade section, deals with the ecological crises involving pollution and its causes. Specific problems include air pollution, pesticides, herbicides,…

  7. Species richness and above-ground biomass of poor and calcareous spring fens in the flysch West Carpatians, and their relationships to water and soil chemistry

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, Michal

    2003-01-01

    Roč. 75, - (2003), s. 271-287. ISSN 0032-7786 R&D Projects: GA ČR GA206/99/1240; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : bryophytes * Central Europe * diversity Subject RIV: EF - Botanics

  8. Vliv akustického prostředí na ontogenezi žadonění mláďat kukačky obecné, aneb jak se pípá v rákosí?

    Czech Academy of Sciences Publication Activity Database

    Žabková, K.; Honza, Marcel; Petrusková, T.; Procházka, Petr

    Brno : Ústav biologie obratlovců AV ČR, 2015 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 271 ISBN 978-80-87189-18-4. [Zoologické dny. 12.02.2015-13.02.2015, Brno] Institutional support: RVO:68081766 Keywords : common cuckoo Subject RIV: EG - Zoology

  9. Exploring the World of Phospholipids and Their Interactions with Proteins: The Work of William Dowhan

    OpenAIRE

    2012-01-01

    The Gene Encoding the Phosphatidylinositol Transfer Protein Is Essential for Cell Growth (Aitken, J. F., van Heusden, G. P., Temkin, M., and Dowhan, W. (1990) J. Biol. Chem. 265, 4711–4717) A Phospholipid Acts as a Chaperone in Assembly of a Membrane Transport Protein (Bogdanov, M., Sun, J., Kaback, H. R., and Dowhan, W. (1996) J. Biol. Chem. 271, 11615–11618)

  10. Sport v obnovené demokracii

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    Praha: Prostor - architektura, interiér, design, 2012 - (Švácha, R.), s. 256-271 ISBN 978-80-87064-08-5 Institutional support: RVO:68378033 Keywords : architecture * sport * privatization Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. Sports in the restored democracy

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    Prague: Prostor - architektura, interiér, design, 2012 - (Švácha, R.), s. 256-271 ISBN 978-80-87064-09-2 Institutional support: RVO:68378033 Keywords : architecture * sport * privatization Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Rostlinné makrozbytky z areálu kostela sv. Martina a fary v Bohušově

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    Ostrava: Národní památkový ústav, územní odborné pracoviště v Ostravě, 2011, 271-278,487-488 ISBN 978-80-85034-59-2 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeobotany * churches * Bohušov Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Novedades en el diccionario (New Additions to the Dictionary)

    Science.gov (United States)

    Carnicer, Ramon

    1975-01-01

    A total of 271 items--words, phrases and affixes--were added to the common Spanish dictionary in the period between October and December 1974. This article lists the principal additions, each organized within a larger semantic category. (Text is in Spanish.) (TL)

  14. EST Table: FY016174 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY016174 rbmov16b13 11/11/04 55 %/269 aa ref|XP_395304.2| PREDICTED: similar to TatD DNase domai ... /04 30 %/271 aa CD4.2#CE16950#WBGene00000795#locus:crn - 2#status:Confirmed#UniProt:O44160#protein_id:AAB8 ...

  15. Investigation of oxidation attack sites in sterols: Thermodynamics of hydrogen atom transfer

    Czech Academy of Sciences Publication Activity Database

    Škorňa, P.; Lengyel, Jozef; Rimarčík, J.; Klein, E.

    2014-01-01

    Roč. 1038, JUN 2014 (2014), s. 26-32. ISSN 2210-271X R&D Projects: GA ČR(CZ) GA14-27047S Institutional support: RVO:61388955 Keywords : sterol * steroid * oxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

  16. Coupled Cluster Theories for Strongly Correlated Molecular Systems

    Czech Academy of Sciences Publication Activity Database

    Kowalski, K.; Bhaskaran-Nair, K.; Brabec, Jiří; Pittner, Jiří

    Heidelberg: Springer-Verlag Berlin, 2013 - (Avella, A.; Mancini, F.), s. 237-271 ISBN 978-3-642-35106-8 R&D Projects: GA ČR GAP208/11/2222 Institutional support: RVO:61388955 Keywords : coupled cluster theories * strongly correlated molecular systems * computational chemistry Subject RIV: CF - Physical ; Theoretical Chemistry

  17. Reaction enthalpies of Osingle bondH bonds splitting-off in flavonoids: The role of non-polar and polar solvent

    Czech Academy of Sciences Publication Activity Database

    Vagánek, A.; Rimarčík, J.; Dropková, K.; Lengyel, Jozef; Klein, E.

    2014-01-01

    Roč. 1050, DEC 2014 (2014), s. 31-38. ISSN 2210-271X R&D Projects: GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : flavonoids * polyphenols * antioxidants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

  18. The 7B-1 mutation in tomato (Solanum lycopersicum L.) confers a blue light-specific lower sensitivity to coronatine, a toxin produced by Pseudomonas syringae pv. tomato

    Czech Academy of Sciences Publication Activity Database

    Bergougnoux, V.; Hlaváčková, V.; Plotzová, R.; Novák, Ondřej; Fellner, Martin

    2009-01-01

    Roč. 60, č. 4 (2009), s. 1219-1230. ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blue light-specific response * COI1 * coronatine Subject RIV: EF - Botanics Impact factor: 4.271, year: 2009

  19. Statistical interpretation of WEBNET seismograms by artificial neural nets

    Czech Academy of Sciences Publication Activity Database

    Plešinger, Axel; Růžek, Bohuslav; Boušková, Alena

    2000-01-01

    Roč. 44, č. 2 (2000), s. 251-271. ISSN 0039-3169 R&D Projects: GA AV ČR IAA312104; GA ČR GA205/99/0907 Institutional research plan: CEZ:AV0Z3012916 Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.761, year: 2000

  20. Alkene Dioxygenation with Malonoyl Peroxides: Synthesis of γ-Lactones, Isobenzofuranones, and Tetrahydrofurans.

    Science.gov (United States)

    Alamillo-Ferrer, Carla; Karabourniotis-Sotti, Marianna; Kennedy, Alan R; Campbell, Matthew; Tomkinson, Nicholas C O

    2016-07-01

    Treatment of homoallylic alcohols or carboxylic acids with malonoyl peroxide 1 provides a stereoselective method for the preparation of tetrahydrofurans, γ-lactones, and isobenzofuranones in 44-82% yield and up to 27:1 trans selectivity. Application of this simple and effective heterocyclization in the synthesis of the antidepressant citalopram is also described. PMID:27314605

  1. AcEST: BP920408 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_G04 572 Adiantum capillus-veneris mRNA. clone: YMU001_000136_G04. BP920408 CL1355C ... SKMVGFALKAAEILEKEGISAEVINLRSIRPLDRP 270 Query: 542 TIN QSVRKTN 571 TIN ... SVRKTN Sbjct: 271 TIN ASVRKTN 280 >s ... SKMVGFALKAAEKLAEEGISAEVINLRSIRPLDRA 280 Query: 542 TIN QSVRKTN 571 TIN ... SVRKT+ Sbjct: 281 TIN ASVRKTS 290 >s ...

  2. Blood pressure trends and mortality: the Leiden 85-plus Study

    NARCIS (Netherlands)

    Poortvliet, R.K.; Ruijter, W. de; Craen, A.J. de; Mooijaart, S.P.; Westendorp, R.G.J.; Assendelft, W.J.J.; Gussekloo, J.; Blom, J.W.

    2013-01-01

    OBJECTIVE: To evaluate the independent contributions of both the trend in SBP and the SBP value at age 90 to the prediction of mortality in nonagenarians. METHODS: The trend in SBP between 85 and 90 years and SBP at age 90 years were assessed in a population-based sample of 271 participants (74 men

  3. Persecution in Central Europe and its consequences on the lives of SHARE respondents

    Czech Academy of Sciences Publication Activity Database

    Boháček, Radim; Myck, M.

    Heidelberg : Springer, 2011 - (Börsch-Supan, A.; Brandt, M.; Hank, K.; Schröder, M.), s. 271-285 ISBN 978-3-642-17471-1 R&D Projects: GA ČR GA402/09/1340 Institutional research plan: CEZ:AV0Z70850503 Keywords : persecution * Central Europe * SHARE respondents Subject RIV: AH - Economics

  4. A Short Note on t-filters, I-filters and Extended Filters on Residuated Lattices

    Czech Academy of Sciences Publication Activity Database

    Víta, Martin

    2015-01-01

    Roč. 271, 15 July (2015), s. 168-171. ISSN 0165-0114 R&D Projects: GA ČR GAP202/10/1826 Institutional support: RVO:67985807 Keywords : t- filter s * I- filter s * extended filter s * residuated lattices Subject RIV: BA - General Mathematics Impact factor: 1.986, year: 2014

  5. SwissProt search result: AK064280 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064280 002-105-G03 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 9e-13 ...

  6. SwissProt search result: AK061398 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061398 006-305-F03 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 5e-15 ...

  7. SwissProt search result: AK062188 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062188 001-046-E07 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 1e-15 ...

  8. SwissProt search result: AK059381 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059381 001-026-G02 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 2e-13 ...

  9. SwissProt search result: AK109689 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109689 002-145-E02 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 2e-11 ...

  10. SwissProt search result: AK109139 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109139 002-155-E07 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 1e-11 ...

  11. SwissProt search result: AK111977 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111977 001-007-H12 (Q9VEZ5) Inhibitor of nuclear factor kappa B kinase beta subunit (EC 2.7.1. ... ein) (Lipopolysaccharide-activated kinase) (DLAK) (Cactus ... kinase IKK) IKKB_DROME 2e-11 ...

  12. EST Table: FS833842 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS833842 E_FL_fmgV_44C23_R_0 10/09/28 97 %/271 aa ref|NP_001116814.1| alpha-esterase 40 [Bombyx ... mori] gb|ACB12414.1| carboxylesterase CarE -10 [Bombyx mori] 10/09/10 low homology 10/08/29 lo ...

  13. 21.PSYCHIATRIC DISORDER 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920198 Kinetic observation of serum thyr-onormone level in schizophrenics.WANGXueyi (王学义),et al.Psychiatr Hosp,KailuanCoal Mining Administration,Tangshan,063001.Chin J Neurol & Psychiat 1991; 24 (5): 268-271.Measurements of serum T3,T4,RUR and FT4I

  14. Psychiatric Disorder

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    2005514 Comparison of cognitive function and P300potentials in first-episode schizophrenia treated withrisperidone and clozapine.WANG Changhong(王长虹),et al.Dept Psychiat,Mental Health Instit,2nd Xian-gya Hosp,Centr South Univ,Changsha 410011.Chin JNerv Ment Dis 2005;31(4):267-271.

  15. Conjugacy Class Sizes and Solvability of Finite Groups

    Indian Academy of Sciences (India)

    Qinhui Jiang; Changguo Shao

    2013-05-01

    Let be a finite group and * be the set of primary, biprimary and triprimary elements of . We prove that if the conjugacy class sizes of * are {1,,,} with positive coprime integers and ,then is solvable. This extends a recent result of Kong (Manatsh. Math. 168(2)(2012) 267–271).

  16. On the behaviour of the IR Ca II triplet in normal and active galaxies

    OpenAIRE

    Terlevich, Elena; Angeles I. Díaz; Terlevich, Roberto

    1990-01-01

    This is an electronic version of an article published in Monthly Notices of the Royal Astronomical Society. Terlevich, E., Díaz, A.I., Terlevich, R. On the behaviour of the IR Ca II triplet in normal and active galaxies. Monthly Notices of the Royal Astronomical Society 242 (1990): 271-284

  17. The phosphatase activity of the isolated H4-H5 loop of Na+/K+ ATPase resides outside its ATP binding site

    Czech Academy of Sciences Publication Activity Database

    Ettrich, Rüdiger

    2004-01-01

    Roč. 271, č. 19 (2004), s. 3923-3939. ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5011922; MSM113100003 Keywords : phosphatase Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.260, year: 2004

  18. Biochemical evidence for the activation of distinct subsets of mitogen-activated protein kinases by voltage and defense-related stimuli

    Czech Academy of Sciences Publication Activity Database

    Link, V.; Hofmann, M.; Sinha, A.; Ehness, R.; Strnad, Miroslav; Roitsch, T.

    2002-01-01

    Roč. 128, č. 1 (2002), s. 271-281. ISSN 0032-0889 R&D Projects: GA MŠk OC 844.10 Institutional research plan: CEZ:AV0Z5038910 Keywords : TOBACCO SUSPENSION CULTURE * CYCLIN DEPENDENT KINASES * CYTOSOLIC CALCIUM ION Subject RIV: CE - Biochemistry Impact factor: 5.800, year: 2002

  19. Midway Atoll Site P20 12/6/2002 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P20 28.271 N, 177.385 W, between 8 and 9 meters along a permanent transect.

  20. Attention-Like Modulation of Hippocampus Place Cell Discharge

    Czech Academy of Sciences Publication Activity Database

    Fenton, André Antonio; Lytton, W.W.; Barry, J.M.; Lenck-Santini, P. P.; Zinyuk, Larissa; Kubík, Štěpán; Bureš, Jan; Poucet, B.; Muller, R. U.; Olypher, Andrej Vadimovich

    2010-01-01

    Roč. 30, č. 13 (2010), s. 4613-4625. ISSN 0270-6474 R&D Projects: GA ČR(CZ) GA309/09/0286 Institutional research plan: CEZ:AV0Z50110509 Keywords : attention * overdispersion * place cells Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

  1. Characterizing a new class of variability in GRS 1915+105 with simultaneous INTEGRAL/RXTE observations

    DEFF Research Database (Denmark)

    Hannikainen, D.C.; Rodriguez, J.; Vilhu, O.;

    2005-01-01

    , 271) but not to any previously known variability class. We separated the INTEGRAL data into two subsets covering the maxima and minima of the pulses and fitted the resulting two broadband spectra with a hybrid thermal-non-thermal Comptonization model. The fits show the source to be in a soft state...

  2. Additional observations on Philometra spp. (Nematoda: Philometridae) in marine fishes off Iraq, with the description of two new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2014-01-01

    Roč. 87, č. 3 (2014), s. 259-271. ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

  3. Influence of surface wave plasma deposition conditions on diamond growth regime

    Czech Academy of Sciences Publication Activity Database

    Babchenko, Oleg; Potocký, Štěpán; Ižák, Tibor; Hruška, Karel; Bryknar, Z.; Kromka, Alexander

    2015-01-01

    Roč. 271, Jun (2015), s. 74-79. ISSN 0257-8972 R&D Projects: GA ČR(CZ) GA14-05053S Institutional support: RVO:68378271 Keywords : surface wave plasma * diamond thin films * growth kinetics * scanning electron microscopy * Raman spectroscopy * optical emission spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.998, year: 2014

  4. High-grandient magnetic filters with permanent NdFeB magnets

    Czech Academy of Sciences Publication Activity Database

    Žežulka, Václav; Straka, Pavel

    Istanbul: Promed Advertising Agency, 2006 - (Önal, G.), s. 266-271 ISBN 975-7946-27-3. [International mineral processing congress /23./. Istanbul (TR), 03.09.2006-08.09.2006] Institutional research plan: CEZ:AV0Z30460519 Keywords : magnetic filters * permanent magnets Subject RIV: BM - Solid Matter Physics ; Magnetism

  5. Seasonal variation of the F1 region response to geomagnetic storms over the Europe

    Czech Academy of Sciences Publication Activity Database

    Burešová, Dalia; Laštovička, Jan; Stanislawska, I.; Altadill, D.; Miro, G.; Turunen, E.; Ulich, T.

    Oxford: AppletonRutherford Laboratory, 2003, s. -. [Communications COST 271. Faro (PT), 02.10.2003-04.10.2003] R&D Projects: GA AV ČR IAA3042102 Institutional research plan: CEZ:AV0Z3042911 Keywords : geomagnetic storm * ionosphere * F1 region Subject RIV: DG - Athmosphere Sciences, Meteorology

  6. The Effect of Coping Knowledge on Emergency Preparedness in Elementary School Students

    Science.gov (United States)

    Kim, Shin-Jeong; Kang, So-Ra; Lee, Seung-Hee; Kang, Kyung-Ah

    2014-01-01

    The purpose of this study was to examine the effect of coping knowledge for emergency preparedness in Korean elementary school students. A school-based coping education program was provided seven times to 271 fourth- and fifth-grade students in two urban schools by researchers with the school nurses. The Process Model of Stress and Coping and…

  7. Effect of Using a Personal Development Plan on Learning and Development

    Science.gov (United States)

    Beausaert, Simon; Segers, Mien; Fouarge, Didier; Gijselaers, Wim

    2013-01-01

    Purpose: This study aims to examine the effects of using a personal development plan (PDP) on the undertaking of learning activities and the employee's job competencies. Design/methodology/approach: Data from Dutch pharmacy assistants was collected (n=2,271). Analyses of variance (ANOVAs) as well as regression analyses were conducted on this…

  8. Epidemiology and Decision Support Tools with Application in Cardiology

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana; Peleška, Jan; Štefek, Martin; Švejda, David; Tomečková, Marie

    1997-01-01

    Roč. 17, 1/2 (1997), s. 271-281. ISSN 0208-5216. [ICB Seminar Statistics and Clinical Practice /34./. Waršava, 24.06.1996-28.06.1996] Grant ostatní: COPERNICUS(XE) 10053; IGA MZ ČR(CZ) IZ3792; IGA MZ ČR(CZ) IZ4038

  9. Publishing and perishing: The critical importance of educational design research

    NARCIS (Netherlands)

    Reeves, Thomas; McKenney, Susan; Herrington, Jan

    2011-01-01

    Reeves, T. C., McKenney, S., & Herrington, J. (2011). Publishing and perishing: The critical importance of educational design research. Australian Journal of Educational Technology, 27(1), 55-65. http://www.ascilite.org.au/ajet/ajet27/reeves.htm

  10. Ku kľúčovým dňom česko-slovenskej štátnosti v marci 1939. (Dva dokumenty bezpečnostných zložiek štátu)

    Czech Academy of Sciences Publication Activity Database

    Zudová-Lešková, Zlatica

    Bratislava : Vojenský historický ústav Bratislava, 2010 - (Stanová, M.), s. 256-271 ISBN 978-80-970434-1-4 Institutional research plan: CEZ:AV0Z80150510 Keywords : Czech-Slovak statehood * Slovakia * State of emergency 1939 Subject RIV: AB - History

  11. Bioavailability of Praziquantel Increases with Concomitant Administration of Food

    OpenAIRE

    Castro, Nelly; Medina, Roberto; Sotelo, Julio; Jung, Helgi

    2000-01-01

    In the present study we found that after a single oral dose of 1,800 mg of praziquantel, following a high-lipid diet and a high-carbohydrate diet, the maximum levels in plasma increased 243 and 515% and the area under the plasma concentration curve from 0 to 8 h increased 180 and 271%, respectively.

  12. 75 FR 15754 - Agency Forms Submitted for OMB Review, Request for Comments

    Science.gov (United States)

    2010-03-30

    ... annual reporting hours: 9,271. 2. Title and Purpose of Information Collection: Voluntary Customer Surveys... information we seek to collect from the public. Information Collection Request (ICR) Title: Voluntary Customer... Retirement Act; 3220-0002 Section 2 of the Railroad Retirement Act (RRA) provides for payments of age...

  13. Regulated Cleavage of Prothrombin by Prothrombinase: REPOSITIONING A CLEAVAGE SITE REVEALS THE UNIQUE KINETIC BEHAVIOR OF THE ACTION OF PROTHROMBINASE ON ITS COMPOUND SUBSTRATE*♦

    OpenAIRE

    Bradford, Harlan N.; Micucci, Joseph A.; Krishnaswamy, Sriram

    2009-01-01

    Prothrombinase converts prothrombin to thrombin via cleavage at Arg320 followed by cleavage at Arg271. Exosite-dependent binding of prothrombin to prothrombinase facilitates active site docking by Arg320 and initial cleavage at this site. Precise positioning of the Arg320 site for cleavage is implied by essentially normal cleavage at Arg320 in recombinant prothrombin variants...

  14. Two kinds of procedural semantics for privative modification

    Czech Academy of Sciences Publication Activity Database

    Jespersen, Bjorn; Primiero, G.

    Berlin: Springer, 2010 - (Nakakoji, K.; Murakami, Y.; McCready, E.), s. 252-271. (Lecture Notes in Computer Science. 6284). ISBN 978-3-642-14887-3. [JSAI International Symposia on Artificial Intelligence . Tokyo (JP), 29.11.2010-30.11.2010] Institutional research plan: CEZ:AV0Z90090514 Keywords : logic * semantics Subject RIV: AA - Philosophy ; Religion

  15. Bergman kernels, TYZ expansions and Hankel operators on the Kepler manifold

    Czech Academy of Sciences Publication Activity Database

    Bommier-Hato, H.; Engliš, Miroslav; Youssfi, E.-H.

    2016-01-01

    Roč. 271, č. 2 (2016), s. 264-288. ISSN 0022-1236 Institutional support: RVO:67985840 Keywords : Kepler manifold * Bergman kernel * Tian-Yau-Zelditch expansion Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www. science direct.com/ science /article/pii/S0022123616300593

  16. Marie Kovářová a výzkum tradičních svateb na Podblanicku

    Czech Academy of Sciences Publication Activity Database

    Petráňová, Lydia

    2010-01-01

    Roč. 50, č. 2 (2010), s. 271-284, 457. ISSN 0487-5648 Institutional research plan: CEZ:AV0Z90580513 Keywords : Podblanicko region * Benešov district * wedding rituals * wedding officers * wedding pastry Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Biophysical properties and cellular toxicity of covalent crosslinked oligomers of α-synuclein formed by photoinduced side-chain tyrosyl radicals

    Czech Academy of Sciences Publication Activity Database

    Borsarelli, C.D.; Falomir-Lockhart, L.J.; Ostatná, Veronika; Fauerbach, J.A.; Hsiao, H.-H.; Urlaub, H.; Paleček, Emil; Jares-Erijman, E.A.; Jovin, T.M.

    2012-01-01

    Roč. 53, č. 4 (2012), s. 1004-1015. ISSN 0891-5849 R&D Projects: GA AV ČR(CZ) KJB100040901 Institutional research plan: CEZ:AV0Z50040702 Keywords : Parkinson's disease * neurodegeneration * oxidative stress Subject RIV: BO - Biophysics Impact factor: 5.271, year: 2012

  18. File list: InP.CDV.05.AllAg.HUVEC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.CDV.05.AllAg.HUVEC hg19 Input control Cardiovascular HUVEC SRX220065,SRX294968,...271,SRX425273,SRX220068,SRX425270,SRX190192,SRX220067 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.CDV.05.AllAg.HUVEC.bed ...

  19. 77 FR 34041 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2012-06-08

    ... 907-271-3130. Revision to FR Notice Published 04/20/2012; Comment Period Extended from 06/01/2012 to.... Revision to FR Notice Published 06/01/2012; Change State from AZ to NV and Change Contact Phone Number to.... 20120179, Final EIS, DOE, CA, Energia Sierra Juarez U.S. Transmission Line Project, Construction,...

  20. How to write an academic paper

    OpenAIRE

    Ringmar, Erik

    2011-01-01

    This article focuses on the major rules for preparing a text for publication in an academic journal. The paper provides recommendations concerning how to choose an articles title and publication genre, how to plan the work and edit the text, and guidelines regarding the content of the main parts of the paper.DOI: 10.17323/1814-9545-2011-1-271-293

  1. AA, mating of BST magnet halves

    CERN Multimedia

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  2. Amino acids at the N- and C-termini of human glutamate carboxypeptidase II are required for enzymatic activity and proper folding

    Czech Academy of Sciences Publication Activity Database

    Bařinka, Cyril; Mlčochová, Petra; Šácha, Pavel; Hilgert, Ivan; Majer, P.; Slusher, B. S.; Hořejší, Václav; Konvalinka, Jan

    2004-01-01

    Roč. 271, č. 13 (2004), s. 2782-2790. ISSN 0014-2956 R&D Projects: GA AV ČR IAA5055108 Institutional research plan: CEZ:AV0Z4055905 Keywords : metallopeptidase * prostate cancer * mutagenesis Subject RIV: CE - Biochemistry Impact factor: 3.260, year: 2004

  3. Task Switching Across the Life Span: Effects of Age on General and Specific Switch Costs

    Science.gov (United States)

    Reimers, Stian; Maylor, Elizabeth A.

    2005-01-01

    The authors investigated age-related changes in executive control using an Internet-based task-switching experiment with 5,271 participants between the ages of 10 and 66 years. Speeded face categorization was required on the basis of gender (G) or emotion (E) in single task blocks (GGG... and EEE...) or switching blocks (GGEEGGEE...). General…

  4. Genetic, Biochemical and Environmental Factors Associated with Pregnancy Outcomes in Newborns from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rössner ml., Pavel; Tabashidze, Nana; Dostál, Miroslav; Nováková, Zuzana; Chvátalová, Irena; Špátová, Milada; Šrám, Radim

    2011-01-01

    Roč. 119, č. 2 (2011), s. 265-271. ISSN 0091-6765 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390512 Keywords : air pollution * biomarkers * genetic polymorphisms Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.036, year: 2011

  5. Scientific and technical challenges in remote sensing of plant canopy reflectance and fluorescence

    Czech Academy of Sciences Publication Activity Database

    Malenovský, Z.; Mishra, Kumud; Zemek, František; Rascher, U.; Nedbal, Ladislav

    2009-01-01

    Roč. 10, č. 60 (2009), s. 2987-3004. ISSN 0022-0957 R&D Projects: GA MZe QH92034; GA MŠk OC09001 Institutional research plan: CEZ:AV0Z60870520 Keywords : Chlorophyll fluorescence * optical remote sensing * photosynthesis dynamics * reflectance Subject RIV: GK - Forestry Impact factor: 4.271, year: 2009

  6. 76 FR 18927 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2011-04-06

    ... effective July 1, 2009. 3. F019 Exemption for 73 FR 31756-31769 Oklahoma Statutes Wastewater Treatment June... AGENCY 40 CFR Part 271 Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision... applied to the EPA for Final authorization of the changes to its hazardous waste program under...

  7. 77 FR 47779 - Arkansas: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2012-08-10

    ... FR 31756-31769 Arkansas Code of 1987 Annotated (A.C.A.) Treatment Sludges from Auto Sections 8-7-201... AGENCY 40 CFR Part 271 Arkansas: Final Authorization of State Hazardous Waste Management Program Revision... to the EPA for Final authorization of the changes to its hazardous waste program under the...

  8. 77 FR 60919 - Tennessee: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2012-10-05

    ... for Wastewater 73 FR 31756 1200-01-11-.02(4)(b)1; 1200-01- Treatment Sludges from Auto 06/04/08 11-.02... AGENCY 40 CFR Part 271 Tennessee: Final Authorization of State Hazardous Waste Management Program... has applied to EPA for final authorization of the changes to its hazardous waste program under...

  9. Martin Rajniš

    Czech Academy of Sciences Publication Activity Database

    Platovská, Marie

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 268-271 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : SIAL * architecture of the 20th century and 21th century * wood constructions Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

    Czech Academy of Sciences Publication Activity Database

    Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.

    2014-01-01

    Roč. 63, č. 2 (2014), s. 271-274. ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant ostatní: Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

  11. Morphological traits in nitrogen fixing heterocytous cyanobacteria: possible links between morphology and eco-physiology.

    Czech Academy of Sciences Publication Activity Database

    Pinto, P. D.; Kust, Andreja; Devercelli, M.; Kozlíková-Zapomělová, Eliška

    2016-01-01

    Roč. 764, č. 1 (2016), s. 271-281. ISSN 0018-8158 R&D Projects: GA ČR(CZ) GA14-18067S Institutional support: RVO:60077344 Keywords : traits * heterocyte * akinete * shape * size * phytoplankton Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  12. Socialism. Grade Ten, Unit Two, 10.2. Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Malone, Helen

    The socialism unit of the tenth grade level of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) explores a selected history of socialist thought and the theoretical model of socialism. Three case studies of socialism are explored: Great Britain, Sweden, and Israel. The case studies are designed to answer questions concerning…

  13. 41 CFR 109-27.102 - Economic order quantity principle.

    Science.gov (United States)

    2010-07-01

    ... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal...

  14. 41 CFR 101-27.102 - Economic order quantity principle.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity principle. 101-27.102 Section 101-27.102 Public Contracts and Property Management Federal...

  15. Effect of a N, N’-disubstituted phenylenediamine stabilizer and SB/EPDM compatibilizer on toughness and morphology of blends of pre-aged polyethylene with high-impact polystyrene

    Czech Academy of Sciences Publication Activity Database

    Michálková, Danuše; Pospíšil, Jan; Fortelný, Ivan; Šlouf, Miroslav; Kruliš, Zdeněk

    2006-01-01

    Roč. 12, č. 22 (2006), s. 58-65. ISSN 0193-7197 R&D Projects: GA AV ČR IBS4050008 Institutional research plan: CEZ:AV0Z40500505 Keywords : recycling * compatibilization * stabilization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.271, year: 2005

  16. Využití brassinosteroidů k regulaci stresu během růstu a tvorby výnosu řepy cukrové

    Czech Academy of Sciences Publication Activity Database

    Hradecká, D.; Urban, J.; Kohout, Ladislav; Pulkrábek, J.; Hnilička, R.

    2009-01-01

    Roč. 125, 9/10 (2009), s. 271-273. ISSN 1210-3306 R&D Projects: GA AV ČR 1QS510680561 Institutional research plan: CEZ:AV0Z40550506 Keywords : sugar beet * yield * technological quality * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 0.645, year: 2009

  17. Comparative Ultrastructure of Langerhans-Like Cells in Spleens of Ray-Finned Fishes (Actinopterygii)

    Czech Academy of Sciences Publication Activity Database

    Lovy, J.; Wright, G. M.; Speare, D. J.; Tyml, Tomáš; Dyková, Iva

    2010-01-01

    Roč. 271, č. 10 (2010), s. 1229-1239. ISSN 0362-2525 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * cyprinidae * halibut * dendritic cells * Langerhans cell * Birbeck granules * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.773, year: 2010

  18. "Životní cyklus" mlecích nástrojů z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

    Czech Academy of Sciences Publication Activity Database

    Řídký, Jaroslav; Půlpán, M.; Šreinová, B.; Šrein, V.; Drnovský, V.; Květina, Petr

    2014-01-01

    Roč. 66, č. 2 (2014), s. 271-309. ISSN 0323-1267 R&D Projects: GA ČR(CZ) GAP405/11/1590 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * stone tools * grinding stones Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.

    2015-01-01

    Roč. 591, Sep (2015), s. 271-275. ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.759, year: 2014

  20. Secretory phospholipase A(2) induces delayed neuronal COX-2 expression compared with glutamate

    DEFF Research Database (Denmark)

    Nielsen, Marianne; Bazan, Nicolas G; Diemer, Nils H; Kolko, Miriam

    2002-01-01

    Agonists of the binding site for secretory phospholipase A(2) (sPLA(2)) potentiate glutamate-induced neuronal cell death in primary cell cultures and in vivo (Kolko et al. [1996] J. Biol. Chem. 271:32722; Kolko et al. [1999] Neurosci. Lett. 274:167]. Here, we tested the hypothesis that COX-2...

  1. Zoonotic mosquito-borne flaviviruses: worldwide presence of agents with proven pathogenicity and potential candidates of future emerging diseases

    Czech Academy of Sciences Publication Activity Database

    Weissenböck, H.; Hubálek, Zdeněk; Bakonyi, T.; Nowotny, N.

    2010-01-01

    Roč. 140, 3-4 (2010), s. 271-280. ISSN 0378-1135 Institutional research plan: CEZ:AV0Z60930519 Keywords : Flaviviridae * mosquitoes * Culicidae * zoonoses * arboviruses Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.256, year: 2010

  2. Dicty_cDB: Contig-U03780-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03780-1 no gap 271 2 6491859 6491588 MINUS 1 1 U03780 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show C ... 3 Mus musculus genomic cl... 44 2.6 1 ( EI539723 ) Wang -VSVGgfp-Jurkat-454-Avr-060287_0326_1415 Wang ... 44 ...

  3. Fatigue crack initiation in fcc crystals

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Kunz, Ludvík

    Brno : VUT, 2001, s. 263-271. [International Conference on Materials structure and Micromechanics of Fracture /3./. Brno (CZ), 27.06.2001-29.06.2001] R&D Projects: GA AV ČR IAA2041002 Institutional research plan: CEZ:AV0Z2041904 Keywords : cyclic plastic deformation * crystal defects * fatigue crack initiation Subject RIV: JL - Materials Fatigue, Friction Mechanics

  4. Data publication and dissemination of interactive keys under the open access model

    Science.gov (United States)

    The concepts of publication, citation and dissemination of interactive keys and other online keys are discussed and illustrated by a sample paper published in the present issue (doi: 10.3897/zookeys.21.271). The present model is based on previous experience with several existing examples of publishi...

  5. Tangible and Intangible Rewards and Employee Creativity: The Mediating Role of Situational Extrinsic Motivation

    Science.gov (United States)

    Yoon, Hye Jung; Sung, Sun Young; Choi, Jin Nam; Lee, Kyungmook; Kim, Seongsu

    2015-01-01

    This study examined the effects of tangible and intangible forms of creativity-contingent rewards on employee creativity. Situation-specific intrinsic and extrinsic motivations were proposed as mediators of the reward-creativity link. Based on data collected from 271 employees and their supervisors, results revealed the following: (a) intangible…

  6. Searching a dark photon with HADES

    Czech Academy of Sciences Publication Activity Database

    Agakishiev, G.; Balanda, A.; Belver, D.; Belyaev, A.; Berger-Chen, J. C.; Blanco, A.; Böhmer, M.; Boyard, J. L.; Cabanelas, P.; Chernenko, S.; Dybczak, A.; Epple, E.; Fabbietti, L.; Fateev, O.; Krása, Antonín; Křížek, Filip; Kugler, Andrej; Sobolev, Yuri, G.; Tlustý, Pavel; Wagner, Vladimír

    2014-01-01

    Roč. 731, APR (2014), s. 265-271. ISSN 0370-2693 R&D Projects: GA ČR GA13-06759S; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : HADES * dark photon * hidden sector * dark matter * rare eta decays Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.131, year: 2014

  7. Darkness descends with two Rabs

    OpenAIRE

    Marks, Michael S

    2006-01-01

    Over 60 distinct Rab GTPases regulate specific vesicular transport steps in the mammalian central vacuolar system. Wasmeier et al. (this issue, p. 271) reveal a redundant role for two tissue-specific Rab proteins in regulating transport to a tissue-specific lysosome-related organelle, the melanosome.

  8. 6Li MAS NMR Study of Lithium Insertion into Hydrothermally Prepared Li-Ti-O Spinel

    Czech Academy of Sciences Publication Activity Database

    Krtil, Petr; Dědeček, Jiří; Kostlánová, Tereza; Brus, Jiří

    2004-01-01

    Roč. 7, č. 7 (2004), A163-A166. ISSN 1099-0062 R&D Projects: GA ČR GA203/03/0823 Institutional research plan: CEZ:AV0Z4040901 Keywords : lithium insertion * spinel * NMR Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.271, year: 2004

  9. Succinobucol induces apoptosis in vascular smooth muscle cells

    Czech Academy of Sciences Publication Activity Database

    Midwinter, R.G.; Maghzal, G.; Dennis, J.M.; Wu, B.J.; Cai, H.; Kapralov, A.A.; Belikova, N.A.; Tyurina, Y.Y.; Dong, L. F.; Khachigian, L.; Neužil, Jiří; Kagan, V.E.; Stocker, R.

    2012-01-01

    Roč. 52, č. 5 (2012), s. 871-879. ISSN 0891-5849 R&D Projects: GA ČR(CZ) GAP301/10/1937 Institutional research plan: CEZ:AV0Z50520701 Keywords : reactive oxygen species * free radicals * apoptosis Subject RIV: EA - Cell Biology Impact factor: 5.271, year: 2012

  10. Suitability of food plants for Oxycarenus lavaterae (Heteroptera: Lygaeidae), a mediterranean bug invasive in Central and South-East Europe

    Czech Academy of Sciences Publication Activity Database

    Kalushkov, P.; Nedvěd, Oldřich

    2010-01-01

    Roč. 63, č. 2 (2010), s. 271-276. ISSN 1310-1331 Grant ostatní: Bulgarian National Science Fund, Ministry of Education and Science (BG) B-1508 Institutional research plan: CEZ:AV0Z50070508 Keywords : Oxycarenus lavaterae * host plant specificity * fecundity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.219, year: 2010

  11. Tenure and forest income

    DEFF Research Database (Denmark)

    Jagger, Pamela; Luckert, Martin K.; Duchelle, Amy E.;

    2014-01-01

    We explore the relationship between tenure and forest income in 271 villages throughout the tropics. We find that state-owned forests generate more forest income than private and community-owned forests both per household and per hectare. We explore whether forest income varies according to the e...

  12. The Use of Atmospheric Pressure Chemical Ionization Mass Spectrometry with High Performance Liquid Chromatography and Other Separation Techniques for Identification of Triacylglycerols

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Sigler, Karel

    2007-01-01

    Roč. 3, - (2007), s. 252-271. ISSN 1573-4110 R&D Projects: GA ČR GA203/06/0219 Institutional research plan: CEZ:AV0Z50200510 Keywords : triacylglycerols * atmospheric presssure chemical ionization * mass spectrometry Subject RIV: EE - Microbiology, Virology Impact factor: 1.815, year: 2007

  13. Why is the Bond Multiplicity in C2 so Elusive?

    Czech Academy of Sciences Publication Activity Database

    Cooper, D.L.; Penotti, F.E.; Ponec, Robert

    2015-01-01

    Roč. 1053, SI (2015), s. 189-194. ISSN 2210-271X Institutional support: RVO:67985858 Keywords : bond multiplicity in C2 * spin correlation matrices * full GVB and spin-coupled Subject RIV: CC - Organic Chemistry Impact factor: 1.545, year: 2014

  14. SwissProt search result: AK072136 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072136 J013129C05 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 8e-17 ...

  15. SwissProt search result: AK102027 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102027 J033080N03 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 1e-15 ...

  16. SwissProt search result: AK101297 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101297 J033033I19 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 1e-12 ...

  17. SwissProt search result: AK068816 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068816 J013162L02 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 3e-13 ...

  18. SwissProt search result: AK112048 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK112048 001-100-D12 (P19525) Interferon-induced, double-stranded RNA-activated pro...tein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 5e-15 ...

  19. SwissProt search result: AK121177 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121177 J023083E04 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 3e-14 ...

  20. SwissProt search result: AK072359 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072359 J023063C07 (P19525) Interferon-induced, double-stranded RNA-activated prot...ein kinase (EC 2.7.1.-) (Interferon-inducible RNA-dependent protein kinase) (p68 kinase) (P1/eIF-2A protein kinase) E2AK2_HUMAN 1e-12 ...