WorldWideScience

Sample records for bohrium 271

  1. Impact of COST 271

    Directory of Open Access Journals (Sweden)

    P. A. Bradley

    2004-06-01

    Full Text Available This article discusses the significance of the achievements of the COST 271 Action on science and technology for space weather and telecommunications in Europe and the world. The Action's work has impacted national and international projects and the decision processes. The key words encompassed in the title of COST 271 are «space weather». But as the reader of this Final Report will appreciate, many more topics were addressed during the Action by the large team of workers from a wide range of countries and organisations than this wording would suggest. Relevant to the performance of telecommunication systems that rely on the presence of the ionosphere for propagation support, or that are affected by transmission through it, there have been investigations among other items of solar and magnetosphere disturbances on the ionosphere, satellite and ground-based measurements of the ionosphere, assembly of near-real-time databases of ionosphere information on the Web, studies of planetary and gravity waves in the ionosphere, ionosphere modelling, mapping and forecasting, long-term changes, ray-path deviations in the presence of irregularities, channel-scattering functions, and scintillations on Earth-space paths. The impact of all this work on the outside communities can be considered within three broad headings as follows.

  2. 36 CFR 271.4 - Commercial license.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial license. 271.4 Section 271.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE USE OF âSMOKEY BEARâ SYMBOL § 271.4 Commercial license. (a) The Chief may authorize the commercial...

  3. 7 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...- tative. Assessment an in-depth evaluation of employability skills coupled with counseling on how and... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 271.2 Section 271.2 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM GENERAL INFORMATION AND DEFINITIONS § 271.2...

  4. 48 CFR 719.271-1 - General.

    Science.gov (United States)

    2010-10-01

    ... 719.271-1 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-1 General. The purpose of this section is to prescribe responsibilities and procedures for carrying out the small business program policy set forth in 219.270, and...

  5. 49 CFR 192.271 - Scope.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Scope. 192.271 Section 192.271 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Scope. (a) This subpart prescribes minimum requirements for joining materials in pipelines, other...

  6. 14 CFR 271.9 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Discrimination prohibited. 271.9 Section... TRANSPORTATION § 271.9 Discrimination prohibited. (a) All air carriers receiving subsidy under this part shall comply with the following: (1) The Age Discrimination Act of 1975; (2) The Civil Rights Act of 1964...

  7. 40 CFR 421.271 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Specialized definitions. 421.271 Section 421.271 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Rare Earth...

  8. 48 CFR 1352.271-76 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1352.271-76... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-76 Performance. As prescribed in 48 CFR 1371.107, insert the following clause: Performance (APR 2010) (a) The contractor...

  9. Dicty_cDB: SFC271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC271 (Link to dictyBase) - - - Contig-U16328-1 SFC271P (Link to Original site) SFC...271F 197 SFC271Z 559 SFC271P 756 - - Show SFC271 Library SF (Link to library) Clone ID SFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFC2-C/SFC271Q.Seq.d/ Representative seq. ID SFC...271P (Link to Original site) Representative DNA sequence >SFC271 (SFC271Q) /CSM/SF/SFC2-C/SFC2...Sequences producing significant alignments: (bits) Value SFC271 (SFC271Q) /CSM/SF/SFC2-C/SFC271Q.Seq.d/ 1150

  10. Dicty_cDB: SLI271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLI271 (Link to dictyBase) sli271 G22510 DDB0229898 Contig-U01385-1 SLI2...71P (Link to Original site) SLI271F 213 SLI271Z 565 SLI271P 778 - - Show SLI271 Library SL (Link to library) Clone ID SLI2...71 (Link to dictyBase) Atlas ID sli271 NBRP ID G22510 dictyBase ID DDB0229898 Link t...o Contig Contig-U01385-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLI2-C/SLI2...71Q.Seq.d/ Representative seq. ID SLI271P (Link to Original site) Representative DNA sequence >SLI271 (SLI2

  11. 40 CFR 98.271 - Reporting threshold.

    Science.gov (United States)

    2010-07-01

    ...) MANDATORY GREENHOUSE GAS REPORTING Pulp and Paper Manufacturing § 98.271 Reporting threshold. You must report GHG emissions under this subpart if your facility contains a pulp and paper manufacturing...

  12. 47 CFR 0.271 - Authority delegated.

    Science.gov (United States)

    2010-10-01

    ... of Strategic Planning and Policy Analysis § 0.271 Authority delegated. (a) Insofar as authority is... status, the Chief, Office of Strategic Planning and Policy Analysis is delegated authority to deny... Strategic Planning and Policy Analysis has primary authority. (b) Chief, Media Bureau...

  13. 48 CFR 719.271-3 - USAID contracting officers.

    Science.gov (United States)

    2010-10-01

    .... 719.271-3 Section 719.271-3 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-3 USAID contracting officers. With...) Being thoroughly familiar with part 19 of the FAR and this section dealing with the small...

  14. 48 CFR 719.271 - Agency program direction and operation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Agency program direction and operation. 719.271 Section 719.271 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271 Agency program direction...

  15. 48 CFR 719.271-5 - Cognizant technical officers.

    Science.gov (United States)

    2010-10-01

    ... officers. 719.271-5 Section 719.271-5 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-5 Cognizant technical officers... cognizant technical officers can affect the opportunity of small business to participate...

  16. 48 CFR 719.271-6 - Small business screening procedure.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business screening procedure. 719.271-6 Section 719.271-6 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-6 Small business...

  17. 7 CFR 27.1 - Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Meaning of words. 27.1 Section 27.1 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... CLASSIFICATION UNDER COTTON FUTURES LEGISLATION Regulations Definitions § 27.1 Meaning of words. Words used...

  18. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  19. 12 CFR 271.9 - Fee schedules; waiver of fees.

    Science.gov (United States)

    2010-01-01

    ... 271.9 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES... pursuant to § 271.5 will pay the applicable fees, unless the request includes a limitation on fees to be... because it is likely to contribute significantly to public understanding of the operation or activities...

  20. 7 CFR 205.271 - Facility pest management practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Facility pest management practice standard. 205.271 Section 205.271 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS...

  1. 48 CFR 1352.271-87 - Changes-ship repair.

    Science.gov (United States)

    2010-10-01

    ...—ship repair. As prescribed in 48 CFR 1371.118, insert the following clause: Changes—Ship Repair (APR... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Changes-ship repair. 1352.271-87 Section 1352.271-87 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES...

  2. 48 CFR 3437.271 - Services of consultants clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Services of consultants clause. 3437.271 Section 3437.271 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION REGULATION SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Consulting Services...

  3. 48 CFR 719.271-4 - Heads of contracting activities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Heads of contracting activities. 719.271-4 Section 719.271-4 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL... made by SDB; (b) Consulting with SDB in establishing small business and minority business...

  4. Dicty_cDB: AFH271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available es producing significant alignments: (bits) Value AFH271 (AFH271Q) /CSM/AF/AFH2-C/AFH271Q.Seq.d/ 151 3e-36 A...g significant alignments: (bits) Value AF508975_1( AF508975 |pid:none) Dictyostelium discoideum SslA1 (ss....../AH/AHP2-A/AHP219Q.Seq.d/ 32 1.9 own update 2009. 4. 3 Homology vs DNA Score E Sequences producing significant alignments: (bits) Val...ue N AF508975 |AF508975.1 Dictyostelium discoideum SslA1

  5. 29 CFR 500.271 - Certification of official record.

    Science.gov (United States)

    2010-07-01

    ... MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Administrative Proceedings Record § 500.271 Certification of official record. Upon receipt of timely notice of appeal to a United States District Court... and file with the appropriate United States District Court, a full, true, and correct copy of...

  6. 48 CFR 719.271-2 - The USAID Office of Small and Disadvantaged Business Utilization (SDB).

    Science.gov (United States)

    2010-10-01

    ... and Disadvantaged Business Utilization (SDB). 719.271-2 Section 719.271-2 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-2 The USAID Office of Small and Disadvantaged Business Utilization (SDB). (a) SDB...

  7. 27 CFR 27.1 - Imported distilled spirits, wines, and beer.

    Science.gov (United States)

    2010-04-01

    ..., wines, and beer. 27.1 Section 27.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Scope of Regulations § 27.1 Imported distilled spirits, wines, and beer. This part, “Importation...

  8. 48 CFR 852.271-72 - Time spent by counselee in counseling process.

    Science.gov (United States)

    2010-10-01

    ... counseling process. 852.271-72 Section 852.271-72 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-72 Time spent by counselee in counseling process. As prescribed in 871.212, insert the following clause: Time Spent by Counselee in Counseling Process (APR 1984) The contractor agrees that...

  9. 48 CFR 852.271-73 - Use and publication of counseling results.

    Science.gov (United States)

    2010-10-01

    ... counseling results. 852.271-73 Section 852.271-73 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-73 Use and publication of counseling results. As prescribed in 871.212, insert the following clause: Use and Publication of Counseling Results (JAN 2008) The contractor agrees that none...

  10. Phenotype abnormality: 271 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 271 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u776i elongated hypocotyl in environment... of short day length regimen in environment of short day length regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u40i hypocotyl ... elongated ...

  11. 48 CFR 719.271-7 - Reports on procurement actions that are exempted from screening.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Reports on procurement actions that are exempted from screening. 719.271-7 Section 719.271-7 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies...

  12. 43 CFR 30.271 - How must the tribe pay for the interests it purchases?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How must the tribe pay for the interests it purchases? 30.271 Section 30.271 Public Lands: Interior Office of the Secretary of the Interior... the tribe pay for the interests it purchases? (a) A tribe must pay the full fair market value of...

  13. 36 CFR 271.8 - Consultation with Association of State Foresters and the Advertising Council.

    Science.gov (United States)

    2010-07-01

    ... of State Foresters and the Advertising Council. 271.8 Section 271.8 Parks, Forests, and Public... Association of State Foresters and the Advertising Council. These regulations in this part have been issued after consultation with the Association of State Foresters and the Advertising Council....

  14. 48 CFR 853.271 - Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. 853.271 Section 853.271 Federal Acquisition... Guaranty, Education and Vocational Rehabilitation and Counseling Programs....

  15. The role of the cancer stem cell marker CD271 in DNA damage response and drug resistance of melanoma cells

    Science.gov (United States)

    Redmer, T; Walz, I; Klinger, B; Khouja, S; Welte, Y; Schäfer, R; Regenbrecht, C

    2017-01-01

    Several lines of evidence have suggested that stemness and acquired resistance to targeted inhibitors or chemotherapeutics are mechanistically linked. Here we observed high cell surface and total levels of nerve growth factor receptor/CD271, a marker of melanoma-initiating cells, in sub-populations of chemoresistant cell lines. CD271 expression was increased in drug-sensitive cells but not resistant cells in response to DNA-damaging chemotherapeutics etoposide, fotemustine and cisplatin. Comparative analysis of melanoma cells engineered to stably express CD271 or a targeting short hairpin RNA by expression profiling provided numerous genes regulated in a CD271-dependent manner. In-depth analysis of CD271-responsive genes uncovered the association of CD271 with regulation of DNA repair components. In addition, gene set enrichment analysis revealed enrichment of CD271-responsive genes in drug-resistant cells, among them DNA repair components. Moreover, our comparative screen identified the fibroblast growth factor 13 (FGF13) as a target of CD271, highly expressed in chemoresistant cells. Further we show that levels of CD271 determine drug response. Knock-down of CD271 in fotemustine-resistant cells decreased expression of FGF13 and at least partly restored sensitivity to fotemustine. Together, we demonstrate that expression of CD271 is responsible for genes associated with DNA repair and drug response. Further, we identified 110 CD271-responsive genes predominantly expressed in melanoma metastases, among them were NEK2, TOP2A and RAD51AP1 as potential drivers of melanoma metastasis. In addition, we provide mechanistic insight in the regulation of CD271 in response to drugs. We found that CD271 is potentially regulated by p53 and in turn is needed for a proper p53-dependent response to DNA-damaging drugs. In summary, we provide for the first time insight in a CD271-associated signaling network connecting CD271 with DNA repair, drug response and metastasis. PMID

  16. 48 CFR 1352.271-82 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1352.271-82 Section 1352.271-82 Federal Acquisition... of Provisions and Clauses 1352.271-82 Department of Labor occupational safety and health standards... Occupational Safety and Health Standards for Ship Repair (APR 2010) The contractor, in performance of all...

  17. Phosphorylation of Serine 271 on 5-Lipoxygenase and Its Role in Nuclear Export*

    OpenAIRE

    Flamand, Nicolas; Luo, Ming; Peters-Golden, Marc; Brock, Thomas G.

    2009-01-01

    The enzyme 5-lipoxygenase (5-LO) initiates the biosynthesis of leukotrienes, inflammatory mediators involved in immune diseases and defense. The subcellular localization of 5-LO is regulated, with nuclear import commonly leading to increased leukotriene production. We report here that 5-LO is constitutively phosphorylated on Ser-271 in transfected NIH 3T3 cells. This residue is nested in a classical nuclear export sequence, and phosphorylated Ser-271 5-LO was exclusive...

  18. 25 CFR 700.271 - Requests for notification of existence of records: Submission.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Requests for notification of existence of records... OPERATIONS AND RELOCATION PROCEDURES Privacy Act § 700.271 Requests for notification of existence of records... requires that an individual contact more than two officials concerning the existence of records in...

  19. 14 CFR 135.271 - Helicopter hospital emergency medical evacuation service (HEMES).

    Science.gov (United States)

    2010-01-01

    ....271 Helicopter hospital emergency medical evacuation service (HEMES). (a) No certificate holder may... assignment, for hospital emergency medical evacuation service helicopter operations unless that assignment... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Helicopter hospital emergency...

  20. Yeast Interacting Proteins Database: YDR271C, YOR128C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative...YDR271C - Dubious open reading frame unlikely to encode a protein, based on available experimental and compa...rative sequence data; partially overlaps the verified ORF CCC2/YDR270W Rows with th

  1. 12 CFR 271.5 - Records available to the public on request.

    Science.gov (United States)

    2010-01-01

    ....5 Section 271.5 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE... Committee's operations. (2) The request shall be submitted in writing to the Secretary of the Committee, Federal Open Market Committee, 20th & C Street, N.W., Washington, D.C. 20551; or sent by facsimile to...

  2. 40 CFR 271.12 - Requirements for hazardous waste management facilities.

    Science.gov (United States)

    2010-07-01

    ... Requirements for Final Authorization § 271.12 Requirements for hazardous waste management facilities. The State shall have standards for hazardous waste management facilities which are equivalent to 40 CFR parts 264... reporting. States that choose to receive electronic documents must include the requirements of 40 CFR Part...

  3. 48 CFR 2923.271 - Purchase and use of environmentally sound and energy efficient products and services.

    Science.gov (United States)

    2010-10-01

    ... environmentally sound and energy efficient products and services. 2923.271 Section 2923.271 Federal Acquisition... content products, environmentally preferable products and services, biobased products, energy- and water... and use of environmentally preferable products and services and implement cost-effective...

  4. Fluorocycline TP-271 Is Potent against Complicated Community-Acquired Bacterial Pneumonia Pathogens

    Science.gov (United States)

    Fyfe, Corey; O’Brien, William; Hackel, Meredith; Minyard, Mary Beth; Waites, Ken B.; Dubois, Jacques; Murphy, Timothy M.; Slee, Andrew M.; Weiss, William J.; Sutcliffe, Joyce A.

    2017-01-01

    ABSTRACT TP-271 is a novel, fully synthetic fluorocycline antibiotic in clinical development for the treatment of respiratory infections caused by susceptible and multidrug-resistant pathogens. TP-271 was active in MIC assays against key community respiratory Gram-positive and Gram-negative pathogens, including Streptococcus pneumoniae (MIC90 = 0.03 µg/ml), methicillin-sensitive Staphylococcus aureus (MSSA; MIC90 = 0.25 µg/ml), methicillin-resistant S. aureus (MRSA; MIC90 = 0.12 µg/ml), Streptococcus pyogenes (MIC90 = 0.03 µg/ml), Haemophilus influenzae (MIC90 = 0.12 µg/ml), and Moraxella catarrhalis (MIC90 ≤0.016 µg/ml). TP-271 showed activity (MIC90 = 0.12 µg/ml) against community-acquired MRSA expressing Panton-Valentine leukocidin (PVL). MIC90 values against Mycoplasma pneumoniae, Legionella pneumophila, and Chlamydia pneumoniae were 0.004, 1, and 4 µg/ml, respectively. TP-271 was efficacious in neutropenic and immunocompetent animal pneumonia models, generally showing, compared to the burden at the start of dosing, ~2 to 5 log10 CFU reductions against MRSA, S. pneumoniae, and H. influenzae infections when given intravenously (i.v.) and ~1 to 4 log10 CFU reductions when given orally (p.o.). TP-271 was potent against key community-acquired bacterial pneumonia (CABP) pathogens and was minimally affected, or unaffected, by tetracycline-specific resistance mechanisms and fluoroquinolone or macrolide drug resistance phenotypes. IMPORTANCE Rising resistance rates for macrolides, fluoroquinolones, and β-lactams in the most common pathogens associated with community-acquired bacterial pneumonia (CABP) are of concern, especially for cases of moderate to severe infections in vulnerable populations such as the very young and the elderly. New antibiotics that are active against multidrug-resistant Streptococcus pneumoniae and Staphylococcus aureus are needed for use in the empirical treatment of the most severe forms of this disease. TP-271 is a promising

  5. Solvent Hold Tank Sample Results for MCU-16-270-271-272: February 2016 Monthly Sample

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-05-12

    Savannah River National Lab (SRNL) received one set of Solvent Hold Tank (SHT) samples (MCU-16-270-271-272), pulled on 02/21/2016 for analysis. The samples were combined and analyzed for composition. Analysis of the composite sample MCU-16-270-271-272 indicated the IsoparTML concentration is above its nominal level (101%). The modifier (CS-7SB), the extractant (MaxCalix), and the TiDG concentrations are 7%, 6%, and 40% below their nominal concentrations. This analysis confirms the addition of TiDG, MaxCalix, and modifier to the solvent in November 2015. Based on the current monthly sample, the levels of TiDG, IsoparTML, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time. Periodic characterization and trimming additions to the solvent are recommended.

  6. u271gm.m77t - MGD77 data file for Geophysical data from field activity U-2-71-GM in East Margin Yucatan Peninsula from 06/23/1971 to 07/08/1971

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam, bathymetry, gravity, and magnetic data along with transit satellite navigation data was collected as part of the U.S. Geological Survey cruise U271GM....

  7. Examining the feasibility of clinical grade CD271+ enrichment of mesenchymal stromal cells for bone regeneration.

    Directory of Open Access Journals (Sweden)

    Richard J Cuthbert

    Full Text Available Current clinical trials utilize mesenchymal stromal cells (MSCs expanded in culture, however these interventions carry considerable costs and concerns pertaining to culture-induced losses of potency. This study assessed the feasibility of new clinical-grade technology to obtain uncultured MSC isolates from three human intra-osseous tissue sources based on immunomagnetic selection for CD271-positive cells.MSCs were isolated from bone marrow (BM aspirates or surgical waste materials; enzymatically digested femoral heads (FHs and reamer irrigator aspirator (RIA waste fluids. Flow cytometry for the CD45-/lowCD73+CD271+ phenotype was used to evaluate uncultured MSCs before and after selection, and to measure MSC enrichment in parallel to colony forming-unit fibroblast assay. Trilineage differentiation assays and quantitative polymerase chain-reaction for key transcripts involved in bone regeneration was used to assess the functional utility of isolated cells for bone repair.Uncultured CD45-/lowCD271+ MSCs uniformly expressed CD73, CD90 and CD105 but showed variable expression of MSCA-1 and SUSD2 (BM>RIA>FH. MSCs were enriched over 150-fold from BM aspirates and RIA fluids, whereas the highest MSC purities were obtained from FH digests. Enriched fractions expressed increased levels of BMP-2, COL1A2, VEGFC, SPARC and CXCL12 transcripts (BM>RIA>FH, with the highest up-regulation detected for CXCL12 in BM (>1300-fold. Following culture expansion, CD271-selected MSCS were tri-potential and phenotypically identical to plastic adherence-selected MSCs.A CD271-based GMP-compliant immunomagnetic selection resulted in a substantial increase in MSC purity and elevated expression of transcripts involved in bone formation, vascularisation and chemo-attraction. Although this technology, particularly from RIA fluids, can be immediately applied by orthopaedic surgeons as autologous therapy, further improvements in MSC purities and pre-clinical testing of product

  8. Trehalose preincubation increases mesenchymal (CD271+ stem cells post-cryopreservation viability

    Directory of Open Access Journals (Sweden)

    Indra Kusuma

    2016-10-01

    Full Text Available Background: Dimethyl sulfoxide (Me2SO is a common cryoprotective agent widely used in cell preservation system. Me2SO is currently known to cause epigenetic changes which are  critical in stem cells development and cellular differentiation. Therefore, it is imperative to develop cryopreservation techniques that protect cellular functions and avert Me2SO adverse effect. Trehalose was able to protect organism in extreme condition such as dehydration and cold. This study aimed to verify the protective effect of trehalose preincubation procedure in cryopreservation.Methods: The study was conducted using experimental design. Thawed mesenchymal (CD271+ stem cells from YARSI biorepository were used for the experiment. Trehalose preincubation was performed for 1 hour, internalized trehalose was confirmed by FTIR-ATR measurement. Three groups consisted of (1 cryopreserved without trehalose preincubation, (2 cryopreserved with trehalose preincubation, and (3 did not undergo cryopreservation were evaluated after 24 hours in LN2 for viability in culture. The absorbance from each group was measured at 450 nm. The analysis performed using paired student t test.Results: Viability of thawed mesenchymal (CD271+ stem cells that undergo trehalose preincubation prior cryopreservation was significantly higher (p<0.05 compared to group without trehalose preincubation. Higher viability observed between group with trehalose preincubation compared with controlled group suggests protection to trypsinization. Mesenchymal (CD271+ stem cells incubated for 1 hour in 100 mM trehalose supplemented medium  results in 15%  trehalose loading efficiency.Conclusion: These findings confirm the protective effect of trehalose preincubation in cryopreservation. Future research should be directed to elucidate the trehalose internalization mechanism and eventually the protective mechanism of trehalose in mammalian cell cryopreservation.

  9. The CD271 expression could be alone for establisher phenotypic marker in Bone Marrow derived mesenchymal stem cells.

    Directory of Open Access Journals (Sweden)

    Antonio Carrasco-Yalan

    2011-04-01

    Full Text Available Mesenchymal stem cells (MSCs are of great interest for their potential use in cellular therapies. To define the population more precisely, diverse surface markers have been used. We propose here to use CD271 as the sole marker for MSCs in fresh bone marrow. We compared CD271+ populations to the presence or absence of five defined markers for MSCs: CD90+, CD105+, CD45-, CD34- and CD79. The correlations between markers were evaluated and analyzed with a Pearson's correlation test. We found that the average percentage of cells expressing the combination of markers CD90+, CD105+, CD45-, CD34- and CD79- was 0.54%, and that the average percentage average of CD271+ cells was 0.53%. The results were significant (p<0.05. The exclusive use of CD271 as a marker for MSCs from fresh samples of bone marrow appears to be highly selective. Using CD271 as the sole identification marker for MSCs could reduce costs and accelerate the process of identifying MSCs for the field of cellular therapy.

  10. The CD271 expression could be alone for establisher phenotypic marker in Bone Marrow derived mesenchymal stem cells

    Directory of Open Access Journals (Sweden)

    Edgardo Flores-Torales

    2010-04-01

    Full Text Available Mesenchymal stem cells (MSCs are of great interest for their potential use in cellular therapies. To define thepopulation more precisely, diverse surface markers have been used. We propose here to use CD271 as the sole marker forMSCs in fresh bone marrow. We compared CD271+ populations to the presence or absence of five defined markers forMSCs: CD90+, CD105+, CD45-, CD34- and CD79. The correlations between markers were evaluated and analyzed with aPearson's correlation test. We found that the average percentage of cells expressing the combination of markers CD90+,CD105+, CD45-, CD34- and CD79- was 0.54%, and that the average percentage average of CD271+ cells was 0.53%. Theresults were significant (p<0.05. The exclusive use of CD271 as a marker for MSCs from fresh samples of bone marrowappears to be highly selective. Using CD271 as the sole identification marker for MSCs could reduce costs and acceleratethe process of identifying MSCs for the field of cellular therapy.

  11. CD271+ Mesenchymal Stem Cells as a Possible Infectious Niche for Leishmania infantum

    Science.gov (United States)

    Lopes, Carolina S.; Daifalla, Nada; Das, Bikul; Dias da Silva, Valdo; Campos-Neto, Antonio

    2016-01-01

    Visceral leishmaniasis (VL) is a serious and fatal disease. Therapeutic drugs are toxic and non-sterilizing. The etiological agents Leishmania infantum and Leishmania donovani cause active and asymptomatic diseases. Effective drugs to treat VL exist but unfortunately, post-treatment relapses are common. Little is known why drugs are non-sterilizing or how these intracellular pathogens can escape treatment. Here, using a murine model of VL we found that CD271+/Sca1+ bone marrow mesenchymal stem cells (BM-MSCs) are readily infected in vitro and in vivo by L. infantum. Because BM-MSCs express potent drug efflux pumps, e.g., ABCG2 it is possible that this unique intracellular infectious niche could allow L. infantum to escape anti-parasite drugs. PMID:27622907

  12. Fusion of a Sendai mutant deficient in HN protein (ts271) with cardiolipin liposomes

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, S.; Bundo-Morita, K.; Portner, A.; Lenard, J.

    1988-03-01

    Sendai mutant ts271 contains less than 5% of the amount of HN glycoprotein found in wild-type Sendai. Fusion of this mutant with cardiolipin liposomes revealed no differences from the wild-type virus with regard to specific activity, pH dependence, or radiation inactivation. Target sizes of both mutant and wild-type viral proteins were determined by the radiation-induced disappearance of each band from an SDS-polyacrylamide gel and no differences were found. Of the viral proteins, only F had a target size corresponding to the monomer molecular weight, ca. 60 kDa, identical to the minimum unit previously determined by functional assay for Sendai virus-erythrocyte membrane fusion. This provides additional evidence that F alone is the active protein mediating Sendai-erythrocyte fusion. It is concluded that the HN protein is unlikely to mediate any fusion reactions of the intact virions, either with biological membranes or with cardiolipin liposomes.

  13. X-linked congenital ataxia: a new locus maps to Xq25-q27.1.

    Science.gov (United States)

    Zanni, Ginevra; Bertini, Enrico; Bellcross, Cecelia; Nedelec, Brigitte; Froyen, Guy; Neuhäuser, Gerhard; Opitz, John M; Chelly, Jamel

    2008-03-01

    We report clinical and molecular studies on a large American family of Norwegian descent with X-linked nonprogressive congenital ataxia (XCA) in six affected males over three generations. Neuroimaging showed global cerebellar hypoplasia without evidence of supratentorial anomalies. Linkage analysis resulted in a maximum LOD score Z = 3.44 for marker DXS1192 at Theta = 0.0 with flanking markers DXS1047 and DXS1227 defining a region of 12 cM in Xq25-q27.1. The clinical and neuroradiological findings in the present family are very similar to those described in two reported X-linked families [Illarioshkin et al., 1996; Bertini et al., 2000]; however, the newly identified locus does not overlap with the one defined previously, indicating that there are at least two genes responsible for this rare form of X-linked congenital cerebellar ataxia with normal intelligence.

  14. Defective Ti2Nb10O27.1: an advanced anode material for lithium-ion batteries

    Science.gov (United States)

    Lin, Chunfu; Yu, Shu; Zhao, Hua; Wu, Shunqing; Wang, Guizhen; Yu, Lei; Li, Yanfang; Zhu, Zi-Zhong; Li, Jianbao; Lin, Shiwei

    2015-12-01

    To explore anode materials with large capacities and high rate performances for the lithium-ion batteries of electric vehicles, defective Ti2Nb10O27.1 has been prepared through a facile solid-state reaction in argon. X-ray diffractions combined with Rietveld refinements indicate that Ti2Nb10O27.1 has the same crystal structure with stoichiometric Ti2Nb10O29 (Wadsley-Roth shear structure with A2/m space group) but larger lattice parameters and 6.6% O2- vacancies (vs. all O2- ions). The electronic conductivity and Li+ion diffusion coefficient of Ti2Nb10O27.1 are at least six orders of magnitude and ~2.5 times larger than those of Ti2Nb10O29, respectively. First-principles calculations reveal that the significantly enhanced electronic conductivity is attributed to the formation of impurity bands in Ti2Nb10O29-x and its conductor characteristic. As a result of the improvements in the electronic and ionic conductivities, Ti2Nb10O27.1 exhibits not only a large initial discharge capacity of 329 mAh g-1 and charge capacity of 286 mAh g-1 at 0.1 C but also an outstanding rate performance and cyclability. At 5 C, its charge capacity remains 180 mAh g-1 with large capacity retention of 91.0% after 100 cycles, whereas those of Ti2Nb10O29 are only 90 mAh g-1 and 74.7%.

  15. Insights from the computational analysis of CD271 glycation in mescenchymal stem cells in diabetes mellitus as a predisposition to latent tuberculosis.

    Science.gov (United States)

    Bhattacharyya, Rajasri; Shukla, Misha; Nagra, Sachin; Banerjee, Dibyajyoti

    2013-01-01

    Diabetes mellitus is considered as a predisposition factor for active tuberculosis and is known to activate the latent form of tuberculosis. However, the causative association of latent tuberculosis with diabetes is not conclusively established. Therefore, it is of interest to relate their predisposition. We describe the glycation pattern of mescenchymal stem cell surface markers as CD271+/CD45-mescenchymal stem cell is known to be associated with latent tuberculosis. We show that the lysine residues important for function of CD271 death domain are predicted to be and glycated. These observations help to discuss the role of CD271 and glycation to modulate the genesis of latent tuberculosis in chronic diabetic mellitus.

  16. Characterization of endo-β-mannanase from Enterobacter ludwigii MY271 and application in pulp industry.

    Science.gov (United States)

    Yang, Miao; Cai, Jun; Wang, Changgao; Du, Xin; Lin, Jianguo

    2017-01-01

    β-Mannanases are the second most important enzymes for the hydrolysis of hemicelluloses. An endo-β-mannanase from Enterobacter ludwigii MY271 was purified at 11.7 ± 0.2-fold to homogeneity with a final recovery of 15.2 ± 0.2 %. Using purified β-mannanase protein and SDS-PAGE, the molecular mass was found to be 43.16 kDa. The optimal pH and temperature of the enzyme was found to be 7.0 and 55 °C, respectively. The β-mannanase activity was stable over a broad pH range of pH 2.0-10.0. In addition, the purified enzyme was highly activated by several metal ions and chemical reagents, such as Mg(2+), L-cysteine, glutathione (GSH) and β-mercaptoethanol. Whereas the enzyme was strongly inhibited by Hg(2+), Cu(2+), N-bromosuccinimide (NBS), 1-ethyl-3-(3-dimethyl-amino-propyl)-carbodiimide (EDC), phenylmethanesulfonyl fluoride (PMSF), and sodium dodecyl sulfate (SDS). The β-mannanase was highly active towards glucomannan, and showed endo-activity by producing a mixture of oligosaccharides. Moreover, the enzyme displayed a classical endo-type mode on mannooligosaccharides. The β-mannanase coupled with xylanase significantly improved the brightness of kraft pulp, whereas it has no remarkable effect on the tensile strength of the pulp. Our functional studies of the purified β-mannanase indicate that the enzyme is beneficial to industrial applications, in particular, biotechnological processes, such as food, feed and pulp industry.

  17. Radical cystectomy for bladder cancer:oncologic outcome in 271 Chinese patients

    Institute of Scientific and Technical Information of China (English)

    Zhi-Ling Zhang; Pei Dong; Yong-Hong Li; Zhuo-Wei Liu; Kai Yao; Hui Han; Zi-Ke Qin; Fang-Jian Zhou

    2014-01-01

    Few large scale studies have reported the oncologic outcome of radical cystectomy for treating bladder cancer in China; hence, we lack long-term prognostic information. The aim of the current study was to determine the survival rate and prognostic factors of patients who underwent radical cystectomy for bladder cancer in a Chinese medical center. We retrospectively analyzed clinicopathologic data from 271 bladder cancer patients who underwent radical cystectomy between 2000 and 2011. Univariate and multivariate analyses were conducted to identify independent prognostic predictors for this cohort. Median follow-up was 31.7 months (range, 0.2-139.1 months). Thirty-day mortality was (1.4%). The 5-year recurrence-free survival, cancer-specific survival (CSS), and overall survival rates were 61.6%, 72.9%, and 68.0%, respectively. The 5-year CSS rates of patients with T1-T4 disease were 90.7%, 85.0%, 51.0%, and 18.0%, respectively. Patients with organ-confined disease had a higher 5-year CSS rate than those with extravesical disease (81.4%vs. 34.9%, P<0.001). For the 38 patients (14%) with lymph node involvement, the 5-year CSS rate was 27.7%-significantly lower than that of patients without lymph node metastasis (P < 0.001). The 5-year CSS rate was much higher in patients with low grade tumor than in those with high grade tumor (98.1%vs. 68.1%, P<0.001). Multivariate Cox regression showed that patient age (hazard ratio, 2.045; P = 0.013) and T category (hazard ratio, 2.213; P < 0.001) were independent predictors for CSS. These results suggest that radical cystectomy is a safe and effective method for treating bladder cancer in Chinese patients. Old age and high T category were associated with poor prognosis in bladder cancer patients who underwent radical cystectomy.

  18. Antibody Therapy Targeting CD47 and CD271 Effectively Suppresses Melanoma Metastasis in Patient-Derived Xenografts.

    Science.gov (United States)

    Ngo, Michael; Han, Arum; Lakatos, Anita; Sahoo, Debashis; Hachey, Stephanie J; Weiskopf, Kipp; Beck, Andrew H; Weissman, Irving L; Boiko, Alexander D

    2016-08-09

    The high rate of metastasis and recurrence among melanoma patients indicates the existence of cells within melanoma that have the ability to both initiate metastatic programs and bypass immune recognition. Here, we identify CD47 as a regulator of melanoma tumor metastasis and immune evasion. Protein and gene expression analysis of clinical melanoma samples reveals that CD47, an anti-phagocytic signal, correlates with melanoma metastasis. Antibody-mediated blockade of CD47 coupled with targeting of CD271(+) melanoma cells strongly inhibits tumor metastasis in patient-derived xenografts. This therapeutic effect is mediated by drastic changes in the tumor and metastatic site immune microenvironments, both of whichwhich exhibit greatly increased density of differentiated macrophages and significantly fewer inflammatory monocytes, pro-metastatic macrophages (CCR2(+)/VEGFR1(+)), and neutrophils, all of which are associated with disease progression. Thus, antibody therapy that activates the innate immune response in combination with selective targeting of CD271(+) melanoma cells represents a powerful therapeutic approach against metastatic melanoma.

  19. Antibody Therapy Targeting CD47 and CD271 Effectively Suppresses Melanoma Metastasis in Patient-Derived Xenografts

    Directory of Open Access Journals (Sweden)

    Michael Ngo

    2016-08-01

    Full Text Available The high rate of metastasis and recurrence among melanoma patients indicates the existence of cells within melanoma that have the ability to both initiate metastatic programs and bypass immune recognition. Here, we identify CD47 as a regulator of melanoma tumor metastasis and immune evasion. Protein and gene expression analysis of clinical melanoma samples reveals that CD47, an anti-phagocytic signal, correlates with melanoma metastasis. Antibody-mediated blockade of CD47 coupled with targeting of CD271+ melanoma cells strongly inhibits tumor metastasis in patient-derived xenografts. This therapeutic effect is mediated by drastic changes in the tumor and metastatic site immune microenvironments, both of whichwhich exhibit greatly increased density of differentiated macrophages and significantly fewer inflammatory monocytes, pro-metastatic macrophages (CCR2+/VEGFR1+, and neutrophils, all of which are associated with disease progression. Thus, antibody therapy that activates the innate immune response in combination with selective targeting of CD271+ melanoma cells represents a powerful therapeutic approach against metastatic melanoma.

  20. Human Non-Hematopoietic CD271pos/CD140alow/neg Bone Marrow Stroma Cells Fulfill Stringent Stem Cell Criteria in Serial Transplantations

    Science.gov (United States)

    Ghazanfari, Roshanak; Li, Hongzhe; Zacharaki, Dimitra; Lim, Hooi Ching

    2016-01-01

    Human bone marrow contains a population of non-hematopoietic stromal stem/progenitor cells (BMSCs), which play a central role for bone marrow stroma and the hematopoietic microenvironment. However, the precise characteristics and potential stem cell properties of defined BMSC populations have not yet been thoroughly investigated. Using standard adherent colony-forming unit fibroblast (CFU-F) assays, we have previously shown that BMSCs were highly enriched in the nonhematopoietic CD271pos/CD140alow/neg fraction of normal adult human bone marrow. In this study, we demonstrate that prospectively isolated CD271pos/CD140alow/neg BMSCs expressed high levels of hematopoiesis supporting genes and signature mesenchymal and multipotency genes on a single cell basis. Furthermore, CD271pos/CD140alow/neg BMSCs gave rise to non-adherent sphere colonies (mesenspheres) with typical surface marker profile and trilineage in vitro differentiation potential. Importantly, serial transplantations of CD271pos/CD140alow/neg BMSC-derived mesenspheres (single cell and bulk) into immunodeficient NOD scid gamma (NSG) mice showed increased mesensphere numbers and full differentiation potential after both primary and secondary transplantations. In contrast, BMSC self-renewal potential decreased under standard adherent culture conditions. These data therefore indicate that CD271pos/CD140alow/neg BMSCs represent a population of primary stem cells with MSC phenotype and sphere-forming capacity that fulfill stringent functional stem cell criteria in vivo in a serial transplantation setting. PMID:27527928

  1. HL271, a novel chemical compound derived from metformin, differs from metformin in its effects on the circadian clock and metabolism.

    Science.gov (United States)

    Row, Hansang; Jeong, Jaekap; Cho, Sehyung; Kim, Sungwuk; Kim, Kyungjin

    2016-01-15

    Metformin is a treatment of choice for patients with type 2 diabetes. Its action involves the phosphorylation of 5'-adenosine monophosphate activated protein kinase (AMPK), leading to inhibition of liver gluconeogenesis. The effects of a novel chemical compound derived from metformin, HL271, on molecular and physiological actions involving AMPK and rhythmically-expressed circadian clock genes were investigated. HL271 potently activated AMPK in a dose-dependent manner, and produced shortening of the circadian period and enhanced degradation of the clock genes PER2 and CRY1. Although the molecular effects of HL271 resembled those of metformin, it produced different physiological effects in mice with diet-induced obesity. HL271 did not elicit glucose-lowering or insulin-sensitizing effects, possibly because of altered regulation of glucose-6-phosphatase and phosphoenolpyruvate carboxykinase 1. This indicated that, although HL271 acted on circadian clock machinery through a similar molecular mechanism to metformin, it differed in its systemic effect on glucose and lipid metabolite regulations.

  2. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV.

    Science.gov (United States)

    Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa

    2015-06-12

    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4(K271R) mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4(K210R) mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3'-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4(K271R) was defective in the nuclear localization of itself and LIG4, whereas XRCC4(K210R) was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4(K271R), but not M10-XRCC4(K210R), showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4(WT). The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4(K271R) than in M10-XRCC4(WT), whereas it was only marginally increased in M10-XRCC4(K210R) as compared to M10-XRCC4(WT). The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4.

  3. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail: yoshim@nr.titech.ac.jp

    2015-06-12

    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4{sup K271R} mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4{sup K210R} mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4{sup K271R} was defective in the nuclear localization of itself and LIG4, whereas XRCC4{sup K210R} was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4{sup K271R}, but not M10-XRCC4{sup K210R}, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4{sup WT}. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4{sup K271R} than in M10-XRCC4{sup WT}, whereas it was only marginally increased in M10-XRCC4{sup K210R} as compared to M10-XRCC4{sup WT}. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4{sup K271R} is defective in the nuclear localization of itself and LIG4. • XRCC4{sup K210R} is competent for the nuclear localization of itself and LIG4. • XRCC4{sup K271R} is deficient in DSB repair function. • XRCC4{sup K210R} is mostly normal in DSB repair function.

  4. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Timofeev, V. I., E-mail: inna@ns.crys.ras.ru, E-mail: tostars@mail.ru, E-mail: ugama@yandex.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Abramchik, Yu. A. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Zhukhlistova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Muravieva, T. I.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

    2016-01-15

    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

  5. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    Science.gov (United States)

    Timofeev, V. I.; Abramchik, Yu. A.; Zhukhlistova, N. E.; Muravieva, T. I.; Esipov, R. S.; Kuranova, I. P.

    2016-01-01

    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

  6. Crystal Growth in Al72.9Ge27.1 Alloy Melt under Acoustic Levitation Conditions

    Institute of Scientific and Technical Information of China (English)

    YAN Na; DAI Fu-Ping; WANG Wei-Li; WEI Bing-Bo

    2011-01-01

    The nonequilibrium solidification of liquid Al72.9Ge27.1 hypoeutectic alloy is accomplished by using single-axis acoustic levitation.A maximum undercooling of 112K (0.16TL) is obtained for the alloy melt at a coofing rate of 50 K/s. The primary (Al) phase displays a morphological transition from coarse dendrite under a normal conditions to equiaxed grain under acoustic levitation.In the (Al)+(Ge) eutectic,the (Ge) phase exhibits a conspicuous branched growth morphology.Both the primary (Al) dendrites and (Al)+(Ge) eutectics are well refined and the solute content of the primary (Al) phase is extended under acoustic levitation.The calculated and experimental results indicate that the solute trapping effect becomes more intensive with the enhancement of bulk undercooling.

  7. CLINICAL DIAGNOSIS ANALYSIS ON 271 CASES POLYTRAUMA PRIMARILY WITH ABDOMINAL TRAUMA%271例以腹部外伤为主的多发伤的临床诊疗分析

    Institute of Scientific and Technical Information of China (English)

    邓林军; 崔华中; 黄铿; 陈维荣

    2012-01-01

    目的 探讨以腹部外伤为主的多发伤的诊断与治疗.方法 对我院2006年8月~2011年8月收治的以腹部外伤为主的多发伤271例的诊断、治疗做回顾性分析.结果 手术治疗165例(60.9%),非手术治疗106例(39.1%),治愈241例(88.9%),死亡30例(11.1%).其中13例死于多脏器功能衰竭障碍综合症(MODS);9例死于严重失血性休克,3例肠破裂入院2 d后中毒性休克死亡;1 例脾破裂合并肺挫伤患者术后死于急性左心功能衰竭;2例死于急性肾功能衰竭;2 例合并颅脑外伤者死于脑疝.结论 以腹部外伤为主的多发伤的诊断要及时、明确.治疗要首选对生命威胁最大的损伤进行处理,尽早实行确定性手术治疗,积极主动实施创伤控制性手术(DCO)策略,快速有效止血,避免漏诊,降低病死率.

  8. Insights from the computational analysis of CD271 glycation in mescenchymal stem cells in diabetes mellitus as a predisposition to latent tuberculosis

    OpenAIRE

    Bhattacharyya, Rajasri; Shukla, Misha; Nagra, Sachin; Banerjee, Dibyajyoti

    2013-01-01

    Diabetes mellitus is considered as a predisposition factor for active tuberculosis and is known to activate the latent form of tuberculosis. However, the causative association of latent tuberculosis with diabetes is not conclusively established. Therefore, it is of interest to relate their predisposition. We describe the glycation pattern of mescenchymal stem cell surface markers as CD271+/CD45-mescenchymal stem cell is known to be associated with latent tuberculosis. We show that the lysine ...

  9. Closure Report for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada with Errata Sheet, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Mark Krauss

    2004-08-01

    The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.

  10. Long-term posttraumatic stress symptoms among 3,271 civilian survivors of the September 11, 2001, terrorist attacks on the World Trade Center.

    Science.gov (United States)

    DiGrande, Laura; Neria, Yuval; Brackbill, Robert M; Pulliam, Paul; Galea, Sandro

    2011-02-01

    Although the September 11, 2001, terrorist attacks were the largest human-made disaster in US history, there is little extant research documenting the attacks' consequences among those most directly affected, that is, persons who were in the World Trade Center towers. Data from a cross-sectional survey conducted 2-3 years after the attacks ascertained the prevalence of long-term, disaster-related posttraumatic stress symptoms and probable posttraumatic stress disorder (PTSD) in 3,271 civilians who evacuated World Trade Center towers 1 and 2. Overall, 95.6% of survivors reported at least 1 current posttraumatic stress symptom. The authors estimated the probable rate of PTSD at 15.0% by using the PTSD Checklist. Women and minorities were at an increased risk of PTSD. A strong inverse relation with annual income was observed. Five characteristics of direct exposure to the terrorist attacks independently predicted PTSD: being on a high floor in the towers, initiating evacuation late, being caught in the dust cloud that resulted from the tower collapses, personally witnessing horror, and sustaining an injury. Working for an employer that sustained fatalities also increased risk. Each addition of an experience of direct exposure resulted in a 2-fold increase in the risk of PTSD (odds ratio = 2.09, 95% confidence interval: 1.84, 2.36). Identification of these risk factors may be useful when screening survivors of large-scale terrorist events for long-term psychological sequelae.

  11. Influence of the Texture and Strain on the Behaviour of Ni53.6Mn27.1Ga19.3 and Ni54.2Mn29.4Ga16.4 Shape Memory Alloys

    Directory of Open Access Journals (Sweden)

    Alexandra Rudajevova

    2013-01-01

    Full Text Available Polycrystalline samples of Ni53.6Mn27.1Ga19.3 and Ni54.2Mn29.4Ga16.4 shape memory alloys were investigated using dilatometry. The longitudinal axes of the samples were perpendicular to the columnar grains. Both alloys showed positive shape memory effects. The martensitic phase transformation occurred without hysteresis in both alloys with transformation temperatures of 174°C for the Ni53.6Mn27.1Ga19.3 alloy and 253°C for the Ni54.2Mn29.4Ga16.4 alloy. The dilatation characteristics for both alloys were determined in three perpendicular directions. The strain associated with the internal stress at the interface between the two martensitic structures and the two grains affected the dilatation characteristics in the y and z directions (perpendicular to the longitudinal axis of the sample. The microstructure was determined for all the directions investigated. To investigate the mechanical history, a round cross-section of the Ni54.2Mn29.4Ga16.4 sample was machined using a milling machine along the longitudinal axis so that both sides of the sample were symmetrical. This sample treatment changed the dilatation characteristics of the martensite and austenite. The study and analysis of the dilatation characteristics of the thermal cycle showed the relaxation of internal stresses and the reorientation of the martensitic variants.

  12. Xylose reductase from the thermophilic fungus Talaromyces emersonii: cloning and heterologous expression of the native gene (Texr) and a double mutant (TexrK271R+N273D) with altered coenzyme specificity

    Indian Academy of Sciences (India)

    Sara Fernandes; Maria G Tuohy; Patrick G Murray

    2009-12-01

    Xylose reductase is involved in the first step of the fungal pentose catabolic pathway. The gene encoding xylose reductase (Texr) was isolated from the thermophilic fungus Talaromyces emersonii, expressed in Escherichia coli and purified to homogeneity. Texr encodes a 320 amino acid protein with a molecular weight of 36 kDa, which exhibited high sequence identity with other xylose reductase sequences and was shown to be a member of the aldoketoreductase (AKR) superfamily with a preference for reduced nicotinamide adenine dinucleotide phosphate (NADPH) as coenzyme. Given the potential application of xylose reductase enzymes that preferentially utilize the reduced form of nicotinamide adenine dinucleotide (NADH) rather than NADPH in the fermentation of five carbon sugars by genetically engineered microorganisms, the coenzyme selectivity of TeXR was altered by site-directed mutagenesis. The TeXRK271R+N273D double mutant displayed an altered coenzyme preference with a 16-fold improvement in NADH utilization relative to the wild type and therefore has the potential to reduce redox imbalance of xylose fermentation in recombinant S. cerevisiae strains. Expression of Texr was shown to be inducible by the same carbon sources responsible for the induction of genes encoding enzymes relevant to lignocellulose hydrolysis, suggesting a coordinated expression of intracellular and extracellular enzymes relevant to hydrolysis and metabolism of pentose sugars in T. emersonii in adaptation to its natural habitat. This indicates a potential advantage in survival and response to a nutrient-poor environment.

  13. Paternity testing with VNTR DNA systems. II. Evaluation of 271 cases of disputed paternity with the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11

    DEFF Research Database (Denmark)

    Hansen, Hanna Elsebeth; Morling, N

    1993-01-01

    Paternity testing was carried out in 271 cases of disputed paternity using the 5 VNTR systems D2S44 (YNH24), D5S43 (MS8), D7S21 (MS31), D7S22 (g3), and D12S11 (MS43a), and 10-15 conventional marker systems including the HLA-A,B system. By means of the matching criteria for the VNTR systems...... father/child pairs were studied and in 3 paternity cases and one immigrant family, the alleged fathers were excluded solely by one of the 5 VNTR systems possibly reflecting mutations. No mother/child exclusions were observed among 350 mother/child pairs. Linkage analysis between the syntenic systems D7S......21 (MS31) and D7S22 (g3) was performed in 29 informative families with 81 children and revealed a recombination distance of about 31 cM. The positive evidence for paternity provided by the 5 VNTR systems in cases with non-exclusions is discussed....

  14. Array CGH characterization of an unbalanced X-autosome translocation associated with Xq27.2-qter deletion, 11q24.3-qter duplication and Xq22.3-q27.1 duplication in a girl with primary amenorrhea and mental retardation.

    Science.gov (United States)

    Chen, Chih-Ping; Lin, Shuan-Pei; Chern, Schu-Rern; Kuo, Yu-Ling; Wu, Peih-Shan; Chen, Yu-Ting; Lee, Meng-Shan; Wang, Wayseen

    2014-02-01

    We present array comparative genomic hybridization (aCGH) characterization of an unbalanced X-autosome translocation with an Xq interstitial segmental duplication in a 16-year-old girl with primary ovarian failure, mental retardation, attention deficit disorder, learning difficulty and facial dysmorphism. aCGH analysis revealed an Xq27.2-q28 deletion, an 11q24.3-q25 duplication, and an inverted duplication of Xq22.3-q27.1. The karyotype was 46,X,der(X)t(X;11)(q27.2;q24.3) dup(X)(q27.1q22.3). We discuss the genotype-phenotype correlation in this case. Our case provides evidence for an association of primary amenorrhea and mental retardation with concomitant unbalanced X-autosome translocation and X chromosome rearrangement.

  15. QTL Information Table: 271 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qPHT-1 Morphological trait Dwarf Plant height RFLP C)Interval DHL IR64 Azucena B RZ..., G.S. (2002). Molecular mapping of quantitative trait loci for plant growth, yield and yield related traits

  16. AB271. Sexual dysfunction in chronic prostatitis

    Science.gov (United States)

    Cho, In-Rae

    2016-01-01

    Chronic prostatitis/ chronic pelvic pain syndrome (CP/CPPS), or NIH category III prostatitis, is a clinical syndrome characterized by genital/ pelvic pain and lower urinary tract symptoms in the absence of urinary tract infection. CPPS is the most common prostatic disease in men younger than 50 years of age and the third most common in men older than 50 years of age. CP/CPPS is a complex entity with unclear etiology. Many articles reported that the high percentage of patients with CP/CPPS had sexual dysfunction. The most common symptoms of sexual dysfunction in chronic prostatitis patients are erectile dysfunction (ED), painful ejaculation and premature ejaculation. So we will discuss about ED and ejaculation problems in CP/CPPS patients.

  17. 7 CFR 1822.271 - Processing applications.

    Science.gov (United States)

    2010-01-01

    ... services such as doctors, dentists, and hospitals. (9) If facilities such as water and sewage systems... under Public Law 103-354 can appropriately finance. (iii) There is an immediate and ready market for the... Obligation-Fund Analysis 2 2 1 1 1 1 Data input to Finance Office through field office terminals....

  18. Preface to Per Linguam 27(1

    Directory of Open Access Journals (Sweden)

    Christa van der Walt

    2011-09-01

    Full Text Available This first number of Per Linguam in 2011 sees an extended Editorial Board and we would like to welcome the following esteemed scholars: Prof Colin Baker from the University of Wales (Bangor, a specialist in bilingual education;Prof Herman Batibo from the University of Botswana, a specialist on African languages, language planning and policy issues in Africa; and Prof Petra Engelbrecht from the University of Canterbury, an educational psychologist. We hope that they will be as pleased to be associated with Per Linguam as we are to have them on board! We also say farewell to Prof Bonny Norton whose commitments prevent her from serving on the Board.  Her presence on the Board has lent stature to Per Linguam and she will be missed. We wish her all the best for the future and hope that we can convince her to return at some point in the future.

  19. 36 CFR 271.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Agriculture in cooperation with the Association of State Foresters and The Advertising Council, or any... Department of Agriculture, or person designated to act for him. (c) The term Association of State Foresters... Advertising Council, Inc., organized under the laws of the State of New York....

  20. 40 CFR 60.271 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... scrap is charged to an empty EAF and terminating when the EAF tap is completed. (m) Shop means the... this part. (a) Electric arc furnace (EAF) means a furnace that produces molten steel and heats the... collected by the control device and located at or near the control device for an EAF subject to this...

  1. 40 CFR 60.271a - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means the period beginning when scrap is charged to an empty EAF and ending when the EAF tap is... vessel to the air pollution control device. Charge means the addition of iron and steel scrap or other.... Electric arc furnace (EAF) means a furnace that produces molten steel and heats the charge materials...

  2. 12 CFR 271.3 - Published information.

    Science.gov (United States)

    2010-01-01

    ... preceding year upon all matters of policy relating to open market operations, showing the reasons underlying... information relating to open market operations of the Federal Reserve Banks is published in the Federal... Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES...

  3. 40 CFR 271.1 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... dross residue 56 FR 41178 Aug. 8, 1991. Jan. 29, 1992 Liners and Leak Detection for Hazardous Waste Land... underground mines and caves 3004(b) Do. Do Land disposal prohibition not applicable to contaminated soil or... identified wastes, including soil and debris 3004(g)(4)(C) and 3004(m) Sept. 19, 1994, 59 FR 47982-48110....

  4. 40 CFR 271.26 - Requirements for used oil management.

    Science.gov (United States)

    2010-07-01

    ... marketers which are equivalent to those under subpart H of part 279 of this chapter; and (g) Standards for.... 279.65(a) and (b) Sec. 279.66(b) Sec. 279.72(b) 1 Contains additional new definitions that were...

  5. Dicty_cDB: VHD271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *k*ikttrrfs*llskglvfrsksrkf *iindspqksn*csssiknqfpqrrctnfrrflqkrscipqyskrhdqks**sfkflktl ssifil*isrtydi*CYYC...ssiknqfpqrrctnfrrflqkrscipqyskrhdqks**sfkflktl ssifil*isrtydi*CYYCWCNWCHCYYLYNPNNVTVQASPVTTFIEMAVSNDLARMVGW

  6. Dicty_cDB: VSG271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available date 2001. 3.22 Translated Amino Acid sequence eiq**invnisr*ifr*f**w*rcisrlwirkk**k**fik*fh**fww*gr**q****k ...q**invxisr*ifr*f**w*rcisrlwirkk**k**fik*fh**fww*gr**q** **kfhxyxyxn*intqyk*ttqln Frame B: kynnklmstladrflddf...ENSTXTTTXTK*thninklln*i Translated Amino Acid sequence (All Frames) Frame A: eiq*...*invnisr*ifr*f**w*rcisrlwirkk**k**fik*fh**fww*gr**q****k fhyynyyn*intqyk*TTQLNKHNINNLISFLTIKKKKXEKK--- ---ex

  7. 1935 15' Quad #271 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  8. Worldwide Report, Telecommunications Policy, Research and Development, No. 271

    Science.gov (United States)

    1983-05-17

    and not as educational or cultural instru- ments is the fact that the director of Radio Educacion is now appointed by the Govern- ment Secretariat...Journalists, Froyland Rascon of Radio Educacion , Jose Alvarez Icaza of Cencos [National Mass Media Center]; Leopoldo de Gyves, the mayor of Juchitan...and Marcos Paz . [PA191258 Panama City MATUTINO in Spanish 18 Apr 83 p 10A] CSO: 5500/2066 2U SURINAME NEW COASTAL RADIO STATION FOR

  9. Dicty_cDB: SSL271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 of the complete genome. 46 0.31 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium cDNA Curculio glandium cDNA clone curculio...quence 253 from Patent WO0200928. 46 0.31 1 BQ476622 |BQ476622.1 curculio3e06.g Curculio glandium cDNA Curcu...lio glandium cDNA clone curculio3e06 3', mRNA sequence. 46 0.31 1 BX004766 |BX004766.9 Zebrafish DNA sequenc

  10. 7 CFR 271.7 - Allotment reduction procedures.

    Science.gov (United States)

    2010-01-01

    ... the nature of the issuance system in use. Where there are computerized issuance systems, the program... benefits either by changing all HIR cards before issuance activity for the affected month begins or by... implemented by State agencies for reducing and cancelling benefits shall be designed so that in the event...

  11. Dicty_cDB: SSC271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R0) RecName: Full=Ceroid-lipofuscinosis neuronal protein 5;... 45 0.001 AC116305_..... 42 0.021 (Q5JZQ9) Ceroid-lipofuscinosis neuronal protein 5 precursor (Pro... 4...2 0.021 (A2TJ54) RecName: Full=Ceroid-lipofuscinosis neuronal protein 5;... 39 0.13 AK032293_1( AK032293 |pi...n Score E Sequences producing significant alignments: (bits) Value (Q553W9) RecName: Full=Ceroid-lipofusci...nosis neuronal protein 5 ... 342 6e-93 (Q86JG6) RecName: Full=Cln5-like protein 1;

  12. 40 CFR 271.15 - Requirements for compliance evaluation programs.

    Science.gov (United States)

    2010-07-01

    ... surveillance procedures to determine, independent of information supplied by regulated persons, compliance or... reporting forms and other forms supplying monitoring data; and (iii) Verify the adequacy of sampling... shall be taken and other information shall be gathered in a manner (e.g., using proper “chain of...

  13. Generation of spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele Gabriele; Tubsuwan, Alisa; Schmid, Benjamin

    2016-01-01

    Spinocerebellar ataxia type 2 (SCA2) is a neurodegenerative disease primarily affecting the cerebellum. Very little is known about the molecular mechanisms underlying the disease and, to date, no cure or treatment is available. Here, we demonstrate the generation of an induced pluripotent stem cell...

  14. 40 CFR 271.21 - Procedures for revision of State programs.

    Science.gov (United States)

    2010-07-01

    ... amendments to 40 CFR parts 124, 270, 260-266, or 268 and any self-implementing statutory provisions (i.e... the documentation described in paragraph (b) of this section to revise its program. (f) A State must... Monitoring Activities, Methods Innovation Rule July 14, 2005 70 FR 34538, June 14, 2005 Process Vent...

  15. Ioana BOT, Eminescu explicat fratelui meu, Editura Art, București, 2012, 271 p.

    Directory of Open Access Journals (Sweden)

    Anca-Elena DANCIU

    2012-01-01

    Full Text Available A-i face o prezentare Ioanei Bot ar fi, oarecum, în zadar, luând în considerare vasta bibliografie care ne-a fost dedicată de-a lungul timpului, dar mai ales, dăruirea și devotamentul pe care fiecare student l-a simțit în momentul în care a asistat la cursurile universitare ale autoarei. Ioana Bot se află printre cele mai importante nume din țară și nu numai în critica literară, iar aprecierile la adresa sa nu au întărziat să apară.Pentru a urma canoanele unei recenzii, vom aminti, totuși, câteva date biografice ale autoarei, tocmai pentru acei cititori „cu ochi străini”, care nu au pășit încă, îndeaproape, în universul Ioanei Bot. Așadar, născută în 1964, la Cluj-Napoca, Ioana Bot este în prezent profesor la Facultatea de Litere din cadrul Univeristății „Babeș-Bolyai” și autoare a numeroase volume cu impact major în literatura română. Benefica persistență a operei sale se îndreaptă către studiul operei eminesciene, concretizat în publicații valoroase, dintre care extragem câteva titluri: Eminescu și lirica românească de azi (1990; Mihai Eminescu – Scrisori (2004; Mihai Eminescu, poet naţional român (2002. Volumele care ne călăuzesc în tainele literaturii sunt multe și interesante, însă abordarea unghiurilor și perspectivelor inedite asupra noilor apariții publicistice îi aduc autoarei aprecieri suplimentare. Ne referim aici la rubrica din „Dilematica”, denumită Cărți de plastic, unde autoarea își exprimă cele mai sincere și justificate opinii despre aceste producții.

  16. 34 CFR 271.20 - What conditions must an applicant meet to obtain funding?

    Science.gov (United States)

    2010-07-01

    ... a plan of the steps that it has taken or would take to inform the LEAs it will serve, public school..., gender, age or handicapping condition. (l) The project must have an adequate budget to support the project activities, and costs must be reasonable in relation to the objectives of the project; and (m)...

  17. 48 CFR 1352.271-70 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ..., particularly where such activities are undertaken in the vicinity of the vessel's fuel oil tanks, magazines or... contractor's pier or in dry dock or on a marine railway. All tanks or bilge areas under alteration or repair... sufficient lighting, for the prevention of accidents or injury to persons or property during the...

  18. 46 CFR 502.271 - Special docket application for permission to refund or waive freight charges.

    Science.gov (United States)

    2010-10-01

    ...) An error in failing to publish a new tariff; or (iii) An error in quoting a tariff . (2) Such refund... must be filed within one hundred eighty (180) days from the date of sailing of the vessel from the port... applicant by the Secretary without prejudice to resubmission within the 180-day limitation period....

  19. Nuclear Technology. Course 27: Metrology. Module 27-1, Fundamentals of Metrology.

    Science.gov (United States)

    Selleck, Ben; Espy, John

    This first in a series of eight modules for a course titled Metrology describes the fundamentals of metrology as they pertain to dimensional inspection. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student, (5) subject matter, (6)…

  20. Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

    CERN Document Server

    Burgess, P H

    1978-01-01

    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the a...

  1. Dominance of multidrug resistant CC271 clones in macrolide-resistant streptococcus pneumoniae in Arizona

    Directory of Open Access Journals (Sweden)

    Bowers Jolene R

    2012-01-01

    Full Text Available Abstract Background Rates of resistance to macrolide antibiotics in Streptococcus pneumoniae are rising around the world due to the spread of mobile genetic elements harboring mef(E and erm(B genes and post-vaccine clonal expansion of strains that carry them. Results Characterization of 592 clinical isolates collected in Arizona over a 10 year period shows 23.6% are macrolide resistant. The largest portion of the macrolide-resistant population, 52%, is dual mef(E/erm(B-positive. All dual-positive isolates are multidrug-resistant clonal lineages of Taiwan19F-14, mostly multilocus sequence type 320, carrying the recently described transposon Tn2010. The remainder of the macrolide resistant S. pneumoniae collection includes 31% mef(E-positive, and 9% erm(B-positive strains. Conclusions The dual-positive, multidrug-resistant S. pneumoniae clones have likely expanded by switching to non-vaccine serotypes after the heptavalent pneumococcal conjugate vaccine release, and their success limits therapy options. This upsurge could have a considerable clinical impact in Arizona.

  2. The isolated interacting galaxy pair NGC 5426/27 (Arp 271)

    CERN Document Server

    Fuentes-Carrera, I; Amram, P; Dultzin-Hacyan, D; Cruz-Gonzalez, I; Salo, H; Laurikainen, E; Bernal, A; Ambrocio-Cruz, P; Le Coarer, E

    2003-01-01

    We present H alpha observations of the isolated interacting galaxy pair NGC 5426/27 using the scanning Fabry-Perot interferometer PUMA. The velocity field, various kinematical parameters and rotation curve for each galaxy were derived. The FWHM map and the residual velocities map were also computed to study the role of non-circular motions of the gas. Most of these motions can be associated with the presence of spiral arms and structure such as central bars. We found a small bar-like structure in NGC 5426, a distorted velocity field for NGC 5427 and a bridge-like feature between both galaxies which seems to be associated with NGC 5426. Using the observed rotation curves, a range of possible masses was computed for each galaxy. These were compared with the orbital mass of the pair derived from the relative motion of the participants. The rotation curve of each galaxy was also used to fit different mass distribution models considering the most common theoretical dark halo models. An analysis of the interaction ...

  3. Tomato (Lycopersicon esculentum, cv CXD271BIO) yield and quality during converion from conventional to organic production

    OpenAIRE

    Nardo, N.; Foddai, MS; E.Azzini; Baiamonte, I; Di Ferdinando, S; Paoletti, S.; Vizioli, V; Paoletti, F.

    2011-01-01

    The conversion of a conventional farm to the methods of the organic farming is a very critical stage of technical and economical investment. From an agronomical point of view, usually the conversion needs a very different length of time with respect to that set by the regulation, because the organic farming is based on the soil fertility and, in general, on the preservation at the equilibrium of the farm’s ecosystem. These elements affect time and method of the conversions that, although base...

  4. SU-E-J-271: Correlation of CT Number Change with Radiation Treatment Response for Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Dalah, E; Tai, A; Oshima, K; Hall, W; Knechtges, P; Erickson, B; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2015-06-15

    Purpose: It has been reported recently that radiation can induce CT number (CTN) change during radiation therapy (RT) delivery. In the effort to explore whether CTN can be used to assess RT response, we analyze the relationship between the pathological treatment response (PTR) and the changes of CTN, MRI, and PET before and after the neoadjuvant chemoradiation (nCR) for pancreatic adenocarcinoma. Methods: The preand post-nCR CT, MRI, and PET data for a total of 8 patients with resectable, or borderline resectable pancreatic head adenocarcinoma treated with nCR were retrospectively analyzed. Radiographic characteristics were correlated to PTR data. The histograms, means and standard derivations (SD) of the CTNs in pancreatic head (CTNPH), the GTV defined by ADC (CTNGTV), and the rest of pancreatic head (CTNPH-CTNGTV) were compared. Changes before and after nCR were correlated with the corresponding changes of ADC, lean body mass normalized SUV (SUVlb), and PTR using Pearson’ s correlation coefficient test. Results: The average mean and SD in CTPH for all the patients analyzed were higher in post-nCR (53.17 ± 31.05 HU) compared to those at pre-nCR (28.09 ± 4.253 HU). The CTNGTV were generally higher than CTNPH and CTNPH-CTNGTV, though the differences were not significant. The post-nCR changes of mean CTN, ADC, and SUVlb values in pancreatic head were correlated with PTR (R=0.3273/P=0.5357, R=−0.5455/P<0.0001, and R=0.7638/P=0.0357, respectively). The mean difference in the maximum tumor dimension measured from CTN, ADC, and SUVlb as compared with pathological measurements was −2.1, −0.5, and 0.22 cm, respectively. Conclusion: The radiation-induced change of CTN in pancreas head after chemoradiation therapy of pancreatic cancer was observed, which may be related to treatment responses as assessed by biological imaging and pathology. More data are needed to determine whether the CTN can be used as a quantitative biomarker for response to neoadjuvant therapy.

  5. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements.

  6. Generation of an isogenic, gene-corrected control cell line of the spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele Gabriele; Schmid, Benjamin; Tubsuwan, Alisa

    2016-01-01

    Spinocerebellar ataxia type 2 (SCA2) is a neurodegenerative disease primarily affecting the cerebellum. Very little is known about the molecular mechanisms underlying the disease and, to date, no cure or treatment is available. We have successfully generated bona fide induced pluripotent stem cel...

  7. Generation of an isogenic, gene-corrected control cell line of the spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele G; Schmid, Benjamin; Tubsuwan, Alisa;

    2016-01-01

    Spinocerebellar ataxia type 2 (SCA2) is a neurodegenerative disease primarily affecting the cerebellum. Very little is known about the molecular mechanisms underlying the disease and, to date, no cure or treatment is available. We have successfully generated bona fide induced pluripotent stem cell...

  8. Clinical Observation on 271 Cases of Non-Small Cell Lung Cancer Treated with Yifei Kangliu Yin (益肺抗瘤饮)

    Institute of Scientific and Technical Information of China (English)

    刘嘉湘; 施志明; 李和根; 徐振晔; 朱晏伟; 赵丽红; 高虹; 刘苓霜; 朱惠蓉; 张晖

    2001-01-01

    To observe the effects of Yifei Kangliu Yin(YFKLY) in treating non-small cell lung cancer (NSCLC). Methods:Two hundred and seventy-one patients with NSCLC were randomly divided into three groups, Group A treated only by YFKLY, Group B treated by the combination of YFKLY and chemotherapy, and Group C treated only by chemotherapy as the control group for control. Results: (1) Of the 127 cases in Group A, 1 case got complete remission (CR), 13 got partial remission (PR), 89 had no change (NC), and 24 had progression of disease (PD), thus CR+PR+NC accounting for 81.10%; of the 80 patients in Group B, 17 got PR , 53 got NC, 10 got PD, PR+NC accounting for 87.50%; of the 64 cases of chemotherapy group, 7 cases got PR, 39 cases got NC, 18 cases got PD, PR+NC accounting for 71.88% (P<0.01). (2) The metastasis rate was 23.52% in Group A, 20.00% in Group B and 35.71% in Group C respectively after treatment. (3) The 1-, 2-, 3- and 4-year survival rate were 73.09%, 32.01%, 13.18% and 13.18% in Group A, 71.85%, 46.35%, 29.19% and 23.35% in Group B and 37.61%, 13.67%, 9.7% and 0% in Group C. The symptoms were improved, and Karnofsky score was elevated in Group A and B. Conclusion: YFKLY could increase survival rate and quality of life, decrease metastasis rate, and enhance the immune function in NSCLC patients.

  9. Isolation of neural progenitor cells from the human adult subventricular zone based on expression of the cell surface marker CD271

    NARCIS (Netherlands)

    van Strien, Miriam E; Sluijs, Jacqueline A; Reynolds, Brent A; Steindler, Dennis A; Aronica, Eleonora; Hol, Elly M

    2014-01-01

    Neural progenitor cells (NPCs) in the subventricular zone (SVZ) hold promise for future therapy for neurodegenerative disorders, because the stimulation of adult neurogenesis could potentially restore the function of degenerating neurons and glia. To obtain more knowledge on these NPCs, we developed

  10. Dependence theories: approaches on the development of Latin America - doi: 10.4025/dialogos.v11i1e2.71 Teorías de la dependencia: enfoques sobre el desarrollo Latinoamericano Teorias da dependência: abordagens sobre o desenvolvimento Latino-Americano - doi: 10.4025/dialogos.v11i1e2.71

    Directory of Open Access Journals (Sweden)

    Paulo José Koling

    2010-05-01

    Full Text Available Elements on the theoretical approaches with regard to Latin American development and analyses of its international economic insertion are provided. Periphery, revision of dependence theories and aspects of the debate among “dependentists” are analyzed. The dual focus of civilization and barbarity was dominant during the 19th century and within the context of traditional Latin American intellectual thought on the insertion of the new countries within world economy. This was corroborated by the Ricardian theory of comparative advantages within the international work division, criticized by the Economical Commission for Latin America (CEPAL. In the context of dependence revision, critique on Rostowian and Cepal structuralism will be undertaken. Aspects of the discussion among intellectuals on dependence theories with regard to the relationship between dependence and development and nuances on its publicity in Brazil will be given and investigatedEn este artículo presentamos algunos elementos de los enfoques teóricos realizados sobre el desarrollo latinoamericano y sus análisis de las formas de inserción económica internacional, destacando la visión del pensamiento periférico, la revisión de las teorías de la dependencia y los aspectos del debate entre los dependentistas. Para el estudio de la inserción de los nuevos países de la región en la economía mundial del siglo XIX, en la “tradición” latinoamericana predominó el enfoque dualista de “civilización o barbarie” y la teoría ricardiana sobre las ventajas comparativas de la división internacional del trabajo que, por su parte, fue la base de la crítica producida por la Comisión Económica para América Latina (CEPAL. Inicialmente, de la revisión dependentista analizamos su crítica al estructuralismo rostowiano y al cepalino; luego, situamos los aspectos de la discusión realizada entre los intelectuales de las teorías de la dependencia, en lo que se refiere a la relación entre dependencia y desarrollo y los matices de su divulgación en Brasil.Neste artigo apresentamos alguns elementos das abordagens teóricas realizadas sobre o desenvolvimento latino-americano e suas análises das formas de inserção econômica internacional, destacando a visão do pensamento periférico, a revisão das teorias da dependência e aspectos do debate entre dependentistas. Tratando-se do século XIX, na “tradição” intelectual latino-americana sobre a inserção dos novos países da região na economia mundial predominou o enfoque dualista da civilização ou da barbárie e a teoria ricardiana das vantagens comparativas na divisão internacional do trabalho, que, por sua vez, foi base da crítica produzida pela Comissão Econômica para a América Latina (CEPAL. Da revisão dependentista analisamos, inicialmente, sua crítica ao estruturalismo rostowiano e ao cepalino, e, em seguida, situaremos aspectos da discussão realizada entre intelectuais das teorias da dependência, no que se refere à relação entre a dependência e o desenvolvimento, e nuanças de sua publicização no Brasil.

  11. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  12. Final Report of a CRADA Between Pacific Northwest National Laboratory and the General Motors Company (CRADA No. PNNL/271): “Degradation Mechanisms of Urea Selective Catalytic Reduction Technology”

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Do Heui; Lee, Jong H.; Peden, Charles HF; Howden, Ken; Kim, Chang H.; Oh, Se H.; Schmieg, Steven J.; Wiebenga, Michelle H.

    2011-12-13

    Diesel engines can offer substantially higher fuel efficiency, good driving performance characteristics, and reduced carbon dioxide (CO2) emission compared to stoichiometric gasoline engines. Despite the increasing public demand for higher fuel economy and reduced dependency on imported oil, however, meeting the stringent emission standards with affordable methods has been a major challenge for the wide application of these fuel-efficient engines in the US market. The selective catalytic reduction of NOx by urea (urea-SCR) is one of the most promising technologies for NOx emission control for diesel engine exhausts. To ensure successful NOx emission control in the urea-SCR technology, both a diesel oxidation catalyst (DOC) and a urea-SCR catalyst with high activity and durability are critical for the emission control system. Because the use of this technology for light-duty diesel vehicle applications is new, the relative lack of experience makes it especially challenging to satisfy the durability requirements. Of particular concern is being able to realistically simulate actual field aging of the catalyst systems under laboratory conditions, which is necessary both as a rapid assessment tool for verifying improved performance and certifiability of new catalyst formulations. In addition, it is imperative to develop a good understanding of deactivation mechanisms to help develop improved catalyst materials. In this CRADA program, General Motors Company and PNNL have investigated fresh, laboratory- and vehicle-aged DOC and SCR catalysts. The studies have led to a better understanding of various aging factors that impact the long-term performance of catalysts used in the urea-SCR technology, and have improved the correlation between laboratory and vehicle aging for reduced development time and cost. This Final Report briefly highlights many of the technical accomplishments and documents the productivity of the program in terms of peer-reviewed scientific publications (2 total), reports (3 total including this Final Report), and presentations (5 total).

  13. Corrigendum to "N2- and (H2+He)-broadened cross sections of benzene (C6H6) in the 7-15 μm region for the Titan and Jovian atmospheres" [Icarus, 271 (2016) 438-452

    Science.gov (United States)

    Sung, Keeyoon; Toon, Geoffrey C.; Crawford, Timothy J.

    2017-01-01

    We regret that there was a typographical error in the integrated band intensity of C6H6 in the abstract, in which the exponent was incorrectly given as 10-17 rather than 10-19. The integrated band intensities from N2-broadened C6H6 spectra quoted in the abstract should be 177.0(73), 14.0(10), 27.2(9) × 10-19 cm-1/(molecule · cm-2) for the v4, v14, v13 band regions, respectively. From (H2+He) mixture-broadened C6H6 spectra, the integrated v4 band intensity should be 168.8(17) × 10-19 cm-1/(molecule · cm-2). No other part of the manuscript was affected by this typographical error. We thank Conor A. Nixon for having brought this error to our attention.

  14. Erratum: Correction to Table 3, in: Equivalent threshold sound pressure levels (ETSPL) for Sennheiser HDA 280 supra-aural audiometric earphones in the frequency range 125 Hz to 8000 Hz (International Journal of Audiology (2009) 48 (271-276))

    DEFF Research Database (Denmark)

    Poulsen, Torben

    2014-01-01

    The main results in Poulsen & Oakley (2009) are given as the equivalent threshold sound pressure level, ETSPL, measured in an acoustic coupler specifi ed in IEC 60318-3. These results are all correct. The ETSPL values for the ear simulator specifi ed in IEC 60318-1 were calculated from acoustic l...

  15. Readjustment of the Paper [J. Kaur and S. S. Bhatia, Integrability and L1-Convergence of Double Cosine Trigonometric Series, Anal. Theory Appl., 27(1) (2011), pp. 32-39.

    Institute of Scientific and Technical Information of China (English)

    Xhevat Z. Krasniqi∗

    2015-01-01

    In this paper, we show that new modified double cosine trigonometric sums introduced in [1] are inappropriate, the class of double sequences Jd introduced there is unusable for such sums and consequently the results obtained in it are completely incorrect. We here introduce appropriate modified double cosine trigonometric sums making the class Jd usable considering a particular double cosine trigonometric series.

  16. Política Externa em Perspectiva: um balanço sobre a diplomacia dos presidentes Collor, Itamar, Cardoso e Lula 10.5102/uri.v4i1.271

    Directory of Open Access Journals (Sweden)

    Carlos Ribeiro Santana

    2007-08-01

    Full Text Available A key characteristic of Brazilian diplomacy is its capacity to expand and diversify the country’s international relations. During the last two decades Brazil has had four presidents who led foreign policy according to their individual styles. This article aims to study in both practical and conceptual terms Brazilian foreign policy, its domestic and international constraints, and the country’s bilateral and multilateral relations during the last four presidencies.

  17. The effects of kisspeptin agonist canine KP-10 and kisspeptin antagonist p271 on plasma LH concentrations during different stages of the estrous cycle and anestrus in the bitch

    NARCIS (Netherlands)

    Albers-Wolthers, C H J; de Gier, J; Rutten, V P M G; van Kooten, P J S; Leegwater, P A J; Schaefers-Okkens, A C; Kooistra, H S

    2016-01-01

    Kisspeptin (KP) plays a key role in the regulation of the hypothalamic-pituitary-gonadal axis via the release of GnRH. As normal KP signaling is essential for reproductive function, it could be an interesting new target for therapeutic interventions, e.g., nonsurgical contraception in dogs. The aims

  18. Breakpoint of a balanced translocation (X:14) (q27.1;q32.3) in a girl with severe hemophilia B maps proximal to the factor IX gene.

    Science.gov (United States)

    Di Paola, J; Goldman, T; Qian, Q; Patil, S R; Schutte, B C; Schute, B C

    2004-03-01

    Hemophilia B is an X-linked bleeding disorder caused by the deficiency of coagulation factor (F)IX, with an estimated prevalence of 1 in 30 000 male births. It is almost exclusively seen in males with rare exceptions. We report a girl who was diagnosed with severe (PAC DNA probe, RP6-88D7 (which contains the FIX gene) hybridized only on the normal chromosome X as well as onto the derivative 14. Using a PAC DNA probe, RP11-963P9 that is located proximal to the FIX gene, we obtained signals on the normal and derivative X and also on the derivative 14. We conclude that the breakpoint is located within the DNA sequence of this clone mapping proximal to the FIX gene. Since the FIX gene seems to be intact in the derivative 14, the breakpoint may affect an upstream regulatory sequence that subjects the gene to position effect variegation (PEV).

  19. Multibeam collection for TN271: Multibeam data collected aboard Thomas G. Thompson from 2011-10-25 to 2011-11-03, departing from Seattle, WA and returning to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    In my PhD work I show that it is possible to run unmodified Python/NumPy code on modern GPUs. This is done by using the Bohrium runtime system to translate the NumPy array operations into an array based bytecode sequence. Executing these byte-codes on two GPUs from different vendors shows great...... performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach....... This has lead to more specialized methods as I have shown with the work done with both specialized, and parametrizied kernels. Both have their benefits and recognizable use cases. We achieved clear performance benefits without any significant negative impact on overall application performance. Even...

  1. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels;

    2016-01-01

    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  2. 12 CFR 230.9 - Enforcement and record retention.

    Science.gov (United States)

    2010-01-01

    ... listed in that section. (b) Civil liability. Section 271 of the Act contains the provisions relating to civil liability for failure to comply with the requirements of the act and this part; Section 271...

  3. Logical analysis of biological systems

    DEFF Research Database (Denmark)

    Mardare, Radu Iulian

    2005-01-01

    R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005.......R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005....

  4. “The Time of the Historian”: On the Book by V.A. Kitaev “Social Thought and Historical Science in Russia in 18-20th Centuries (Problems of Historiography” (Nizhny Novgorod: Izd-vo NNGU, 2016. – 271 p.

    Directory of Open Access Journals (Sweden)

    Kuznetsov Oleg V.

    2016-09-01

    Full Text Available The book of V.A. Kitaev includes reviews of monographs and textbook, collective publications, including encyclopedias, publications of sources, historiographical articles, some of which were published in leading scientific journals in 1980-2015, and some were published for the first time. This publication is not exactly a review to V.A. Kitaev’s book, but an attempt to provide the reader with reflections on some of the problems of public thoughts and historiography highlighted by the author: the features of the professional study of history, historiographical analysis as a genre of research, methodology and terminology in modern studies on the history of social thought and historical science, the ratio of professional approach and political convictions, attitude to scientific traditions, etc. The present paper highlights the highest scientific professionalism of V.A. Kitaev, his ability and willingness to be critical not only to other people’s research, but also to his own. Despite the well-known assertion that “we do not choose the times”, we can safely say that V.A. Kitaev consciously chose the “time of the historian” and found himself in this time.

  5. The possible existence of Hs in nature from a geochemical point of view

    CERN Document Server

    Ivanov, A V

    2006-01-01

    A hypothesis of the existence of a long-lived isotope 271Hs in natural molybdenites and osmirides is considered from a geochemical point of view. It is shown that the presence of Hs in these minerals can be explained only by making an additional ad hoc assumption on the existence of an isobaric pair of 271Bh-271Hs. This assumption could be tested by mass-spectrometric measurements of U, Pb, Kr, Xe, and Zr isotopic shifts.

  6. Dicty_cDB: CFI345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -phosphate isomerase; S... 273 8e-72 DQ205071_1( DQ205071 |pid:none) Colias eurytheme isolate 4A phosph... 2...71 1e-71 DQ205064_1( DQ205064 |pid:none) Colias eurytheme isolate 3A phosph... 271 1e-71 DQ205074_1( DQ20507...4 |pid:none) Colias eurytheme isolate 5A phosph... 271 1e-71 DQ205092_1( DQ205092... |pid:none) Colias eurytheme phosphoglucose is... 271 1e-71 DQ205066_1( DQ205066 |pid:none) Colias eurytheme

  7. 76 FR 9733 - Endangered and Threatened Species; Proposed Threatened Status for Subspecies of the Ringed Seal

    Science.gov (United States)

    2011-02-22

    .... Send written comments to Kaja Brix, Assistant Regional Administrator, Protected Resources Division.../ . FOR FURTHER INFORMATION CONTACT: Tamara Olson, NMFS Alaska Region, (907) 271-5006; Kaja Brix,...

  8. 76 FR 14883 - Endangered and Threatened Species; Proposed Threatened Status for Distinct Population Segments of...

    Science.gov (United States)

    2011-03-18

    .... Send written comments to Kaja Brix, Assistant Regional Administrator, Protected Resources Division.../ . FOR FURTHER INFORMATION CONTACT: Tamara Olson, NMFS Alaska Region, (907) 271-5006; Kaja Brix,...

  9. Existing Analytical Frameworks for Information Behaviour Don’t Fully Explain HIV/AIDS Information Exchange in Rural Communities in Ontario, Canada. A Review of: Veinot, T., Harris, R., Bella, L., Rootman, I., & Krajnak, J. (2006. HIV/AIDS Information exchange in rural communities: Preliminary findings from a three‐province study. Canadian Journal of Information and Library Science, 30(3/4, 271‐290.

    Directory of Open Access Journals (Sweden)

    Kate Kelly

    2010-03-01

    Full Text Available Objective – To explore and analyze, against three theoretical frameworks of information behaviours, how people with HIV/AIDS, their friends, and their family living in rural communities find information on HIV/AIDS.Design – Qualitative, individual, in‐depth, semi‐structured interviews.Setting – Two rural regions in Ontario, Canada.Subjects – Sixteen participants; 10 people with HIV/AIDS (PHAs and 6 family members or friends.Methods – Participants were recruited through health care providers, social service agencies and through snowball sampling. Semi‐structure interviews were conducted focusing on participants’ experience with HIV/AIDS, how they find and use information on HIV/AIDS, networks for information exchange and the effect of technology on information exchange. Interviews were taped, transcribed, analyzed qualitatively using NVivo software. Results were compared to three theoretical frameworks for information behaviour: 1. purposeful information seeking (i.e., the idea that people purposefully seek information to bridge perceived knowledge gaps; 2. non‐purposeful or incidental information acquisition (i.e., the idea that people absorb information from going about daily activities; and 3. information gate keeping (i.e., the concept of private individuals who act as community links and filters for information gathering and dissemination.Main Results – Consistent with the theories:•PHAs prefer to receive information from people they have a personal relationship with, particularly their physician and especially other PHAs.•PHAs’ friends and families rely on their friends and family for information, and are particularly reliant upon the PHA in their lives.•Fear of stigma and discrimination cause some to avoid seeking information or to prefer certain sources of information, such as healthcare providers, who are bound by codes of professional conduct.•Emotional support is important in information provision and its presence supersedes the professional role of the provider (social workers and counsellors were identified as key information sources over medical professionals in this instance. Participants responded negatively to the perceived lack of support from providers including doubting the information provided.•PHAs monitor their worlds and keep up to date about HIV/AIDS.Inconsistent with theories:•Reliance on caregivers for information is not solely explained by fear of stigma or exposure. Rather, it is the specialized knowledge and immersion in HIV/AIDS which is valued.•The distinction between peer or kin sources of information and institutional information sources is less clear and relationships with professionals can turn personal over time.•Inter‐personal connections include organisations, not just individuals, particularly AIDS Service Organizations and HIV specialist clinics.•Relatively few incidents of finding useful information about HIV/AIDS incidentally were described. The concept of information just being “out there” was not really applicable to rural settings, likely due to the lack of discussion within participant communities and local media. When it was discussed, participants reported being more likely to gain misinformation through their personal networks.•Incidental information acquisition originates mostly from professional and organisational sources. Participants identified posters, leaflets, and, for those who interacted with organisations, information via mail as contributing to current awareness.•The gate keeping concept does not capture all the information sharing activities undertaken by “gate keepers” in rural areas, and neither does it include formal providers of information, yet all PHAs interviewed identified formal providers as key sources.Conclusion – The findings reinforce some of the existing analytical framework theories, particularly the importance of affective components (i.e. emotional supports of information seeking, the presence of monitoring behaviours, and of interpersonal sources of information. However, alternate theories may need to be explored as the role of institutional information sources in the lives of PHAs doesn’t match the theoretical predication and the “gate keeper” concept doesn’t capture a significant portion of that role in rural HIV/AIDS information exchange.

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  11. Use of acoustic systems for underwater archaeology

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.

    stream_size 2 stream_content_type text/plain stream_name J_Mar_Archaeol_2_71.pdf.txt stream_source_info J_Mar_Archaeol_2_71.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  12. Feasibility Study on the Design of Reinforced Plastic Components for the LVTP (7) Vehicle Shafts

    Science.gov (United States)

    1984-12-01

    neat (pure) resin properties for LRF-092 and LRF-271. LRF-092 LRF-271 - Resin Casting Property (unaged) Property Value Property Value Tensile Strength...fiber properties (Table IV) and resin properties of (Epoxy-Anhydride). 34 4.3.1 Selection of a Shaft Composite Design The purpose of this study is to

  13. 76 FR 79258 - Self-Regulatory Organizations; Chicago Mercantile Exchange, Inc.; Notice of Filing and Order...

    Science.gov (United States)

    2011-12-21

    .../RMB) Spot, Forwards and Swaps); and CME Chapter 271H (Cleared OTC U.S. Dollar/Korean Won Sol (USD/KRW... positive or negative. This language had been adopted previously by CME for many of the cleared OTC FX NDF... 271H. These changes would add language to the cash settlement provisions in the rules governing...

  14. Dicty_cDB: CHB382 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nabarinus heat shoc... 271 3e-71 protein update 2009. 3.29 PSORT psg: 0.52 gvh: 0.2...|pid:none) Rhizophlyctis rosea strain CBS 576... 271 2e-71 EU679414_1( EU679414 |pid:none) Tetranychus cin

  15. NCBI nr-aa BLAST: CBRC-GGOR-01-0539 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0539 ref|YP_002016101.1| hypothetical protein Paes_1434 [Prosthecochloris aes...tuarii DSM 271] gb|ACF46454.1| hypothetical protein Paes_1434 [Prosthecochloris aestuarii DSM 271] YP_002016101.1 1.1 26% ...

  16. Fresh water influx and particle flux variability in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Schafer, P.; Ittekkot, V.; Bartsch, M.; Nair, R.R.; Tiemann, J.

    stream_size 22 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  17. Drug: D07572 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07572 Drug Amylocaine hydrochloride; Dolodent (TN) C14H21NO2. HCl 271.1339 271.783 D07572.gif Local... anesthetic map07015 Local analgesics CAS: 532-59-2 PubChem: 51091891 LigandBox: D07572 NIK

  18. Domain Modeling: NP_003151.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_003151.2 chr19 STRUCTURE OF AURORA B KINASE IN COMPLEX WITH ZM447439 p2bfxa_ chr19/NP_003151....2/NP_003151.2_apo_2-271.pdb p2vrxb_ chr19/NP_003151.2/NP_003151.2_holo_2-271.pdb blast 15L,16G,

  19. Drug: D05173 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05173 Drug Nisoxetine (USAN/INN) C17H21NO2 271.1572 271.3541 D05173.gif Antidepressant Selective nora...drenalin reuptake inhibitor noradrenalin transporter inhibitor [HSA:6530] [KO:K05035] map... Solute carrier family SLC6 SLC6A2 (noradrenalin transporter) [HSA:6530] [KO:K050

  20. Dicty_cDB: VSF223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 196315 |pid:none) Auxenochlorella protothecoides rib... 271 2e-71 BC054263_1( BC054263 |pid:none) Xenopus la...F402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 271 2e-71 FJ196315_1( FJ

  1. NCBI nr-aa BLAST: CBRC-AGAM-07-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0042 ref|ZP_00591264.1| Potassium efflux system protein [Prosthecochlo...ris aestuarii DSM 271] gb|EAN23634.1| Potassium efflux system protein [Prosthecochloris aestuarii DSM 271] ZP_00591264.1 1e-75 46% ...

  2. Moulting and moult quality in eye-stalk ablated penaeid prawn, Metapenaeus monoceros (Fabricius)

    Digital Repository Service at National Institute of Oceanography (India)

    Venkitaraman, P; Sivadas, P

    stream_size 3 stream_content_type text/plain stream_name 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt stream_source_info 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. PDB: CBRC-GGOR-01-0300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0300 3ODU,3OE0,3OE6,3OE8,3OE9, Region:8-271(Identity=98%) PDB:3ODU Chain:A (X-ray Resolution...=2.5),Region:8-271(Identity=98%) PDB:3OE0 Chain:A (X-ray Resolution=2.9),Region:8-271(...Identity=98%) PDB:3OE6 Chain:A (X-ray Resolution=3.2),Region:8-271(Identity=98%) PDB:3OE8 Chain:A (X-ray Resolution...=3.1),Region:8-271(Identity=98%) PDB:3OE9 Chain:A (X-ray Resolution=3.1), ...

  4. Hepatitis C Screening in the Behavioral Healthcare Setting

    Science.gov (United States)

    ... of Internal Medicine, 156 (4), 271– 278. 18 Campbell, J. V., Hagan, H., Latka, M. H., Garfein, ... estimate transmission diversity in viral epidemics. PLoS Computational Biology, 9 (1), e1002876. doi:10.1371/journal.pcbi. ...

  5. Shorelines Extracted from 1984-2015 Landsat Imagery: Petit Bois Island, Mississippi (Polygon: Individual Dates)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Shorelines Extracted from 1984-2015 Landsat Imagery: Petit Bois Island, Mississippi (Polygon: Individual Dates) is a dataset consisting of 271 polygon shapefiles...

  6. Rarotonga Sr/Ca and SST Reconstruction Data for 1726 to 1997

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 271 year record of Sr/Ca variability in a coral from Rarotonga in the South Pacific gyre. Calibration with monthly sea surface temperature (SST) from satellite and...

  7. School's Still out on Internal Auditing.

    Science.gov (United States)

    Cuzzetto, Charles E.; Moran, Daniel D.

    1988-01-01

    Survey responses from 271 members of the Association of School Business Officials International were analyzed to determine the extent and use of internal auditing in school districts and the characteristics of districts with internal auditing positions. (MLF)

  8. Drug: D04052 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of drugs in Japan [BR:br08301] 1 Agents affecting nervous system and sensory organs 12 Agent...docaine hydrochloride mixt 2 Agents affecting individual organs 27 Dental preparations 271 Local anesthetics

  9. 77 FR 15052 - Dataset Workshop-U.S. Billion Dollar Disasters Dataset (1980-2011): Assessing Dataset Strengths...

    Science.gov (United States)

    2012-03-14

    ..., Asheville, North Carolina 28801. FOR FURTHER INFORMATION CONTACT: Adam Smith, National Climatic Data Center, 151 Patton Avenue, Rm. 471, Asheville, North Carolina 28801. (Phone: 828-271-4183, Email:...

  10. Sage Gene Expression Profiles Characterizing Cure

    Science.gov (United States)

    2005-10-01

    Controversies in Management, 1994. 2. Daland EM. Untreated carcinoma of the breast. Surg Gynaecol Obstet 1927, 44, 264–271. 3. Paget S. The distribution of secondary growths in cancer of the breast . Lancet

  11. Stimulating Personal Development and Knowledge Sharing (editorial special issue)

    NARCIS (Netherlands)

    Koper, Rob; Stefanov, Krassen; Dicheva, Darina

    2010-01-01

    Koper, R., Stefanov, K., & Dicheva, D. (2009). Stimulating Personal Development and Knowledge Sharing (editorial) [Special issue]. International Journal of Continuing Engineering Education and Life-Long Learning (IJCEELL), 19(Nos. 4/5/6), 271-275.

  12. Special Issue on Stimulating Personal Development and Knowledge Sharing

    NARCIS (Netherlands)

    Koper, Rob; Stefanov, Krassen; Dicheva, Darina

    2010-01-01

    Koper, R., Stefanov, K., & Dicheva, D. (2009). Stimulating Personal Development and Knowledge Sharing [Special issue]. International Journal of Continuing Engineering Education and Life-Long Learning (IJCEELL), 19(4/5/6), 271-395.

  13. Gas hydrate destabilization and methane release events in the Krishna-Godavari Basin, Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Joshi, R.K.; Mazumdar, A.; Peketi, A.; Ramamurty, P.B.; Naik, B.G.; Kocherla, M.; Carvalho, M.A.; Mahalakshmi, P.; Dewangan, P.; Ramana, M.V.

    . Palaeo. 284, 271-282. Panieri, G., Camerlenghi, A., Cacho, I., Cervera, C.S., Canals, M., Lafuerza, S., Herrera, G., 2012. Tracing seafloor methane emissions with benthic foraminifera: Results from the Ana submarine landslide (Eivissa Channel...

  14. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  15. La temperatura alcanzada es casi un grado más frio que el universo, informó el centro de investigaciones CERN

    CERN Multimedia

    2007-01-01

    The first section of what will be the biggest particle accelerator in the world, the LHC, near Geneva, reached the temperature in which it will work: -271 degre Celsius, about one degree colder than the Universe. (1/2 page)

  16. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  17. The Display of Multivariate Information: The Effects of Auto and Cross- Correlation, Reliability, and Heterogeneity

    Science.gov (United States)

    1987-12-01

    Factors Society. Santa Monica, CA: Human Factors. Chapman, L.J. and Chapman, J.P. (1969). Illusory correlation as an obstacle to the use of valid psychodiagnostic signs. Journal of Abnormal Psychology, 74, 271-280.

  18. Profit growth rate drops for China's shipbuilding industry

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    According to CANSI statistics, from January to August, the nation's major shipbuilding in- dustrial enterprises had a revenue of 438.3 billion Yuan for their primary business, up 27.1% from a year ago.

  19. Technical progress report. Private sector initiatives between the United States and Japan. January 1990 - December 1990

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-07-01

    OAK A271 This annual report for calendar year 1990 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract.

  20. Technical progress report. Private sector initiatives between the United States and Japan. January 1992 - December 1992

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-08-01

    OAK A271 This annual report for calendar year 1992 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract.

  1. Kuidas kirjutatakse ajalugu? / Carlo Ginzburg ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Ginzburg, Carlo

    2007-01-01

    Ülevaade Pisa Euroopa kultuuride professori C. Ginzburg'i teostest. Varem. ilm.: Märgid, jäljed ja tõendid : intervjuu Carlo Ginzburgiga // Ginzburg, Carlo. Juust ja vaglad. - Tallinn, 2000. - Lk. 262-271

  2. 76 FR 9734 - Endangered and Threatened Species; Proposed Threatened Status for Distinct Population Segments of...

    Science.gov (United States)

    2011-02-22

    ... notice in the Federal Register. Send written comments to Kaja Brix, Assistant Regional Administrator... Region, (907) 271-5006; Kaja Brix, NMFS Alaska Region, (907) 586-7235; or Marta Nammack, Office...

  3. 76 FR 6754 - Endangered and Threatened Species; Extension of Public Comment Period on Proposed Threatened...

    Science.gov (United States)

    2011-02-08

    ... March 25, 2011. ADDRESSES: Send comments to Kaja Brix, Assistant Regional Administrator, Protected... Region, (907) 271-5006; Kaja Brix, NMFS Alaska Region, (907) 586-7235; or Marta Nammack, Office...

  4. 76 FR 14882 - Endangered and Threatened Species; Proposed Threatened Status for Subspecies of the Ringed Seal

    Science.gov (United States)

    2011-03-18

    ... Mini- Convention Center, 409 River Street, Nome, AK. Send written comments to Kaja Brix, Assistant... Region, (907) 271-5006; Kaja Brix, NMFS Alaska Region, (907) 586-7235; or Marta Nammack, Office...

  5. Storm Water Management for Industrial Activities: Developing Pollution Prevention Plans and Best Management Practices

    Science.gov (United States)

    1992-09-01

    Contact *Alabama John Poole Daniel E. Cooper 205-271-7852 205-271-7939 Alaska Michael Menge David Wigglesworth 907-465-5260 907-465-5275 Arizona See...Oxabicyclo(2.2.l lhoptan*-2.3- 146733 Endothall 1.* 4 P088 C 1000 (464) dicarboxyhoc acid 1,2-Oxothiolano, 2.2-dioxide 1120714 1.3-Propane aultone 1

  6. An Overview of Production Systems

    Science.gov (United States)

    1975-10-01

    DISTRIBUTED BY: Matonal Tochnica! Infonu srice U. S. DEPARTMENT OF COMMERCE 028143 Stanford Artificil Inteligence Laboratory October 1975 Memo AIM-271...ORGANIZATION NAMEL AND ADDRESS 18. PROGRAM ELEMENT. PROJECT. TASK Artificial Intelligence Laboratory AE OKUI UBR Stanford University ARPA Order 249...014-64011I j SEC-jRITY CLASSIFICATION OF THIS PAGE (When, Data bHISP011 A Stanford Artificial ktteligncs Laboratory October 1975 Memo AIM-271 Computer

  7. Age-Related Yield of Adipose-Derived Stem Cells Bearing the Low-Affinity Nerve Growth Factor Receptor

    Directory of Open Access Journals (Sweden)

    Raquel Cuevas-Diaz Duran

    2013-01-01

    Full Text Available Adipose-derived stem cells (ADSCs are a heterogeneous cell population that may be enriched by positive selection with antibodies against the low-affinity nerve growth factor receptor (LNGFR or CD271, yielding a selective cell universe with higher proliferation and differentiation potential. This paper addresses the need for determining the quantity of ADSCs positive for the CD271 receptor and its correlation with donor's age. Mononuclear cells were harvested from the lower backs of 35 female donors and purified using magnetic beads. Multipotency capacity was tested by the expression of stemness genes and through differentiation into preosteoblasts and adipocytes. A significant statistical difference was found in CD271+ concentrations between defined age intervals. The highest yield was found within women on the 30–40-year-old age range. CD271+ ADSCs from all age groups showed differentiation capabilities as well as expression of typical multipotent stem cell genes. Our data suggest that the amount of CD271+ cells correlates inversely with age. However, the ability to obtain these cells was maintained through all age ranges with a yield higher than what has been reported from bone marrow. Our findings propose CD271+ ADSCs as the primary choice for tissue regeneration and autologous stem cell therapies in older subjects.

  8. The comparative effect of an addition of a surface term to the Woods-Saxon potential on the thermodynamics of a nucleon

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schr\\"odinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an $\\alpha$ particle confined in Bohrium-$270$ nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared in both wells. The internal energy and the specific heat capacity increase, as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the num...

  9. Comparison of Characteristics of Human Amniotic Membrane and Human Adipose Tissue Derived Mesenchymal Stem Cells

    Science.gov (United States)

    Dizaji Asl, Khadijeh; Shafaei, Hajar; Soleimani Rad, Jafar; Nozad, Hojjat Ollah

    2017-01-01

    BACKGROUND Mesenchymal stem cells (MSCs) are ideal candidates for treatment of diseases. Amniotic membranes are an inexpensive source of MSCs (AM-MSC) without any donor site morbidity in cell therapy. Adipose tissue derived stem cells (ASCs) are also suitable cells for cell therapy. There is discrepancy in CD271 expression among MSCs from different sources. In this study, the characteristics of AM-MSC and ASCs and CD271 expression were compared. METHODS Adult adipose tissue samples were obtained from patients undergoing elective surgical procedure, and samples of amniotic membrane were collected immediately after caesarean operation. After isolation and expansion of MSCs, the proliferation rate and viability of cells were evaluated through calculating DT and MTT assay. Expression of routine mesenchymal specific surface antigens of MSCs and CD271 was evaluated by flow cytometry for both types of cells. RESULTS The growth rate and viability of the MSCs from the amniotic membrane was significantly higher compared with the ASCs. The low expression of CD14 and CD45 indicated that AM-MSC and ASCs are non hematopoietic cells, and both cell types expressed high percentages of CD44, CD105. The results revealed that AM-MSC and ASCs expressed no CD271 on their surfaces. CONCLUSION This study showed that amniotic membrane is a suitable cell source for cell therapy, and CD271 is a negative marker for MSCs identification from amniotic membrane and adipose tissue.

  10. Evaluation of acetone vapors toxicity on Plodia interpunctella (Hubner) (Lepidoptera: Pyralidae) eggs.

    Science.gov (United States)

    Pourmirza, Ali Asghr; Nasab, Fershteh Sadeghi; Zadeh, Abas Hossein

    2007-08-01

    The efficacy of acetone vapors against carefully aged eggs of Plodia interpunctella (Hubner) at 17+/-1 and 27+/-1 degrees C at different dosage levels of acetone over various exposure times was determined. Acetone was found to be toxic to Indian meal moth eggs. Considerable variation in the susceptibility of different age groups of eggs was apparent in the fiducial limits of the LD50 values. An inverse relationship between LD50 values and exposure times was observed in age groups of tested eggs. At 27+/-1 degrees C and 24 h exposure period, eggs aged 1-2 day-old were more tolerant to acetone than other age groups, followed by 0-1 day-old, 2-3 day-old and 3-4 day-old eggs. A similar pattern of susceptibility of eggs was observed at 72 h exposure. In all bioassays, eggs exposed to higher dosages of acetone developed at smaller rate. This was significant for the eggs, which were exposed to the highest dosage for 24 h. Increasing the temperature from 17+/-1 to 27+/-1 degrees C greatly increased the efficacy of acetone. At 27+/-1 degrees C eggs of P. interpunctella were killed by less than one-third of the dosage required for control at 17+/-1 degrees C. Acetone achieved 50% mortality with a dosage of 82.76 mg L(-1) in 1-2 day-old eggs at 27+/-1 degrees C. At this temperature hatching was retarded and greatly diminished when eggs aged 1-2 day-old were exposed to 80 mg L(-1) of acetone for the 24 h exposure period. There was no evidence of a hatch delay longer than the time spent under vapors for eggs exposed at 17+/-1 or 27+/-1 degrees C, indicating that some development must have occurred under fumigation.

  11. Isolation and characterisation of mesenchymal stem/stromal cells in the ovine endometrium.

    Directory of Open Access Journals (Sweden)

    Vincent Letouzey

    Full Text Available Mesenchymal stem/stromal cells (MSC were recently discovered in the human endometrium. These cells possess key stem cell properties and show promising results in small animal models when used for preclinical tissue engineering studies. A small number of surface markers have been identified that enrich for MSC from bone marrow and human endometrium, including the Sushi Domain-containing 2 (SUSD2; W5C5 and CD271 markers. In preparation for developing a large animal preclinical model for urological and gynecological tissue engineering applications we aimed to identify and characterise MSC in ovine endometrium and determine surface markers to enable their prospective isolation.Ovine endometrium was obtained from hysterectomised ewes following progesterone synchronisation, dissociated into single cell suspensions and tested for MSC surface markers and key stem cell properties. Purified stromal cells were obtained by flow cytometry sorting with CD49f and CD45 to remove epithelial cells and leukocytes respectively, and MSC properties investigated.There was a small population CD271+ stromal cells (4.5 ± 2.3% in the ovine endometrium. Double labelling with CD271 and CD49f showed that the sorted CD271+CD49f- stromal cell population possessed significantly higher cloning efficiency, serial cloning capacity and a qualitative increased ability to differentiate into 4 mesodermal lineages (adipocytic, smooth muscle, chondrocytic and osteoblastic than CD271-CD49f- cells. Immunolabelling studies identified an adventitial perivascular location for ovine endometrial CD271+ cells.This is the first study to characterise MSC in the ovine endometrium and identify a surface marker profile identifying their location and enabling their prospective isolation. This knowledge will allow future preclinical studies with a large animal model that is well established for pelvic organ prolapse research.

  12. EST Table: FS912717 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS912717 E_FL_fufe_27A22_F_0 10/09/28 93 %/271 aa ref|NP_001040215.1| stathmin [Bom...byx mori] gb|ABD36259.1| stathmin [Bombyx mori] 10/09/12 46 %/271 aa FBpp0144714|DgriGH10808-PA 10/08/29 n.h...|Amel|GB18507-PA 10/09/10 52 %/274 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 fufe ...

  13. EST Table: FS919586 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS919586 E_FL_fufe_47M17_F_0 10/09/28 93 %/271 aa ref|NP_001040215.1| stathmin [Bom...byx mori] gb|ABD36259.1| stathmin [Bombyx mori] 10/09/13 46 %/271 aa FBpp0144714|DgriGH10808-PA 10/08/29 n.h...|Amel|GB18507-PA 10/09/10 53 %/274 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 fufe ...

  14. Drug: D00477 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Pronestyl (TN) C13H21N3O. HCl 271.1451 271.7863 D00477.gif Cardiac depressant [anti-arrhythmic] Therapeutic ...category: 2121 ATC code: C01BA02 Class I antiarrhythmic agent (Ia) voltage-gated sodium channel (SCN1A) bloc...:6581] Transporter inhibition: SLC47A1 [HSA:55244] map07028 Antipsychotics map07037 Antiarrhythmic drugs map...TIARRHYTHMICS, CLASS I AND III C01BA Antiarrhythmics, class Ia C01BA02 Procainami...de D00477 Procainamide hydrochloride (JP16/USP) USP drug classification [BR:br08302] Cardiovascular Agents Antiarrhythmic

  15. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A.

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  16. An experimental paradigm opening the world of superheavy elements

    Science.gov (United States)

    Armbruster, P.; Münzenberg, Gottfried

    2012-07-01

    The history of the discovery of the six elements Z = 107 ∓ 112, bohrium, hassium, meitnerium, darmstadtium, roentgenium, and copernicium goes back to the early 1960s. An experimental method to separate and identify rare nuclear reaction products, the recoil separation, was developed and optimised for beams of fission products at European research reactors. Chemical elements beyond the then first transactinides ( Z = 104), which owe their stability to the internal structure of atomic nuclei, were predicted theoretically. A big brother of the shell-stabilised nucleus 208Pb, a spherical magic nucleus at Z = 114∓126 and N = 184, might reach lifetimes long enough to be detected. In the seventies, hunting superheavy elements (SHE) was on the agenda of nuclear chemistry. Could the Periodic Table of Elements be extended to Z = 120, and is the order of electrons in the atom still following the laws established for lighter elements? In Germany, the heavy ion accelerator (UNILAC) was built by Christoph Schmelzer and his team at GSI, Darmstadt. SHE and UNILAC met the recoil separators in 1968, and SHIP (Separator for Heavy Ion reaction Products) was ready together with the first UNILAC-beams in 1976. Recoil separation is orders of magnitude more sensitive, selective, and faster than earlier methods used to synthesise elements up to seaborgium, Z = 106. The experimental paradigm we introduced opened the world of SHEs. At SHIP we discovered and investigated the elements Z = 107∓112 in the years 1980-2000. Our laboratory was the world champion during this time. Today our experimental method is used worldwide in the search for SHEs, but the leadership went to the Russian laboratory JINR in Dubna, which extended the Periodic Table by 6 more elements to Z = 118, the candidate for the next rare gas.

  17. Synthesis of the heaviest nuclei in cold fusion reactions

    Science.gov (United States)

    Münzenberg, G.; Morita, K.

    2015-12-01

    Cold fusion of heavy ions paved the way to superheavy elements. It was proposed by Yu.Ts. Oganessian more than forty years ago in 1974 [1,2]. First experiments were carried out at JINR Dubna, starting with the reaction 40Ar + 208Pb → 248Fm* where several hundreds to thousand atoms were produced on one day. The large production rate indicating an enhancement of the fusion cross section, especially for the evaporation of two or three neutrons, proved the concept of cold-fusion with the use of the doubly magic nucleus 208Pb as a target. The Dubna experiments were extended to the transactinide region beyond rutherfordium. The breakthrough came with the separation in-flight. Two different approaches were used: kinematic separation with the velocity filter SHIP [3] at GSI Darmstadt, and with the gasfilled separator GARIS [4,5] at RIKEN. With SHIP the concept of cold fusion of massive nuclear systems was convincingly confirmed by the observation of the one-neutron evaporation channel in the production of 247Rf in an irradiation of 208Pb with 50Ti [6] in 1981 which opened the way to the transactinide region. At SHIP the elements bohrium (107) to copernicium (112) were discovered [7]. A new closed shell region around hassium was found. The RIKEN experiments started in 2002. They confirmed the GSI results and in addition improved the data on structure and production of elements hassium to copernicium significantly. The heaviest element ever created in a cold fusion reaction, Z = 113, was observed at GARIS [8,9].

  18. Use of osteoplastic material to guide bone tissue regeneration deffect.

    Science.gov (United States)

    Machavariani, A; Mazmishvili, K; Grdzelidze, T; Menabde, G; Amiranashvili, I

    2011-12-01

    The goal of research was study of restoration processes in jaw-teeth bone defects by application of osteoplastic materials in the experiment. The experiment was performed over 32 white (6-12 month old) rats; the animals were divided into 2 groups; 16 animals were enrolled in the first group; the section was performed in the edge of lower jaw; the lower jaw body was revealed. Under the effect of the dental drilling machine and the # 1 cooling mean by the fissure bohrium (distilled water) the defect of the dimension of 2x2 mm was created; the defect was washed by 0/9% saline to remove the bone sawdust; the wound was sutured tightly, in layers. The second group of the experiment was staffed with 16 animals (main group); the similar bone defect of the size 2 x 2mm was created on the rat's jaw's body. After washing of modeled defect we inserted osteopathic materials PORESORB-TCP crystals with the size of 0,6-1.0 mm the wound was sutured tightly, in layers. After the 3-rd, 15-th, 30-th and 90-th days from the date of operation there was performed X-ray and morphological examination over the animals in the control as well as the main group. The analysis of the examination performed over the experimental materials showed that in the control group in samples taken at 90th day the defects were not completely restored. In the test group in samples taken at 90th day reparative regeneration is confirmed. This is stimulated by the factor that within the main group's animals the defect regeneration process is supported with the osteoplastic material PORESORB-TCP.

  19. 77 FR 34041 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2012-06-08

    .... 20120179, Final EIS, DOE, CA, Energia Sierra Juarez U.S. Transmission Line Project, Construction, Operation....-Mexico Border, Presidential Permit Approval, San Diego County, CA, Review Period Ends: 07/09/2012... 907-271-3130. Revision to FR Notice Published 04/20/2012; Comment Period Extended from 06/01/2012...

  20. Waste water treatment of slaughterhouse through water treatment plants of stainless steel; Tratamiento de aguas residuales de mataderos mediante depuradoras compactas modulares de acero inoxidable

    Energy Technology Data Exchange (ETDEWEB)

    BaNales Sirvent, P.

    1997-06-01

    The object of this project was to develop an integral waste water treatment concept, based on compact module made of stainless steel, with a combination that allows to get performances according to given requirements stablished in the Community Directive 91/271/CEE (1991). The industrial pilot tests have been made in a slaughterhouse with a capacity of 20 tons per day. (Author)

  1. Gclust Server: 201755 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201755 PPT_231553 Cluster Sequences - 271 fgenesh2_pg.scaffold_134000031; no annota...tion 1 1.00e-99 14.29 0.0 0.0 0.0 0.0 0.0 Show 201755 Cluster ID 201755 Sequence ID PPT_231553 Link to clust

  2. Submarine Propulsion Shaft Life: Probabilistic Prediction and Extension through Prevention of Water Ingress

    Science.gov (United States)

    2014-06-01

    Inspection. Reliability Engineering and System Safety , 271-292. 47 Shi, P., & Mahadevan, S. (2001). Damage Tolerance Approach for Probabilistic ...Submarine Propulsion Shaft Life: Probabilistic Prediction and Extension through Prevention of Water Ingress By Douglas E. Jonart M.S. Systems...number. 1. REPORT DATE 01 JUN 2014 2. REPORT TYPE 3. DATES COVERED 4. TITLE AND SUBTITLE Submarine Propulsion Shaft Life: Probabilistic

  3. Drug: D07435 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07435 Mixture, Drug Papaveretum (BAN); Omnopon (TN) Morphine hydrochloride [DR:D02...271], Papaverine hydrochloride [DR:D02218], Codeine hydrochloride [DR:D07740] ATC code: N02AA10 A mixture of 253 parts of Morphine

  4. InterProScan Result: FS737332 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS737332 FS737332_6_ORF1 55F7618E271F4D18 SUPERFAMILY SSF100939 SPOC domain-like 5....4e-41 T IPR016194 Spen Paralogue and Orthologue SPOC, C-terminal-like Molecular Function: binding (GO:0005488) ...

  5. Developing College Students' Civic Identity: The Role of Social Perspective Taking and Sociocultural Issues Discussions

    Science.gov (United States)

    Johnson, Matthew

    2015-01-01

    The development of college students' civic identity is understudied, but worthy of attention because of its salience to many students and higher education's commitment to fostering an engaged citizenry. Using 45,271 participants from the 2009 Multi-Institutional Study of Leadership, this study uses structural equation modeling to explore…

  6. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......, the DHQs were accompanied by six histrionicotoxins (HTXs), viz., 283A, 285A, 285B, 285C, 287A, and 287D. This co-occurrence of the HTX and DHQ alkaloids is the usual pattern seen in dendrobatid frogs. This finding contrasts with our earlier study, where workers of a Brazilian ant, Solenopsis (Diplorhoptrum......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...

  7. Novedades en el diccionario (New Additions to the Dictionary)

    Science.gov (United States)

    Carnicer, Ramon

    1975-01-01

    A total of 271 items--words, phrases and affixes--were added to the common Spanish dictionary in the period between October and December 1974. This article lists the principal additions, each organized within a larger semantic category. (Text is in Spanish.) (TL)

  8. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M

    2007-01-01

    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  9. File list: InP.CDV.05.AllAg.HUVEC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.CDV.05.AllAg.HUVEC hg19 Input control Cardiovascular HUVEC SRX220065,SRX294968,...271,SRX425273,SRX220068,SRX425270,SRX190192,SRX220067 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.CDV.05.AllAg.HUVEC.bed ...

  10. Gclust Server: 202079 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 202079 TET_35.m00287 Cluster Sequences - 271 hypothetical protein chr_0_8254597_35;... no annotation 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 202079 Cluster ID 202079 Sequence ID TET_35.m00287

  11. Extraction of Carbon Dioxide From Seawater by Ion Exchange Resin. Part 2. Using Strong Base Anion Exchange Resin

    Science.gov (United States)

    2009-09-29

    Figure 1. Table 2 - Resin Properties of Static Experiments Using Amberjet 4400 in OH Form (150 minute contact time). Sample Concentration (Molar...0.271 1 36 17.9 0.0075 150 0.267 134 19.0 Table 4 - Resin Properties of Static Experiments Using Amberjet 4400 in Cl Form (150 minute contact time

  12. AcEST: DK952033 [AcEST

    Lifescience Database Archive (English)

    Full Text Available r protein 521 OS=Mus musculus GN... 32 4.0 sp|P36847|FIBP_ADE15 Fiber protein OS=Human adenovirus D serotyp....Query: 215 PCVLAGLPFLSENVFLLHL 271 C+ + F +E +H+ Sbjct: 1196 QCIKCQMVFYNEWDIQVHV 1214 >sp|P36847|FIBP_ADE15 Fiber

  13. Assembling the LHC short straight sections

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The building where the short straight sections are being assembled, was often called ‘Lego Land’ by the workers because of the wide variety of sets of magnets and cryostats. Short straight sections contain magnets for manipulating the beam inside cryostats with liquid helium to keep the magnets at a cool 1.9 K (-271.3°C).

  14. Agglutination of pYV+ Yersinia enterocolitica strains by agglutinin from Mangifera indica.

    OpenAIRE

    1995-01-01

    Agglutination of 271 strains of Yersinia enterocolitica and related species grown at 37 degrees C by a 0.01% dilution of the agglutinin from Mangifera indica was correlated with the presence of the virulence plasmid. The study of YadA mutants suggested that the YadA protein is the target of the plant agglutinin.

  15. Apatite and Chitin Amendments Promote Microbial Activity and Augment Metal Removal in Marine Sediments

    Science.gov (United States)

    2013-07-01

    Situ Remediation of Contaminated Sediments: Evaluation of Potential Environmental Impacts,” Science of the Total Environment , Vol. 408, No. 20...and Their Suitability for Remediation of Con- taminated Soils,” Science of the Total Environment , Vol. 357, No. 1-3, 2006, pp. 271-279. doi:10.1016

  16. Covering, Packing and Logical Inference

    Science.gov (United States)

    1993-10-01

    of Operations Research 43 (1993). [34] *Hooker, J. N., Generalized resolution for 0-1 linear inequalities, Annals of Mathematics and A 16 271-286. [35...Hooker, J. N. and C. Fedjki, Branch-and-cut solution of inference prob- lems in propositional logic, Annals of Mathematics and AI 1 (1990) 123-140. [40

  17. Mathematical Programming and Logical Inference

    Science.gov (United States)

    1990-12-01

    solution of inference problems in propositional logic, to appear in Annals of Mathematics and Al. (271 Howard, R. A., and J. E. Matheson, Influence...1981). (281 Jeroslow, R., and J. Wang, Solving propositional satisfiability problems, to appear in Annals of Mathematics and Al. [29] Nilsson, N. J

  18. Same- and Other-Sex Popularity and Preference during Early Adolescence

    Science.gov (United States)

    Bowker, Julie C.; Adams, Ryan E.; Bowker, Matthew H.; Fisher, Carrie; Spencer, Sarah V.

    2016-01-01

    This study examined the longitudinal and bidirectional relations between same-sex (SS) and other-sex (OS) popularity and preference across one school year. Participants were 271 sixth-grade students who completed peer nomination measures at three time points in their schools. Tests of cross-lagged autoregressive models indicated that SS popularity…

  19. Evaluation of Dredged Material Proposed for Disposal at Island, Nearshore, or Upland Confined Disposal Facilities - Testing Manual

    Science.gov (United States)

    2003-01-01

    dynamics and risk assessment,” Ecotoxicology 2, 271-300. Moore, D. W., Bridges, T. S., and Cura, J. (1998). “Use of risk assessment in dredging and... bioassay procedures for the assessment of environmental samples containing hazardous wastes,” Biology and Fertility of Soils 1, 195- 200. Greene, J...2-6 2.2 Considerations for Risk Assessment

  20. French Frigate Shoals Site P16 9/14/2001 28-29M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 28 and 29 meters along a permanent transect.

  1. French Frigate Shoals Site P16 10/4/2002 18-19M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 18 and 19 meters along a permanent transect.

  2. French Frigate Shoals Site P16 10/4/2002 9-10M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 9 and 10 meters along a permanent transect.

  3. Protein (Viridiplantae): 356520860 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 24:441 3398:441 71240:3539 91827:3539 71275:632 91835:271 72025:690 3803:690 3814:690 163735:1365 3846:1365 3847:1365 PREDICTED: grav...es disease carrier protein-like Glycine max MAKQRQEDGKKGVVDLMPLFAKELLAGGVAGGFAKTVVA

  4. Upconversion Effects in Resonantly Pumped Er3+ and Pr3+ Doped Low Phonon-Energy Crystals for Eye-Safe Laser Applications

    Science.gov (United States)

    2015-07-14

    271-278 (2007). [15] Ferrier, A., Velazquez ,M., Doualan,J. L. and Moncorge, R., “Energy level and excited state absorption properties of Er3...Jian-hui, and Yang Gaobo, Optoelectronics Letters 8 (2012) 0273. [33] A. Ferrier, M. Velazquez , J. L. Doualan, and R. Moncorge, J. of AppL. Phys

  5. French Frigate Shoals Site P16 9/14/2001 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 2 and 3 meters along a permanent transect.

  6. French Frigate Shoals Site P16 10/4/2002 6-7M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 6 and 7 meters along a permanent transect.

  7. French Frigate Shoals Site P16 10/4/2002 30-31M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 30 and 31 meters along a permanent transect.

  8. French Frigate Shoals Site P16 10/4/2002 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 1 and 2 meters along a permanent transect.

  9. French Frigate Shoals Site P16 10/4/2002 12-13M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 12 and 13 meters along a permanent transect.

  10. AcEST: DK955092 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ted protein OS=Physcomitrella paten... 157 4e-37 tr|A9RMD5|A9RMD5_PHYPA Predicted protein OS=Physcomitrella ...++HAREYGHTHLSEV ++R NK ILFIHFSAR+ E Sbjct: 216 QAKLLIMETTFLDDAVTIQHAREYGHTHLSEVIKYANRLLNKSILFIHFSARYKRE 271 >tr|A9RMD5|A9RMD5

  11. ASSESSMENT OF IN VIVO MECHANICAL MUSCLE FUNCTION IN PATIENTS WITH OSTEOARTHRITIS (OA) OF THE HIP; RELIABILITY

    DEFF Research Database (Denmark)

    Jensen, Carsten; Overgaard, Søren; Aagaard, Per

    2009-01-01

    A). Both explosive muscle force characteristics (Rate of force development) and maximal isometric force (MVC) were obtained for the affected (aff) and non-affected (n-aff) leg (only data MVC for affected side in this abstract). 20 patients, (age 55.9 ± 4.8; height 174 ± 8; BMI 27.1 ± 4.5) with unilateral...

  12. Method for phenotypic detection of extended-spectrum beta-lactamases in enterobacter species in the routine clinical setting

    NARCIS (Netherlands)

    Stuart, J.C.; Diederen, B.; Al Naiemi, N.; Fluit, A.; Arents, N.; Thijsen, S.; Vlaminckx, B.; Mouton, J.W.; Leverstein-van Hall, M.

    2011-01-01

    In 271 Enterobacter blood culture isolates from 12 hospitals, extended-spectrum beta-lactamase (ESBL) prevalence varied between 0% and 30% per hospital. High prevalence was associated with dissemination, indicating the potential relevance of infection control measures. Screening with cefepime or Vit

  13. Balones que inspiran

    Directory of Open Access Journals (Sweden)

    Daniel Samper Pizano

    2005-09-01

    Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

  14. 77 FR 65379 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2012-10-26

    ..., Coos, Douglas, and Lane Counties, OR, Comment Period Ends: 12/10/2012, Contact: Angie Morris 541-271... Ends: 11/26/2012, Contact: Mary Romero 907-753-2773. EIS No. 20120340, Draft EIS, FHWA, IN, I-69.... Revision to FR Notice Published 08/31/2012; Extending Comment Period from 10/16/2012 to 10/31/2012. EIS...

  15. Plastics Pollution Control Technology Research

    Science.gov (United States)

    1992-01-01

    recycling program has generated $1 million as well as avoided significant landfill costs. The money collected is going to the base welfare and...Barbara Britten American Cetacean Society 1300 South Arlington Ridge Road #614 Arlington, Virginia 22202 703-920-0076 Fax: 703-271-8204 Madelyn

  16. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status

    Science.gov (United States)

    Wolters, Nina; Knoors, Harry; Cillessen, Antonius H. N.; Verhoeven, Ludo

    2014-01-01

    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of deaf adolescents' peer status in Grade 8 from…

  17. French Frigate Shoals Site P16 10/4/2002 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 23 and 24 meters along a permanent transect.

  18. 78 FR 79567 - Supplemental Nutrition Assistance Program: Trafficking Controls and Fraud Investigations

    Science.gov (United States)

    2013-12-31

    ...] [Page 79567] [FR Doc No: 2013-31354] DEPARTMENT OF AGRICULTURE Food and Nutrition Service 7 CFR Parts 271 and 274 RIN 0584-AE26 Supplemental Nutrition Assistance Program: Trafficking Controls and Fraud Investigations AGENCY: Food and Nutrition Service, USDA. ACTION: Final rule, Interim final rule; notice...

  19. 48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and...

  20. Psychiatric Disorder

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    2005514 Comparison of cognitive function and P300potentials in first-episode schizophrenia treated withrisperidone and clozapine.WANG Changhong(王长虹),et al.Dept Psychiat,Mental Health Instit,2nd Xian-gya Hosp,Centr South Univ,Changsha 410011.Chin JNerv Ment Dis 2005;31(4):267-271.

  1. 21.PSYCHIATRIC DISORDER 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920198 Kinetic observation of serum thyr-onormone level in schizophrenics.WANGXueyi (王学义),et al.Psychiatr Hosp,KailuanCoal Mining Administration,Tangshan,063001.Chin J Neurol & Psychiat 1991; 24 (5): 268-271.Measurements of serum T3,T4,RUR and FT4I

  2. Mechanisms of Mitochondrial Defects in Gulf War Syndrome

    Science.gov (United States)

    2011-08-01

    Chang, L., et al., Taurine protected myocardial mitochondria injury induced by hyperhomocysteinemia in rats. Amino acids, 2004. 27(1): p. 37-48...Mitochondrial ribosomal RNA mutation associated with both antibiotic-induced and non-syndromic deafness. Nature genetics, 1993. 4(3): p. 289-94. 50. Suzuki, Y

  3. Relationship between pickiness and subsequent development in body mass index and diet intake in obesity prone normal weight preschool children

    DEFF Research Database (Denmark)

    Rohde, Jeanett Friis; Händel, Mina Nicole; Stougaard, Maria

    2017-01-01

    Start” intervention study which included 271 children aged 2–6 years susceptible to overweight later in life. Information on pickiness was obtained from a parental questionnaire. Dietary habits were collected by 4-day dietary records filled in by the parents and height and weight were measured...... children seemed to develop a lower protein intake despite similar total energy intake and diet composition....

  4. Parental Employment and Child Behaviors: Do Parenting Practices Underlie These Relationships?

    Science.gov (United States)

    Hadzic, Renata; Magee, Christopher A.; Robinson, Laura

    2013-01-01

    This study examined whether hours of parental employment were associated with child behaviors via parenting practices. The sample included 2,271 Australian children aged 4-5 years at baseline. Two-wave panel mediation models tested whether parenting practices that were warm, hostile, or characterized by inductive reasoning linked parent's hours of…

  5. Infection

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010373 Eosinophilic meningitis caused by Angiostrongylus cantonensis:a clinical and cerebrospinal fluid cytology report of 9 cases. GUAN Hongzhi(关鸿志),et al. Dept Neurol,PUMC & CAMS,Bejing 100730. Chin J Neurol 2010;43(4):268-271. Objective To report 9 cases of eosinophilic meningitis caused by Angiostrongylus cantonensis in Beijing,and to evaluate

  6. New method to analyze internal disruptions with tomographic reconstructions

    NARCIS (Netherlands)

    Tanzi, C. P.; de Blank, H. J.

    1997-01-01

    Sawtooth crashes have been investigated on the Rijnhuizen Tokamak Project (RTP) [N. J. Lopes Cardozo ed al., Proceedings of the 14th international Conference on Plasma Physics and Controlled Nuclear Fusion Research, Wurzburg, 1992 (International Atomic Energy Agency, Vienna, 1993), Vol. 1, p. 271].

  7. French Frigate Shoals Site P16 10/4/2002 14-15M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 14 and 15 meters along a permanent transect.

  8. Midway Atoll Site P20 12/6/2002 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 23 and 24 meters along a permanent transect.

  9. 77 FR 7383 - Announcement of Funding Awards for the Continuum of Care Program for Fiscal Year (FY) 2010

    Science.gov (United States)

    2012-02-10

    ...,530 County. Mental Health Association of San Mateo CA 73,271 County. Mental Health Systems Inc CA 273,283 Mental Health Systems Inc CA 287,042 Mental Health Systems Inc CA 74,843 Mental Health Systems Inc... Assistance Association....... AK 104,665 Anchorage Community Mental Health......

  10. Information Theoretic Detection of Objects Embedded in Cluttered Aerial Scenes.

    Science.gov (United States)

    1982-07-01

    procedure must only be accomplished once for each template density and most numerical problems are avoided. The Cyclic Coordinate Method ( Bazaraa , 1979:271...TApril 1962). L4. Bazaraa , Mokhtar S. and C. M. Shetty. Nonlinear Pro- gramming Theory and Algorithms. New York: John Wiley and Sons, 1979. 5. Burg, John P

  11. Dicty_cDB: Contig-U06058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 27_1( EU420127 |pid:none) Clavicipitaceae sp. CV-2008a trans... 350 6e-95 EF468764_1( EF468764 |pid:none) Ophiocordyceps...fac... 348 3e-94 EF468756_1( EF468756 |pid:none) Metacordyceps liangshanensis strai... 348 3e-94 DQ028594_1(

  12. 75 FR 8920 - Grant of Authority for Subzone Status; Danisco USA, Inc., Sweeteners Division (Xylitol, Xylose...

    Science.gov (United States)

    2010-02-26

    ... Foreign-Trade Zones Board Grant of Authority for Subzone Status; Danisco USA, Inc., Sweeteners Division... manufacturing facility of Danisco USA, Inc., Sweeteners Division, located in Thomson, Illinois, (FTZ Docket 4... facility of Danisco USA, Inc., Sweeteners Division, located in Thomson, Illinois (Subzone 271A),...

  13. 77 FR 14350 - North Pacific Fishery Management Council; Public Meeting

    Science.gov (United States)

    2012-03-09

    ...; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Hilton Hotel, 500 West 3rd Avenue, King Salmon/Illiamna Room, Anchorage, AK. Council address: North... INFORMATION CONTACT: Jane DiCosimo, Council staff; telephone: (907) 271-2809. SUPPLEMENTARY INFORMATION:...

  14. 78 FR 16660 - North Pacific Fishery Management Council; Public Meeting

    Science.gov (United States)

    2013-03-18

    ...; Public Meeting AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Hilton Hotel, Dillingham/Katmai Room, 500 West 3rd Avenue, Anchorage, AK. Council address: North Pacific... CONTACT: Diana Evans, Council staff, telephone: (907) 271-2809. ] SUPPLEMENTARY INFORMATION: The...

  15. Gclust Server: 201560 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201560 DCGR_CAGL0G06996g Cluster Sequences - 271 - 1 1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 2015...60 Cluster ID 201560 Sequence ID DCGR_CAGL0G06996g Link to cluster sequences Cluster Sequences

  16. Dicty_cDB: FC-AD05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 99 e-110 AM920435_140( AM920435 |pid:none) Penicillium chrysogenum Wisconsi... 272 8e-72 EU857727_1( EU857727 |pid:none) Horta...ea werneckii delta-9 desatura... 271 2e-71 AY576801_1( AY576801 |pid:none) Hortaea werneck

  17. A Biomathematical Model of the Restoring Effects of Caffeine on Cognitive Performance During Sleep Deprivation

    Science.gov (United States)

    2013-01-01

    on mood and performance: a study of realistic consumption. Psychopharmacology (Berlin) 164, 188–192. Caldwell, J.A., Caldwell, J.L., 2005. Fatigue in...S., Dagan, Y., Shenkman, L., 2002. The effects of coffee consumption on sleep and melatonin secretion. Sleep Med. 3, 271–273. Syed, S.A., Kamimori

  18. French Frigate Shoals Site P13 10/31/2002 16-17M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 16 and 17 meters along a permanent transect.

  19. French Frigate Shoals Site P16 9/14/2001 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 23 and 24 meters along a permanent transect.

  20. French Frigate Shoals Site P13 10/31/2002 12-13M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 12 and 13 meters along a permanent transect.

  1. French Frigate Shoals Site P16 9/14/2001 18-19M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 18 and 19 meters along a permanent transect.

  2. SwissProt search result: AK104880 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104880 001-044-G04 (Q13627) Dual specificity tyrosine-phosphorylation regulated k...inase 1A (EC 2.7.1.-) (Protein kinase minibrain homolog) (MNBH) (HP86) (Dual specificity YAK1-related kinase) DYR1A_HUMAN 2e-23 ...

  3. SwissProt search result: AK099863 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099863 J013111B17 (Q63470) Dual specificity tyrosine-phosphorylation regulated ki...nase 1A (EC 2.7.1.-) (Protein kinase minibrain homolog) (MNBH) (RP86) (Dual specificity YAK1-related kinase) DYR1A_RAT 1e-17 ...

  4. SwissProt search result: AK066287 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066287 J013064I06 (Q13627) Dual specificity tyrosine-phosphorylation regulated ki...nase 1A (EC 2.7.1.-) (Protein kinase minibrain homolog) (MNBH) (HP86) (Dual specificity YAK1-related kinase) DYR1A_HUMAN 1e-18 ...

  5. SwissProt search result: AK110015 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110015 002-159-H03 (Q13627) Dual specificity tyrosine-phosphorylation regulated k...inase 1A (EC 2.7.1.-) (Protein kinase minibrain homolog) (MNBH) (HP86) (Dual specificity YAK1-related kinase) DYR1A_HUMAN 3e-13 ...

  6. SwissProt search result: AK073808 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073808 J033067D07 (Q63470) Dual specificity tyrosine-phosphorylation regulated ki...nase 1A (EC 2.7.1.-) (Protein kinase minibrain homolog) (MNBH) (RP86) (Dual specificity YAK1-related kinase) DYR1A_RAT 6e-19 ...

  7. 75 FR 73116 - Delaware River and Bay Oil Spill Advisory Committee; Meetings

    Science.gov (United States)

    2010-11-29

    ..., Pennsylvania 19147. Send written material and requests to make oral presentations to Gerald Conrad, Liaison to... CONTACT: Gerald Conrad, Liaison to the DFO of the DRBOSAC, telephone 215-271-4824. SUPPLEMENTARY... possible. Dated: November 23, 2010. Joseph M. Re, Captain, U.S. Coast Guard, Office of...

  8. Identification of Novel Prognostic Genetic Marker in Prostate Cancer

    Science.gov (United States)

    2001-08-01

    Carlsbad, CA, USA) were denatured for 7 minutes Bank , Tokyo) containing sequences encoding the simian at 75°C, reannealed at 37°C for 1 hour, then...Hum. Mol. Genet. 10, 271-282. 21. Daigo, Y., Chin, S. F., Gorringe , K. L., Bobrow, L. G., Ponder, B. A., Pharoah, P. D., Caldas, C. (2001

  9. TMFunction data: 900 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available H7 ... Minchin RF, McCoubrie JE. Int J Biochem Cell Biol. 2004 Feb;36(2):271-80 Glycine-scanning mutagenesis 9.5 Km (microM) ... Q8X9G5_ECO57 Helix ... polyamine; transporter; E.coli; PotE

  10. Smallpox Antiviral Drug

    Science.gov (United States)

    2007-01-01

    strategies is essential. ACKNOWLEDGMENTS We thank Robert Jordan, Sean Amberg, and Tove’ Bolken for critical reviews of the manuscript. REFERENCES...part II. Adverse events. Clin Infect Dis 37:251–271. Ghosn J, Chaix ML, Peytavin G, Rey E, Bresson JL, Goujard C, Katlama C, Viard JP, Treluyer JM

  11. Conjugacy Class Sizes and Solvability of Finite Groups

    Indian Academy of Sciences (India)

    Qinhui Jiang; Changguo Shao

    2013-05-01

    Let be a finite group and * be the set of primary, biprimary and triprimary elements of . We prove that if the conjugacy class sizes of * are {1,,,} with positive coprime integers and ,then is solvable. This extends a recent result of Kong (Manatsh. Math. 168(2)(2012) 267–271).

  12. French Frigate Shoals Site P16 10/4/2002 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 38 and 39 meters along a permanent transect.

  13. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status

    Science.gov (United States)

    Wolters, Nina; Knoors, Harry; Cillessen, Antonius H. N.; Verhoeven, Ludo

    2014-01-01

    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of deaf adolescents' peer status in Grade 8 from Grade…

  14. Constitutional Court of South Africa overturns lower court's decision on the right to "sufficient water".

    Science.gov (United States)

    2009-12-01

    On 8 October 2009, the Constitutional Court of South Africa overturned the judgment of the Supreme Court of Appeal, which addressed the proper interpretation of Section 27(1)(b) of the Constitution of South Africa (Constitution)--namely, everyone's right to have access to sufficient water.

  15. 41 CFR 109-27.102-52 - Implementation.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27.102-52 Section 109-27.102-52 Public Contracts and Property Management Federal Property...

  16. 41 CFR 109-27.102-51 - Policy.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management...

  17. 41 CFR 101-27.103 - Acquisition of excess property.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT 27.1-Stock Replenishment § 101-27.103 Acquisition of excess property. Except for inventories... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Acquisition of excess property. 101-27.103 Section 101-27.103 Public Contracts and Property Management Federal...

  18. 41 CFR 109-27.102-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property...

  19. 41 CFR 109-27.102-50 - Systems contracting.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property...

  20. French Frigate Shoals Site P16 9/14/2001 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 4 and 5 meters along a permanent transect.

  1. French Frigate Shoals Site P16 9/14/2001 22-23M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 22 and 23 meters along a permanent transect.

  2. French Frigate Shoals Site P13 10/31/2002 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 1 and 2 meters along a permanent transect.

  3. French Frigate Shoals Site P13 10/31/2002 0-1M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 0 and 1 meters along a permanent transect.

  4. French Frigate Shoals Site P16 10/4/2002 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 4 and 5 meters along a permanent transect.

  5. French Frigate Shoals Site P16 9/14/2001 42-43M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 42 and 43 meters along a permanent transect.

  6. French Frigate Shoals Site P16 9/14/2001 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 47 and 48 meters along a permanent transect.

  7. French Frigate Shoals Site P13 10/31/2002 14-15M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 14 and 15 meters along a permanent transect.

  8. French Frigate Shoals Site P16 9/14/2001 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 10 and 11 meters along a permanent transect.

  9. Bleeding Time, Volume of Shed Blood Collected at the Bleeding Time Site, and the Peripheral Venous Hematocrit.

    Science.gov (United States)

    2007-11-02

    The bleeding time. Prog in Hemostasis and Thrombosis, NY, Grune-Stratton 2:249-271,1974. 2. The bleeding time. The Lancet 1991;337:1447-1448. 3...aggregation. The Lancet 1984;1409-1410. 29. The bleeding-time and the haematocrit. The Lancet May 4; 1984;997-998. 30. Turrito VT,Weiss HJ: Red blood

  10. The risk and prognostic impact of definite stent thrombosis or in-stent restenosis after coronary stent implantation

    DEFF Research Database (Denmark)

    Thayssen, Per; Jensen, Lisette Okkels; Lassen, Jens Flensted;

    2012-01-01

    of death (HR=2.71 [95% CI: 1.72-4.27]) compared to cases without stent thrombosis. In-stent restenosis had no substantial impact (HR=1.17 [95% CI: 0.79-1.75]). However, in-stent restenosis presenting as non-ST-segment elevation myocardial infarction (NSTEMI) was associated with a greater mortality risk...

  11. Measurement of the cosmic background radiation temperature at 6. 3 cm

    Energy Technology Data Exchange (ETDEWEB)

    Mandolesi, N.; Calzolari, P.; Cortiglioni, S.; Morigi, G.

    1984-06-15

    We present results of a measurement of the cosmic background radiation temperature at a wavelength of 6.3 cm. We obtained the value T/sub CBR/ = 2.71 +- 0.20 K. This is in good agreement with, and has a smaller error than, any previous measurement at equal or longer wavelengths.

  12. 48 CFR 1371.118 - Changes-ship repair.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Changes-ship repair. 1371... SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.118 Changes—ship repair. Insert clause 1352.271-87, Changes—Ship Repair, in all solicitations...

  13. Intervención cognitivo conductual en adultos mayores : retos y dificultades en la adaptación de una terapia de grupo manualizada /

    OpenAIRE

    Vergara-Lope Tristán, Samana sustentante.

    2009-01-01

     tesis que para obtener el grado de Doctor en Psicología, presenta Samana Vergara-Lope Tristán ; asesor Ana Luisa González-Celis Rangel. 271 páginas. Doctorado en Psicología UNAM, Facultad de Psicología, 2009

  14. 77 FR 71344 - Texas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2012-11-30

    ... pollution control, Water supply. Authority: This rule is issued under the authority of Sections 2002(a...) Texas Water Code (TWC), Texas Codes Annotated, as amended effective September 1, 2009: Chapter 5... AGENCY 40 CFR Parts 271 and 272 Texas: Final Authorization of State-initiated Changes and...

  15. Gclust Server: 43432 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 43432 PHRA_74388 Cluster Sequences Related Sequences(66) 271 fgenesh1_pg.C_scaffold..._7000159; no annotation 2 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 43432 Cluster ID 43432 Sequence ID PHRA_743

  16. SWAT Development for Simulating Flow and Pesticide Movement in a Large Claypan Watershed

    Science.gov (United States)

    The Mark Twain Lake/Salt River Basin is located in northeastern Missouri and is the source of water to Mark Twain Lake (MTL), a public water supply that serves 40,000 people. At the outlet of MTL, the basin drains 6417 km2, including 10 major watersheds that range in area from 271 to 1579 km2. The b...

  17. 78 FR 4143 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2013-01-18

    ... Morse 209-579-1270. EIS No. 20130007, Draft EIS, BLM, NV, Arturo Mine Project, Development, Elko County... Hunt on Bowhead Whales for the Years 2013 through 2017/2018, Contact: Steven K. Davis 907-271-3523. EIS.... Amended Notices EIS No. 20120362, Draft EIS, BLM, CA, Casa Diablo IV Geothermal Development Project,...

  18. Augmented Reality Mentor for Training Maintenance Procedures: Interim Assessment

    Science.gov (United States)

    2014-08-01

    References Chandler, P. (2009). Dynamic visualisations and hypermedia: Beyond the “Wow” factor. Computers in Human Behavior , 25(2), 389-392. Hart...Merrienboer, J. J. (2011). An expertise reversal effect of segmentation in learning from animated worked-out examples. Computers in Human Behavior , 27(1

  19. Some Diophantine equations from finite group theory: $\\Phi_m(x)=2p^n-1$

    CERN Document Server

    Luca, Florian; de Weger, Benne

    2009-01-01

    We show that the equation in the title (with $\\Phi_m$ the $m$th cyclotomic polynomial) has no integer solution with $n\\ge 1$ in the cases $(m,p)=(15,41), (15,5581),(10,271)$. These equations arise in a recent group theoretical investigation by Z. Akhlaghi, M. Khatami and B. Khosravi.

  20. Small hydro policy and potential in Spain

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Spain has 662 small hydro installations, as registered in the “Speciaf Regimen” of 31 December 1999, with 1,271,573 kW of instaffed power producing the equivalent of the electricity consumed by 1.1 million families, avoiding emissions of 2.6 million tonnes of CO2 per year and substituting 250,000 toe.

  1. One-year incidence of prosthetic joint infection in total hip arthroplasty

    DEFF Research Database (Denmark)

    Gundtoft, P H; Pedersen, Alma Becic; Schønheyder, Henrik Carl

    2016-01-01

    . The most common micro-organisms identified in the 271 PJI were Staphylococcus aureus (36%) and coagulase-negative staphylococci (CoNS) (33%); others commonly identified included Enterobacteriaceae, enterococci, and streptococci. Antimicrobial resistance to beta-lactams and gentamicin did not change during...

  2. 38 CFR 17.805 - Additional terms of loans.

    Science.gov (United States)

    2010-07-01

    .... L. 102-54, 105 Stat. 271, 38 U.S.C. 501) Health Care Benefits for Certain Children of Vietnam... established with the assistance of the loan, the recipient must agree to the following: (a) The use of alcohol... prohibition of alcohol or any illegal drugs will be expelled from the residence; (c) The cost of...

  3. 77 FR 41292 - Louisiana: Final Authorization of State-Initiated Changes and Incorporation by Reference of...

    Science.gov (United States)

    2012-07-13

    ... From the Federal Register Online via the Government Publishing Office ] ENVIRONMENTAL PROTECTION AGENCY 40 CFR Parts 271 and 272 Louisiana: Final Authorization of State-Initiated Changes and... analog. 109 SPOC No Federal analog. State analogs to 40 CFR Part 261 provisions (Identification...

  4. International Conference on Rehabilitation Engineering: Proceedings (2nd, Ottawa, Canada, June 17-22, 1984). Combined with RESNA 7th Annual Conference. Volume 4 = Conference internationale sur la technologie de reeducation fonctionnelle: compet rendu (2nd, Ottawa, Canada, Juin 17-22, 1984). Tenue parallelement a la RESNA 7e conference annuelle.

    Science.gov (United States)

    Rehabilitation Engineering Society of North America, Washington, DC.

    These proceedings contain 271 papers in English and 15 in French, representing research and development efforts in 19 countries. On the topic of wheelchairs, 28 papers address their design, performance, evaluation, and fabrication. The field of prosthetics and orthotics is represented by 33 papers discussing devices for upper extremities, lower…

  5. Micromechanical Origins and Design Implications of Damage Tolerance in Ti3SiC2

    Science.gov (United States)

    2003-10-01

    J. Alloys and Compds (3), and Scripta Mater. (1). As important the feature article and cover the July-August 2001 American Scientist was devoted...Compds. 347, 271-278 (2002). 12. M. W. Barsoum and T. El-Raghy, “The MAX Phases: Unique New Carbide and Nitride Materials”, American Scientist , 89

  6. The Coast Artillery Journal. Volume 65, Number 5, November 1926

    Science.gov (United States)

    1926-11-01

    alone this college gave the Army 5966 men, the Navy 325, and the ~Iarine Corps 271, a total of 6562. Ei !!;hty-six men gave their Ihes, 456 ,,’ere... sarcasm . He was a large con- tributor to the pages of the Militiir.Wochenblatt and was highly appreciated by the editorial management of that military

  7. Decision Support Tool for Deep Energy Efficiency Retrofits in DoD Installations

    Science.gov (United States)

    2013-12-01

    Laboratory 148 1119 229 271 1370 13 528 33 1 1 3713 Lodging 14186 12886 14856 2590 12278 1970 2571 3421 755 903 66416 Mercantile (Retail other than...Houston Denver Usage Types Educatio n Food Servic e Health Care (Outpatient ) Laborator y Lodgin g Mercantil e (Retail other than mall

  8. Historical Overview of Racism in the Military

    Science.gov (United States)

    2002-02-01

    highest military award, the Croix de Guerre was awarded to 170 individual soldiers as well as the unit itself. The 370th and 271st also received the... Croix . However, the AEF leaders were concerned about the French commending the Black American troops too highly, and urged them not to spoil the

  9. Midway Atoll Site P20 12/6/2002 45-46M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 45 and 46 meters along a permanent transect.

  10. Tangible and Intangible Rewards and Employee Creativity: The Mediating Role of Situational Extrinsic Motivation

    Science.gov (United States)

    Yoon, Hye Jung; Sung, Sun Young; Choi, Jin Nam; Lee, Kyungmook; Kim, Seongsu

    2015-01-01

    This study examined the effects of tangible and intangible forms of creativity-contingent rewards on employee creativity. Situation-specific intrinsic and extrinsic motivations were proposed as mediators of the reward-creativity link. Based on data collected from 271 employees and their supervisors, results revealed the following: (a) intangible…

  11. Mira y lee: Libro de actividades, 1 (Look and Read: Workbook 1).

    Science.gov (United States)

    Martinez, Emiliano; And Others

    This workbook, designed to be used with the textbook of the same title (FL 004 271), contains exercises, riddles, puzzles, coloring activities, and reinforcement of various word-perception skills and sentences. Included is a step-by-step procedure of phonetic analysis. The intention of the workbook is to enable students to increase their ability…

  12. Command and Control of the U.S. Tenth Army During the Battle of Okinawa

    Science.gov (United States)

    2009-06-12

    30 Appleman, et al, 498. 31 Nichols and Shaw, 271. 32 Ibid., 261. 33 Ibid., 263. 34 Craig M. Cameron, American Samurai : Myth, Imagination...Annapolis: Naval Institute Press, 1987. Cameron, Craig M. American Samurai : Myth, Imagination, and the Conduct of Battle of the First Marine

  13. Health care agreements as a tool for coordinating health and social services

    DEFF Research Database (Denmark)

    Rudkjøbing, Andreas; Strandberg-Larsen, Martin; Vrangbaek, Karsten

    2014-01-01

    services, a survey was conducted before (2005-2006) and after the reform (2011). THEORY AND METHODS: The study was designed on the basis of a modified version of Alter and Hage's framework for conceptualising coordination. Both surveys addressed all municipal level units (n = 271/98) and a random sample...

  14. The Relationship between Mechanical Hyperalgesia Assessed by Manual Tender Point Examination and Disease Severity in Patients with Chronic Widespread Pain: A Cross-Sectional Study

    DEFF Research Database (Denmark)

    Amris, Kirstine; Wæhrens, Eva Ejlersen; Jespersen, Anders

    2014-01-01

    . 271 women with CWP were recruited from a clinical setting. Data collection included patient-reported symptoms, health-related quality of life variables, and observation-based measures of functional ability, muscle strength, 6-minute walk, and pressure pain thresholds measured by cuff algometry. TP...

  15. Draft Genome Sequence of the Intermediate Rough Vaccine Strain Brucella abortus S19Δper Mutant

    Science.gov (United States)

    Chaudhuri, Pallab; Goswami T, Tapas K.; Lalsiamthara, Jonathan; Kaur, Gurpreet; Vishnu, Udayakumar S.; Sankarasubramanian, Jagadesan; Gunasekaran, Paramasamy

    2015-01-01

    Here, we report the genome sequence of the intermediate rough vaccine strain mutant, Brucella abortus S19Δper. The length of the draft genome was 3,271,238 bp, with 57.2% G+C content. A total of 3,204 protein-coding genes and 56 RNA genes were predicted. PMID:26564050

  16. Predictive Service Life Tests for Roofing Membranes: Phase 1

    Science.gov (United States)

    1993-12-01

    April 1991), pp 37-38, 40, 42, 44, 46. Puterman . M., K.H. Reinhorn, and M. Marton, "Specifications for Quality Assurance of Single-Ply Membrane...Material." Third International Symposium on Roofing Technology (NRCA, 1991), pp 271-275. Puterman , M., I. Soroka, and A. Bentur, "Deterioration of

  17. Exposure of the Distal Humerus Using a Triceps Hemi-peel Approach

    Science.gov (United States)

    2014-05-14

    approach to the elbow. Ann R Coll Surg Engl. 2010; 92:240- 242. 18. Regan WD, Korinek SL, Morrey BF, An KN. Biomechanical study of ligaments around...the elbow joint. Clin Orthop Relat Res. 1991; (271):170-179. 19. Blair JA, Stinner DJ, Kirby JM, et al. Quan- tification of femoral neck exposure

  18. 78 FR 6124 - Office of the Director, National Institutes of Health; Notice of Closed Meeting

    Science.gov (United States)

    2013-01-29

    ... personal privacy. Name of Committee: Office of Research Infrastructure Programs Special Emphasis Panel; K01... applications. Place: National Institutes of Health, One Democracy Plaza, 6701 Democracy Boulevard, Bethesda, MD... Health, 6701 Democracy Blvd., Democracy 1, Room 1070, Bethesda, MD 20892-4874, 240-271-4890,...

  19. Comparison of Health-Related Quality of Life among 10- to 12-Year-Old Children with Chronic Illnesses and Healthy Children: The Parents' Perspective

    Science.gov (United States)

    Svavarsdottir, Erla Kolbrun; Orlygsdottir, Brynja

    2006-01-01

    The purpose of this study was to evaluate mothers' and fathers' perception of their child's health-related quality of life (HRQOL) among 10- to 12-year-old Icelandic children with or without chronic health condition or illness. A total of 912 Icelandic parents (510 mothers and 402 fathers) and 480 children (209 boys and 271 girls) participated in…

  20. French Frigate Shoals Site P13 10/31/2002 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 7 and 8 meters along a permanent transect.

  1. 76 FR 36414 - Occupational Injury and Illness Recording and Reporting Requirements-NAICS Update and Reporting...

    Science.gov (United States)

    2011-06-22

    ... classifying business establishments for the purpose of collecting, analyzing, and publishing statistical data... Goods Stores. 4511 Sporting Goods, Hobby, and Musical Instrument Stores. 4512 Book, Periodical, and... Stations 128,972 12,220 2,575 3,634 4511 Sporting Goods, Hobby, and Musical 1,271 65 16 37...

  2. 76 FR 6594 - Florida: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2011-02-07

    ... AGENCY 40 CFR Part 271 Florida: Final Authorization of State Hazardous Waste Management Program Revisions... for Final authorization of the changes to its hazardous waste program under the Resource Conservation... submit an electronic comment, EPA recommends that you include your name and other contact information...

  3. 76 FR 6594 - North Carolina: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2011-02-07

    ... AGENCY 40 CFR Part 271 North Carolina: Final Authorization of State Hazardous Waste Management Program... applied to EPA for Final authorization of the changes to its hazardous waste program under the Resource... you submit an electronic comment, EPA recommends that you include your name and other...

  4. French Frigate Shoals Site P13 10/31/2002 17-18M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 17 and 18 meters along a permanent transect.

  5. French Frigate Shoals Site P16 10/4/2002 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 11 and 12 meters along a permanent transect.

  6. French Frigate Shoals Site P16 10/4/2002 24-25M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 24 and 25 meters along a permanent transect.

  7. 47 CFR 73.202 - Table of Allotments.

    Science.gov (United States)

    2010-10-01

    ..., 299C3 Hotchkiss 258C3 Hugo 222A Lake City 247A Olathe *270C2, *293C Orchard Mesa 249C3 Silverton 281A..., 286C2 Santa Anna 282A Savoy 297A Shamrock 271A Sheffield 224C2 Silverton 252A Smiley 280A Snyder...

  8. Domain Modeling: NP_059431.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_059431.1 chr19 Crystal Structure of Autoinhibited Form of Grp1 Arf GTPase Exchan...ge Factor c2r0db_ chr19/NP_059431.1/NP_059431.1_holo_49-390.pdb blast 268K,270G,271G,272G,273R,274V,276T,278

  9. Domain Modeling: NP_660281.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_660281.2 chr1 Structure of the Wilms Tumor Suppressor Protein Zinc Finger Domain... Bound to DNA p2prta_ chr1/NP_660281.2/NP_660281.2_holo_261-368.pdb psi-blast 265T,266S,267E,268K,270Q,271G,

  10. French Frigate Shoals Site P16 10/4/2002 40-41M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 40 and 41 meters along a permanent transect.

  11. French Frigate Shoals Site P16 9/14/2001 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 8 and 9 meters along a permanent transect.

  12. French Frigate Shoals Site P16 9/14/2001 6-7M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 6 and 7 meters along a permanent transect.

  13. French Frigate Shoals Site P16 10/4/2002 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 37 and 38 meters along a permanent transect.

  14. French Frigate Shoals Site P16 10/4/2002 13-14M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 13 and 14 meters along a permanent transect.

  15. French Frigate Shoals Site P16 9/14/2001 31-32M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 31 and 32 meters along a permanent transect.

  16. French Frigate Shoals Site P13 10/31/2002 33-34M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 33 and 34 meters along a permanent transect.

  17. Developing an Instrument for Measuring Teachers' Mathematics Content Knowledge on Ratio and Proportion: A Case of Indonesian Primary Teachers

    Science.gov (United States)

    Ekawati, Rooselyna; Lin, Fou-Lai; Yang, Kai-Lin

    2015-01-01

    In this study, we developed an instrument for assessing teachers' mathematics content knowledge (MCK) on ratio and proportion and examined the profile of Indonesian primary teacher's MCK on this topic. The MCK items were administered to 271 Indonesian in-service primary teachers with a variety of educational backgrounds and teaching…

  18. Gender and Function of Language Use: Quantitative and Qualitative Evidence from Japanese.

    Science.gov (United States)

    Ide, Sachiko

    1992-01-01

    A study used both a survey and observation to investigate the phenomenon of politer speech among Japanese women than among Japanese men. The survey of 256 men and 271 women, parents of college students at a college in Tokyo and representing a middle-class population, inquired about the respondents' personal use of polite forms of Japanese. It is…

  19. Protesting War: Comparing Afghanistan to Vietnam

    Science.gov (United States)

    2011-10-27

    Kennedy School of Government C15-80-271 (Boston, MA: Harvard University Press, 1983), 7. 4 Edwin E. Moise , ―The Domino Theory – The 1960s: high...more-us-troops-in- afghanistan-than-iraq.html, (Accessed 3 December 2010). Moise , Edwin E., ―The Domino Theory – The 1960s: High Tide of the Domino

  20. Seek Balance, Connect with Others, and Reach All Students: High School Students Describe a Moral Imperative for Teachers

    Science.gov (United States)

    Whitney, Jean; Leonard, Maureen; Leonard, William; Camelio, Marilyn; Camelio, Vincent

    2006-01-01

    This article documents a collaborative, teacher inquiry process to uncover a diverse sample of 271 students from an urban high school reflect on teachers they admire and classes in which they feel the most comfortable. The findings indicate that the students described teachers in terms of who the teacher is as a person, the role that he or she…

  1. Association between levels of persistent organic pollutants in adipose tissue and cryptorchidism in early childhood

    DEFF Research Database (Denmark)

    Koskenniemi, Jaakko J; Virtanen, Helena E; Kiviranta, Hannu;

    2015-01-01

    chemical concentrations and the risk of cryptorchidism were analysed with logistic regression to get an estimate for odds ratio (OR) of cryptorchidism per multiplication of chemical concentrations with ca. 2.71 (Napier's constant). RESULTS: Total-TEq i.e. the WHO-recommended 2,3,7,8-TCDD equivalent...

  2. EST Table: DN237662 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DN237662 EST00788 10/09/29 89 %/271 aa ref|NP_001037309.1| vitellogenin precursor [...s: Precursor dbj|BAA02444.1| vitellogenin precursor [Bombyx mori] dbj|BAA06397.1| vitellogenin [Bombyx mori

  3. Tenure and forest income

    DEFF Research Database (Denmark)

    Jagger, Pamela; Luckert, Martin K.; Duchelle, Amy E.

    2014-01-01

    We explore the relationship between tenure and forest income in 271 villages throughout the tropics. We find that state-owned forests generate more forest income than private and community-owned forests both per household and per hectare. We explore whether forest income varies according to the e...

  4. Midway Atoll Site P20 12/6/2002 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 8 and 9 meters along a permanent transect.

  5. Comparison of individuals opting for BRCA1/2 or HNPCC genetic susceptibility testing with regard to coping, illness perceptions, illness experiences, family system characteristics and hereditary cancer distress

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Tibben, Aad

    2007-01-01

    Objective: To study differences between individuals opting for genetic cancer susceptibility testing of a known familial BRCA1/2 and HNPCC related germline mutation. Methods: Coping, illness perceptions, experiences with cancer in relatives and family system characteristics were assessed in 271 appl

  6. Improving Multi-Component Maintenance Acquisition with a Greedy Heuristic Local Algorithm

    Science.gov (United States)

    2013-04-01

    heuristic based on a genetic algorithm was applied in train maintenance scheduling problems by Sriskandarajah, Jardine , and Chan (1998), primarily...interdependent. OR Spectrum, 27(1), 63–84. Sriskandarajah, C., Jardine , A., & Chan, C. (1998). Maintenance scheduling of rolling stock using a genetic

  7. 77 FR 3224 - New Mexico: Incorporation by Reference of State Hazardous Waste Management Program

    Science.gov (United States)

    2012-01-23

    ...] [FR Doc No: 2012-998] ENVIRONMENTAL PROTECTION AGENCY 40 CFR Parts 271 and 272 [EPA-R06-RCRA-2011-0407...: Environmental Protection Agency (EPA). ACTION: Proposed rule. SUMMARY: The EPA proposes to codify in the...), Multimedia Planning and Permitting Division, EPA Region 6, 1445 Ross Avenue, Dallas, Texas 75202-2733,...

  8. An Energy-Based Thermodynamic Stabilization Framework for Hybrid Control Design of Large-Scale Aerospace Systems

    Science.gov (United States)

    2009-02-27

    parallelism makes it possible to effectively update a neural network on line. These properties make neural networks a viable paradigm for adaptive...Irreversibility, and the Entropic Arrow of Time: From Mechanics to System Thermodynamics," Nonlinear Analysis: Real World Applications, vol. 9, pp. 250-271, 2008

  9. Midway Atoll Site P20 12/6/2002 13-14M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 13 and 14 meters along a permanent transect.

  10. Dicty_cDB: Contig-U15651-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available J0-ahl-a-01-0-UI.r2 UI-E-EJ0 Homo sapiens c... 38 3.8 2 ( DQ108132 ) Aetomylaeus maculatus voucher BW-A272 c...ytochrome ... 46 3.8 1 ( DQ108131 ) Aetomylaeus maculatus voucher BW-A271 cytochrome ... 46 3.8 1 ( AL928980

  11. Midway Atoll Site P20 12/6/2002 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 47 and 48 meters along a permanent transect.

  12. Gclust Server: 61616 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 61616 HSA_89028372 Cluster Sequences - 271 XP_936227.1 PREDICTED: hypothetical prot...ein ; no annotation 2 1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 61616 Cluster ID 61616 Sequence ID HSA_89028372

  13. Incision Decisions.

    Science.gov (United States)

    Michener, Olivia H.; And Others

    1993-01-01

    Survey forms sent to a random sample of 5,271 school board members elicited responses from 1,096 (21 percent) board members. Lists the demographics of school board service, the specific budget cuts board members made last year, and choices they would make if further cuts were needed in the current budget. (MLF)

  14. EXPLORATION GEOCHEMISTRY

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    <正>20070497 Wang Shuangqing (National Research Center of Geoanalysis, Beijing 100037, China); Sun Weilin Review on Methodology in Oil and Gas Geochemical Exploration (Rock and Mineral Analysis, ISSN0254-5357, CN11-2131/TD, 24(4), 2005, p.271-276, 40 refs.) Key words: geochemical prospecting of oil and gas

  15. An endogenous growth model with embodied energy-saving technical change

    NARCIS (Netherlands)

    van Zon, A; Yetkiner, IH

    2003-01-01

    In this paper, we extend the Romer [Journal of Political Economy 98 (Part 2) (1990) S271] model in two ways. First we include energy consumption of intermediates. Second, intermediates become heterogeneous due to endogenous energy-saving technical change. We show that the resulting model can still g

  16. 77 FR 6682 - Marine Mammals; Subsistence Taking of Northern Fur Seals; Harvest Estimates

    Science.gov (United States)

    2012-02-09

    .... George. DATES: Effective March 12, 2012. FOR FURTHER INFORMATION CONTACT: Michael Williams, (907) 271-5117, email Michael.Williams@noaa.gov ; Kim Rivera, (907) 586-7424, email Kim.Rivera@noaa.gov ; or...: February 3, 2012. Alan D. Risenhoover, Acting Deputy Assistant Administrator for Regulatory...

  17. Data Acquisition System of FlashADC on GTAF Facility

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Qi-wei; HE; Guo-zhu; HUANG; Xing; RUAN; Xi-chao; ZHOU; Zu-ying; ZHU; Xing-hua

    2013-01-01

    The data acquisition system of GTAF facility bases on the digitizer of FlashADC(DC271A,made by Acqiris Technologies Inc.),which can achieve the acquisition of experimental data and real-time monitoring of on-line measure by the capture of digital full pulse waveform from 40 BaF2 detectors.Fig.1

  18. Tularemia: Current Diagnosis and Treatment Options

    Science.gov (United States)

    2008-04-01

    PCR-enzyme immunoassay : tul4  CFU for both assays Successful detection of F. tularensis in mouse tissue and ticks [90] Junhui et al. Three primers...Akalin H, Oral HB . Tularemia in Bursa, Turkey: 205 cases in 10 years. Eur. J. Epidemiol. 16, 271–276 (2000). 85 Feldman KA, Enscore RE, Lathrop

  19. Breast cancer

    Science.gov (United States)

    ... women: U.S. Preventive Services Task Force recommendation statement. Ann Intern Med . 2014;160:271-281. PMID: 24366376 www.ncbi. ... Cancer: U.S. Preventive Services Task Force recommendation statement. Ann Intern Med . [Epub ahead of print 12 January 2016] doi: ...

  20. 38 CFR 39.26 - Forms.

    Science.gov (United States)

    2010-07-01

    ... characteristics for construction and burial or to determine foundation requirements and utility service.... (a) Standard Form 271—Outlay Report and Request for Reimbursement for Construction Programs ER29MR04...—Assurances—Construction Programs. ER29MR04.006 ER29MR04.007 (Authority: 38 U.S.C. 501, 2408) (The Office...

  1. Autonomic innervation of the pancreas in diabetic and non-diabetic rats. A new view on intramural sympathetic structural organization

    NARCIS (Netherlands)

    Luiten, P.G.M.; Horst, G.J. ter; Steffens, A.B.

    1986-01-01

    Using histochemical and immunocytochemical methods the intramural neural tissue of the pancreas was investigated in non-diabetic and in alloxan-diabetic rats. It was demonstrated that the non-diabetic pancreas contains an average of 2.71 cells/mm3 tissue that react positive for activity of acetylcho

  2. A peptide-binding assay for the disease-associated HLA-DQ8 molecule

    DEFF Research Database (Denmark)

    Straumfors, A; Johansen, B H; Vartdal, F;

    1998-01-01

    . The Ha 255-271(Y) peptide bound to DQ8 in a pH-dependent fashion showing optimal binding around pH 5. The association kinetics were relatively slow and the resulting complexes were heat labile. The specificity of peptide binding to DQ8 was investigated in competitive inhibition experiments with a panel...

  3. Eco-biology of marine diatoms with emphasis on the influence of physico-chemical parameters

    Digital Repository Service at National Institute of Oceanography (India)

    Mitbavkar, S.

    in the Dutch Wadden Sea. Nether J Sea Res 15: 196-216 Connor MS, Edgar RK (1982) Selective grazing by the mud snail Ilyanassa obsoleta. Oecologia 53: 271-275 Corpe WA (1970) Attachment of marine bacteria to solid surfaces. In: Manley RS (ed) Adhesions...

  4. AcEST: BP914817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2 TCHPKRIVGIKMGNITATAMVKTLLHSQHSPSKLILVV 135 TC+P+R+VG+ + TLL H+P ILVV Sbjct: 240 TCYPERVVGV-------LNAINTLLS...R+VG+ + TLL H+P ILVV Sbjct: 241 TCYPERVVGV-------LNAINTLLSDSHAPFIFILVV 271 >sp|Q8RHI7|RPOC_FUSNN DNA-directe

  5. Department of the Navy Justification of Estimates for Fiscal Year 1984 Submitted to Congress January 1983. Operation & Maintenance, Navy. Book 3. Budget Activity 3: Intelligence & Communications. Budget Activity 8: Training, Medical & OGPA. Budget Activity 9: Administration & Assoc Acts. Budget Activity 10: Support to Other Nations.

    Science.gov (United States)

    1983-01-01

    1982 Budget Man Costs 5) Officer Retention$ 6) Enlisted Retention 1/ (116) (123) 7) Submarine Motivatio 2/ 79 42 UDT/SEAL 3/ 44 42 8) Officer/Enlisted...Costs 5) Officer Retention -7W ~ 4§ 4 6) Enlisted Retention 1/ 216 266 216 271 7) Submarine Motivatio 2/ 81 44 81 45 UDT/SEAL 3/ 44 43 44 44 8) Officer

  6. 15 CFR 200.100 - Statutory functions.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Statutory functions. 200.100 Section..., PROCEDURES, AND FEES § 200.100 Statutory functions. (a) The National Institute of Standards & Technology (NIST) has been assigned the following functions (15 U.S.C. 271 et seq.): (1) The custody,...

  7. The cardiovascular risk management for people living with HIV in Europe

    DEFF Research Database (Denmark)

    Shahmanesh, M; Schultze, A; Burns, F;

    2016-01-01

    hypertensive, 45.0% had high cholesterol, 47.4% were current smokers, and 27.1% were overweight. 1504 (17.2%) had a 5-year CV-risk of > 5%. Of 7258 individuals with a 5-year risk 5%, (6.53/100 person-years). These patients were more likely to be older, men, living in East...

  8. 75 FR 66735 - National Fire Protection Association (NFPA): Request for Comments on NFPA's Codes and Standards

    Science.gov (United States)

    2010-10-29

    .... NFPA 271 Standard Method of P Test for Heat and Visible Smoke Release Rates for Materials and Products... Thermal Barriers Used Over Foam Plastic Insulation. NFPA 285 Standard Fire Test P Method for Evaluation of... Structural Fire Protection Design. NFPA 560 Standard for the W Storage, Handling, and Use of Ethylene...

  9. Rating Delay and Rating Outcomes in Laboratory-Based Performance Evaluations.

    Science.gov (United States)

    1988-01-01

    1967). Genesis of Iopular but erroneous psychodiagnostic observations. Journal of Abnormal 6.j.. •%- 42 Psychology, 72, 193-204. Chapman, L...Chapman, J. (1969). Illusory correlation as an obstacle to the use of valid psychodiagnostic signs. Journal of Abnormal Psychology, 74, 271-280. Cline, V

  10. 77 FR 39716 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2012-07-05

    ... Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting Pursuant to section 10(d) of the Federal... clearly unwarranted invasion of personal privacy. Name of Committee: National Institute on Alcohol Abuse... Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for Scientists and Clinicians;...

  11. 76 FR 44597 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2011-07-26

    ... HUMAN SERVICES National Institutes of Health National Institute on Alcohol Abuse and Alcoholism; Notice... personal privacy. Name of Committee: National Institute on Alcohol Abuse and Alcoholism Special Emphasis... of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards...

  12. The Development and Application of Cellular Sensitivity Biomarkers for the Detection and Measurement of Toxic Effects in Normal and Malignant Cells From Patients Receiving High-Dose Meiphalan (L-PAM) With Autologous Peripheral Blood Progenitor Cell Rescue in the Treatment of Metastatic Breast Cancer.

    Science.gov (United States)

    1995-09-01

    The microgel alkaline electrophoresis assay was originated to detect and quantify single stranded DNA breaks and alkali labile damage in individual...Mutation Res., 271, 101-113. Tice, RR, (1995) The single cell gel/ comet assay: A microgel electrophoresis technique for detecting DNA damage and repair

  13. Optimization of the Co-Digestion of Catch Crops with Manure Using a Central Composite Design and Reactor Operation

    DEFF Research Database (Denmark)

    Molinuevo-Salces, Beatriz; Ahring, Birgitte Kiær; Uellendahl, Hinrich

    2015-01-01

    This study investigates the effect of catch crops as co-substrate on manure-based anaerobic digestion. Batch experiments were carried out for two catch crops, namely Italian ryegrass (IR) and oil seed radish (OSR), in co-digestion with manure. Methane yields in the range of 271–558 and 216–361 ml...

  14. Enhanced personal protection at the PS

    CERN Multimedia

    Samuel Morier Genoud

    2013-01-01

    Pictures 03, 06, 07 08 : Pierre Ninin, deputy group leader of GS-ASE and responsible for the installation of the new PS complex safety system, in front of a new access control system.Pictures 10, 12 ,13 : View of Building 271, the future control centre of the new PS complex safety system.

  15. The Effect of Coping Knowledge on Emergency Preparedness in Elementary School Students

    Science.gov (United States)

    Kim, Shin-Jeong; Kang, So-Ra; Lee, Seung-Hee; Kang, Kyung-Ah

    2014-01-01

    The purpose of this study was to examine the effect of coping knowledge for emergency preparedness in Korean elementary school students. A school-based coping education program was provided seven times to 271 fourth- and fifth-grade students in two urban schools by researchers with the school nurses. The Process Model of Stress and Coping and…

  16. Potential Effects of Winter Navigation on Movements of Large Land Mammals in Eastern Lake Superior and St. Mary’s River Area. 1980 - 1981 Supplemental Report. Great Lakes-St. Lawrence Seaway Navigation Season Extension Program

    Science.gov (United States)

    1982-08-01

    Monitoring Radio-collared Deer Movements of radio-collared deer were recorded by tracking from the ground (Marshall and Kupa 1963) and from an...661-663. Kuyt, E. 1962. Movements of young timber wolves in the Northwest Territories of Canada. J. Mammal. 43:270-271. Marshall, W. H., and J. J. Kupa

  17. The Impact of Marketing Actions on Relationship Quality in the Higher Education Sector in Jordan

    Science.gov (United States)

    Al-Alak, Basheer A. M.

    2006-01-01

    This field/analytical study examined the marketing actions (antecedents) and performance (consequences) of relationship quality in a higher education setting. To analyze data collected from a random sample of 271 undergraduate students at AL-Zaytoonah Private University of Jordan, the linear structural relationship (LISREL) model was used to…

  18. French Frigate Shoals Site P16 9/14/2001 45-46M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 45 and 46 meters along a permanent transect.

  19. Midway Atoll Site P20 12/6/2002 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P20 (28.271 N, 177.385 W), between 7 and 8 meters along a permanent transect.

  20. French Frigate Shoals Site P16 9/14/2001 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 38 and 39 meters along a permanent transect.

  1. 48 CFR 1371.107 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1371.107 Section 1371.107 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL... Performance. Insert clause 1352.271-76, Performance, in all solicitations and contracts for ship...

  2. French Frigate Shoals Site P16 9/14/2001 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P16 (23.857 N, 166.271 W), between 27 and 28 meters along a permanent transect.

  3. Data publication and dissemination of interactive keys under the open access model

    Science.gov (United States)

    The concepts of publication, citation and dissemination of interactive keys and other online keys are discussed and illustrated by a sample paper published in the present issue (doi: 10.3897/zookeys.21.271). The present model is based on previous experience with several existing examples of publishi...

  4. Fast-track surgery for bilateral total knee replacement

    DEFF Research Database (Denmark)

    Husted, H; Troelsen, A; Otte, K S;

    2011-01-01

    Bilateral simultaneous total knee replacement (TKR) has been considered by some to be associated with increased morbidity and mortality. Our study analysed the outcome of 150 consecutive, but selected, bilateral simultaneous TKRs and compared them with that of 271 unilateral TKRs in a standardised...

  5. An annotated catalog of the Iranian Pentatomoidea (Hemiptera: Heteroptera: Pentatomomorpha).

    Science.gov (United States)

    Ghahari, Hassan; Moulet, Pierre; Rider, David A

    2014-07-15

    Seven families of Pentatomoidea including Acanthosomatidae, Dinidoridae, Pentatomidae, Plataspididae, Scutelleridae, Thaumastellidae, and Thyreocoridae are discussed in this catalog. The Iranian fauna of Pentatomoidea (excl. Cydnidae) is represented by 99 genera and 271 species and subspecies. Elasmostethus interstinctus (Linnaeus, 1758) (Acanthosomatidae) and Derula flavoguttata Mulsant & Rey, 1856 (Pentatomidae) are new records for Iran. 

  6. Discrimination, Mastery, and Depressive Symptoms among African American Men

    Science.gov (United States)

    Watkins, Daphne C.; Hudson, Darrell L.; Caldwell, Cleopatra Howard; Siefert, Kristine; Jackson, James S.

    2011-01-01

    Purpose: This study examines the influence of discrimination and mastery on depressive symptoms for African American men at young (18-34), middle (35-54), and late (55+) adulthood. Method: Analyses are based on responses from 1,271 African American men from the National Survey of American Life (NSAL). Results: Discrimination was significantly…

  7. Bibliography of Testing and Evaluation Reference Material

    Science.gov (United States)

    1989-08-01

    1988. [Krus78] Kruszewski, G. 1978. "Software Reliability Modeling." In Proceedings NAVSEA SWS RMQ Seminar, * September, 271-296. ** [Kuhn82] Kuhn ...Concurrent Debugger." In MuTEAM: Distributed Multiprocessor Architecture and ECSP Concurrent Language. Technoprint, 61-87. Bologna. ** [Lato89] Latour , L...Krug88] Kruszewski G ....................................................... (Krus78J Kuhn W.W

  8. Eutectic phases in water-ice : an efficient medium for biopolymerization

    DEFF Research Database (Denmark)

    Monnard, Pierre-Alain; Dörr, Mark; Löffler, Philipp M. G.

    2011-01-01

    Earth and possibly on other icy planets. References Attwater, J, Wochner, A, Pinheiro, VB, Coulson, A and Holliger, P (2010) Nat. Commun., 1, 76. Kanavarioti, A, Monnard, P-A and Deamer, DW (2001) Astrobiology, 1, 271. Monnard, P-A, Kanavarioti, A and Deamer, DW (2003) J. Am. Chem. Soc., 125, 13734...

  9. 75 FR 41121 - Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes...

    Science.gov (United States)

    2010-07-15

    ... AGENCY 40 CFR Parts 257, 261, 264, 265, 268, 271 and 302 RIN 2050-AE81 Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes; Disposal of Coal Combustion Residuals From...), 3001, 3004, 3005, and 4004 of the Solid Waste Disposal Act of 1970, as amended by the...

  10. Privacy Preserving Service Discovery for Interoperability in Power to the Edge Approach

    Science.gov (United States)

    2011-06-01

    IEICE Technical Report vol. 109, No. 271, pp. 69-74 (2009) [4] S. Tsujii, H. Yamaguchi, A. Kitazawa, K. Kurosawa: “A method for voting protocols with...regards to privacy,” Technical report of IEICE , ISEC98, pp. 45-51 (1998) Appendix (Terminology) (1) Homomorphic Cryptosystem Homomoriphism is a

  11. French Frigate Shoals Site P13 10/31/2002 21-22M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P13 (23.271 N, 166.284W), between 21 and 22 meters along a permanent transect.

  12. Immunophenotyping reveals the diversity of human dental pulp mesenchymal stromal cells in vivo and their evolution upon in vitro amplification

    Directory of Open Access Journals (Sweden)

    Maxime DUCRET

    2016-11-01

    Full Text Available Mesenchymal stromal/stem cells (MSCs from human dental pulp (DP can be expanded in vitro for cell-based and regenerative dentistry therapeutic purposes. However, their heterogeneity may be a hurdle to the achievement of reproducible and predictable therapeutic outcomes. To get a better knowledge about this heterogeneity, we designed a flow cytometric strategy to analyze the phenotype of DP cells in vivo and upon in vitro expansion with stem cell markers. We focused on the CD31- cell population to exclude endothelial and leukocytic cells. Results showed that the in vivo CD31- DP cell population contained 1.4% of CD56+, 1.5% of CD146+, 2.4% of CD271+ and 6.3% of MSCA-1+ cells but very few Stro-1+ cells (≤1%. CD56+, CD146+, CD271+ and MSCA-1+ cell subpopulations expressed various levels of these markers. CD146+MSCA-1+, CD271+MSCA-1+ and CD146+CD271+ cells were the most abundant DP-MSC populations. Analysis of DP-MSCs expanded in vitro with a medicinal manufacturing approach showed that CD146 was expressed by about 50% of CD56+, CD271+, MSCA-1+ and Stro-1+ cells, and MSCA-1 by 15-30% of CD56+, CD146+, CD271+ and Stro-1+ cells. These ratios remained stable with passages. CD271 and Stro-1 were expressed by less than 1% of the expanded cell populations. Interestingly, the percentage of CD56+ cells strongly increased from P1 (25% to P4 (80% both in all sub-populations studied. CD146+CD56+, MSCA-1+CD56+ and CD146+MSCA-1+ cells were the most abundant DP-MSCs at the end of P4. These results established that DP-MSCs constitute a heterogeneous mixture of cells in pulp tissue in vivo and in culture, and that their phenotype is modified upon in vitro expansion. Further studies are needed to determine whether co-expression of specific MSC markers confers DP cells specific properties that could be used for the regeneration of human tissues, including the dental pulp, with standardized cell-based medicinal products.

  13. Active site of Zn2+-dependent sn-glycerol-1-phosphate dehydrogenase from Aeropyrum pernix K1

    Directory of Open Access Journals (Sweden)

    Jin-Suk Han

    2005-01-01

    Full Text Available The enzyme sn-glycerol-1-phosphate dehydrogenase (Gro1PDH, EC 1.1.1.261 is key to the formation of the enantiomeric configuration of the glycerophosphate backbone (sn-glycerol-1-phosphate of archaeal ether lipids. This enzyme catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate. To date, no information about the active site and catalytic mechanism of this enzyme has been reported. Using the sequence and structural information for glycerol dehydrogenase, we constructed six mutants (D144N, D144A, D191N, H271A, H287A and D191N/H271A of Gro1PDH from Aeropyrum pernix K1 and examined their characteristics to clarify the active site of this enzyme. The enzyme was found to be a zinc-dependent metalloenzyme, containing one zinc ion for every monomer protein that was essential for activity. Site-directed mutagenesis of D144 increased the activity of the enzyme. Mutants D144N and D144A exhibited low affinity for the substrates and higher activity than the wild type, but their affinity for the zinc ion was the same as that of the wild type. Mutants D191N, H271A and H287A had a low affinity for the zinc ion and a low activity compared with the wild type. The double mutation, D191N/ H271A, had no enzyme activity and bound no zinc. From these results, it was clarified that residues D191, H271 and H287 participate in the catalytic activity of the enzyme by binding the zinc ion, and that D144 has an effect on substrate binding. The structure of the active site of Gro1PDH from A. pernix K1 seems to be similar to that of glycerol dehydrogenase, despite the differences in substrate specificity and biological role.

  14. Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

    Science.gov (United States)

    Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

    2015-06-01

    Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change.

  15. Speed of mental addition in an abacus expert, estimated by eye movements and neural activities.

    Science.gov (United States)

    Hamada, Takashi; Iwaki, Sunao

    2012-08-01

    A grand expert of abacus looked at a display on which three-digit numbers were aligned vertically with constant spacing, for sequentially adding the numbers mentally. His eye regularly moved downward by alternating a fixation to one of the numbers with a saccade to another below it, with the average period of the alternations at 271 msec. His magnetoencephalogram averaged with respect to start of the fixations revealed activity in the right superior parietal cortex. This finding not only supported the previous view that abacus experts mentally calculate by manipulating spatial representations of numbers, but also showed that the calculation was synchronized with the periodic eye movements. Thus, each process of the mental sequential addition, which starts with visual recognition of an addend, was estimated to require less than 271 msec. on average.

  16. Dicty_cDB: FC-IC1367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1367 (Link to dictyBase) - - - - FC-IC1367E (Link to Original site) FC-IC... to library) Clone ID FC-IC1367 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Ori...cytoskeletal 8.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> prediction for FC-IC1367 i...1367F 271 FC-IC1367Z 271 FC-IC1367P 522 FC-IC1367E 261 Show FC-IC1367 Library FC-IC (Link...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1367Q.Seq.d/ Rep

  17. 双蛋白干酪发酵剂的筛选及发酵特性研究%Selection and fermentation characteristics of double-protein cheese starters

    Institute of Scientific and Technical Information of China (English)

    李丽; 宗绪岩; 张莉; 杨贞耐

    2012-01-01

    In order to study the ferment characteristics of milk or soy milk, studied on fermentation characteristics of six lactic acid bacteria including of acid, pH, content of extracellular polysaccharide, viscosity, free amino nitrogen, diacetyl production, the results show that: in the milk, XZ3303 was the strongest acid, QH27-1 had the highest titratable acidity; in the soymilk, QH 48-3-2 had highest titratable acidity, and acidity in soymilk was significantly higher than in milk. Viscosity in soymilk are significantly higher than in milk, and viscosity curve had double increasing trend in soy milk. XZ3303, XZ10303, QH27-1, QH48-3-2 fermented milk produced more content of diacetyl ability; extracellular polysaccharides production of XZ3303 and QH27-1 of was significantly higher than other strains. By combining physical and chemical and sensory analysis, chosed L.Lactis subsp. Cremoris QH27-1 and L.Lactis subsp. Lactis XZ3303 for double protein cheese starters.%为了研究不同发酵剂对牛乳或豆乳的发酵特性,对6株乳酸菌在发酵过程中的酸度、pH、胞外多糖、黏度、游离氨基氮、双乙酰等指标进行了测定。结果表明:在牛乳中,XZ3303的产酸能力最强,QH27-1滴定酸度最高;在豆乳中,QH48-3-2滴定酸度最高,并且在豆乳中的酸度明显高于牛乳。乳酸菌在豆乳中的黏度值都明显高于牛乳,并且豆乳中的黏度变化曲线有二次产黏的现象,有利于发酵乳口感的改善。XZ3303、XZ10303、QH27-1、QH48-3-2发酵乳产双乙酰能力较强;XZ3303和QH27-1产胞外多糖的能力明显高于其他菌株。通过感官分析并结合理化指标综合考虑,选择了在豆乳和牛乳中都能优势生长的L.Lactis subsp.Cremoris QH27-1和L.Lactis subsp.Lactis XZ33032株乳酸菌作为制作双蛋白干酪的发酵剂。

  18. 按摩治疗腰椎间盘突出症疗效体会%Experience for treating lumbar disc herniation by massage

    Institute of Scientific and Technical Information of China (English)

    周光跃

    2014-01-01

    Lumbar disc herniation was common in clinical orthopedics. In this article, 271 patients with lumbar disc herniation were treated by massage, the total efficacy was 97%. Massage on lumbar disc herniation can relieve pain and restore limb function.%腰椎间盘突出症是临床骨伤科常见的疑难病之一。本文选取271例腰椎间盘突出患者行按摩治疗,总有效率97%,效果较好。按摩治疗腰椎间盘突出症可缓解疼痛,恢复肢体功能。

  19. Clinical research on mycoplasma pneumoniae complicated with digestive system damage in children%小儿肺炎支原体感染并发消化系统损害临床分析

    Institute of Scientific and Technical Information of China (English)

    韦秋玲

    2016-01-01

    目的:总结小儿肺炎支原体感染并发消化系统损害的临床表现。方法对271例肺炎支原体感染患儿的临床资料进行回顾性分析。结果271例肺炎支原体感染患儿中肺外损害检出率为52.77%(143/271),其中消化系统损害检出率为34.69%(94/271),占肺外损害的65.73%(94/143)。男性并发消化系统损害的检出率(33.80%)与女性(35.66%)之间差异无统计学意义(χ2=0.103,P=0.748)。婴幼儿组消化系统损害检出率(47.27%)高于儿童组(31.48%),差异有统计学意义(χ2=4.825,P=0.028)。婴幼儿组的临床表现以纳差、恶心、呕吐症状为主,儿童组以腹胀、腹痛症状为主。儿童组的血清转氨酶、血总胆红素、血淀粉酶、尿淀粉酶、腹部超声、腹部X线及腹部CT等异常检出率高于婴幼儿组,差异有统计学意义( P<0.05)。结论小儿肺炎支原体感染常并发消化系统损害,需积极预防和有效干预。%Objective To explore the clinical manifestations in children with mycoplasma pneumoniae com -plicated with the digestive system damage .Methods The clinical data of 271 children with mycoplasma pneumoniae were retrospectively studied .Results The rate of extrapulmonary organ damages in 271 children with mycoplasma pneumoniae was 52.77%(143/271), among which, the rate of the digestive system damage organ was 34.69%(94/271), accounting for 65.73%(94/143) of the extrapulmonary organ damages .There were no significant differences in concurrent digestive system organ damages between the male children ( 33.80%) and the female children (35.66%)(χ2 =0.103, P=0.748).The rate of digestive system organ damages of the infants (47.27%) was high-er than that of the children subgroup (31.48%), significantly(χ2 =4.825, P=0.028).The clinical manifestations of the infant subgroup were characterized with anorexia , nausea, and

  20. Smoking outcome by psychiatric history after behavioral and varenicline treatment.

    Science.gov (United States)

    McClure, Jennifer B; Swan, Gary E; Catz, Sheryl L; Jack, Lisa; Javitz, Harold; McAfee, Tim; Deprey, Mona; Richards, Julie; Zbikowski, Susan M

    2010-06-01

    Treatment outcomes were compared across smokers enrolled in the COMPASS cessation trial with (positive psychiatric history [PH+], n = 271) and without (PH-, n = 271) a diagnosis of PH based on medical record evidence of anxiety, depression, psychotic disorder, or bipolar disorder. Everyone received behavioral counseling plus varenicline and was followed for 6 months post quit date. PH+ smokers took varenicline for fewer days on average (59.4 vs. 68.5, p < or = .01) but did not differ in their use of behavioral treatment. PH+ smokers were more likely to report anxiety and depression, but side-effect intensity ratings did not differ after adjusting for multiple comparisons. Overall, all side effects were rated as moderate intensity or less. Groups had similar 30-day abstinence rates at 6 months (31.5% PH+ vs. 35.4% PH-, p = .35). In sum, having a psychiatric diagnosis in this trial did not predict worse treatment outcome or worse treatment side effects.

  1. The use of multiparameter flow cytometry and cell sorting to characterize native human bone marrow mesenchymal stem cells (MSC).

    Science.gov (United States)

    Boxall, Sally; Jones, Elena

    2015-01-01

    This chapter describes a method for identification, phenotypic analysis, and cell sorting of rare mesenchymal stem cells (MSCs) from human bone marrow (BM) aspirates. The native BM MSC population is identified based on the CD45(-/low)CD271(+) phenotype. The method consists of three related procedures: Procedure 1 involves a microbead-based pre-enrichment step. Two other procedures describe direct flow cytometric analysis of MSCs following the isolation of the mononuclear cell (MNC) fraction (Procedure 2) or more rapidly, following a simple ammonium chloride-based red cell lysis (Procedure 3). Recently described multi-lineage transcript expression in the CD45(-/low)CD271(+) cells suggests that the native BM MSC fraction could be further subdivided into functionally distinct subpopulations. The present protocols are hoped to help MSC biologists to enter this exciting field of research and to take it forward towards a better understanding of MSC biology in vivo.

  2. A survey of Radio Recombination Lines using Ooty Radio Telescope at 328 MHz in the Inner Galaxy

    CERN Document Server

    Baddi, Raju

    2012-01-01

    A survey of radio recombination lines in the Galactic plane with longitude $-32^o < l < +80^o$ and latitude $b<\\pm3^o$ using Ooty Radio Telescope(ORT) at 328 MHz has been reported. ORT observations were made using a New Digital Backend(NDB) augmented to it recently. With NDB ORT had a beam of $2^o.3 \\times 2^o.2 sec(\\delta)$ and a passband of $\\sim$1 MHz in the spectral line mode. The above mentioned Galactic region was divided into $\\sim 2^o \\times 2^o$ patches with the ORT beam pointed to the center. The ORT observations form a study of distribution of extended low-density warm-ionized medium(ELDWIM) in the inner Galaxy using H271$\\alpha$ RL. By obtaining kinematical distances using $V_{LSR}$ of the H271$\\alpha$ RLs the distribution of ELDWIM clouds within the inner Galaxy has been deduced for the region given above.

  3. Behavioral and Biological Effects of Housing Conditions and Stress in Male Rats - Relevance to Heart Disease

    Science.gov (United States)

    2006-08-01

    index anxiety in rodent research (Elliott, Faraday, Phillips, & Grunberg, 2004; Pellow, Chopin , File, & Briley, 1985; Hogg, 1996; Kalinichev et al...conduct and typically takes 5 minutes to complete. A variety of species have been used in the elevated plus maze, including rats (Pellow, Chopin , File...Research, 94(271-280). 74 Pellow, S., Chopin , P., File, S. E., & Briley, M. (1985). Validation of open:Closed arm entries in an elevated plus-maze as a

  4. The Behavioral Effects of Environmental Enrichment in Rats

    Science.gov (United States)

    2007-11-02

    the adolescent subject. Elevated Plus Maze (EPM) Elevated Plus Maze is widely used as an index of anxiety in rodent research (Pellow, Chopin ...complete. A variety of species have been used in the Elevated Plus Maze, including rats (Pellow, Chopin , File, & Briley, 1985), mice (Lister, 1987...271-280. 111 Pellow, S., Chopin , P., File, S.E., & Briley, M. (1985). Validation of open:closed arm entries in an elevated plus-maze as a

  5. Proceedings of the National Conference on Ada (trade mark) Technology (6th) Held on 14-18 March 1988 in Arlington, VA.

    Science.gov (United States)

    1988-03-01

    requiring the mized for art individual task or set of tasks, they redes ign of the leal-cells themselves (Mead and also present inherent... Informatica , Vol. 1, 1972, pp. 271-281. An Ada-based specification and design language, SEDL. is proposed that supports the development, recording, 4. Software...10. C. A. R. Hoare, "Proof of Correctness of Data Representation," Acta Informatica 1 (1972). 11. R. B. K. Dewar, E. Schonberg, J. T. Schwartz & E

  6. An evaluation of molecular and clinical remission in rheumatoid arthritis by assessing radiographic progression

    OpenAIRE

    2013-01-01

    Objectives. To determine whether molecular remission defined by a multi-biomarker disease activity (MBDA) score predicts a reduced risk of joint damage progression, and whether the MBDA score can augment existing classifications of remission. Methods. The study examined 271 visits for 163 RA patients in the Leiden Early Arthritis Cohort. The MBDA score and other variables from each visit were evaluated for prediction of progression [change in Sharp–van der Heijde Score (ΔSHS) >3] over the ens...

  7. Qualitative and quantitative assessment and management of hospital waste in Zanjan, Iran in 2011

    Directory of Open Access Journals (Sweden)

    Mahran Mohammadian Fazli

    2013-05-01

    Conclusion: Waste generation rate in the hospitals of Zanjan was lower compared with the expected average value in other cities (e.g. 2.71 Kg/bed.day in Tehran. The percentage of medical waste in Zanjan hospitals was 34, which is higher than W.H.O. recommendations. Therefore, it is strongly recommended to reform and monitor certain solid waste management practices in order to reduce health and environmental issues.

  8. Cruz y raya en los libros: Junio de 1967

    Directory of Open Access Journals (Sweden)

    Ernesto Cortés Ahumada

    1967-06-01

    Full Text Available STOKES, Sewell. Mas allá del Bien y del Mal; basada en la vida de Oscar Wilde. Buenos Aires, Kraft, 1965 271 p. He aquí una novela que no es una biografía, y he aquí, igualmente una biografía que no es una novela. Es decir, a una especie de centauro literario, cuyo caballo no corresponde rigurosamente a la especie equina, porque tiene una parte humana. Y viceversa.

  9. A study on Factors Affecting Application of Information and Communication Technology (ICT) by Faculty Members of

    OpenAIRE

    Elham Biglari; Hossein Agahi

    2010-01-01

    This paper is an attempt to investigate the factors affecting on ICT application by faculty members of University of Razi. A descriptive-correlative research survey method was used. The statistical population of this research consist of faculty members of University of Kermanshah (N=271). Sampling method was stratified randomization (n=116). Questionnaire was used for data collection, the validity of which was confirmed by the opinions of some of professionals and faculty members of Agricultu...

  10. Shock Testing the SEAWOLF Submarine, Final Environmental Impact Statement

    Science.gov (United States)

    1998-05-01

    the common fin whale (Balaenoptera physalis ): Crassicaudiosis of the urinary system. Journal of Mammalogy. 67(2):353-366. Lazell, J.D. 1980...Balaenoptera physalis ) and humpback whale (Megaptera novaeangliae) on the American sand lance (Ammodytes americanus) in the northwest Atlantic... physalis ) in Massachusetts Bay. Fishery Bull. 88(2):271-278. Shaver, D.J. 1991. Feeding ecology of wild and head-started Kemp’s ridley sea turtles in

  11. Operation Brain Trauma Therapy

    Science.gov (United States)

    2013-10-01

    investigators. This included resveratrol , N-acetylcysteine, necrostatin, INO-1001, glibenclamide, AER 271, edaravone, melatonin, fluoxetine, amphetamine...significantly ameliorates cortical damage following traumatic brain injury. Exp Neurol. 2000;161:631-637. 34. Sullivan PG, Rabchevsky AG , Hicks RR, et al...Berges L. Dependency of cyclosporine tissue distribution and metabolism on the age and gender of rats after a single intravenous dose. Internat J

  12. Assessment and Correlation of Customer and Rater Response to Cold-Start and Warmup Driveability

    Science.gov (United States)

    1993-08-01

    Satisfcation Versus Fuel Volatility Level- TWD Vehicles ............................................... 9 XIII. Comparison of Customer and Rater Results...AD-A271 775 CRC Report No. 585 ASSESSMENT AND CORRELATION OF CUSTOMER AND RATER RESPONSE TO COLD-START AND WARMUP DRIVEABILITY -bA A K-70-&q _C -oo0...404) 396-3404 Society of Automotive Engineers, Inc. ASSESSMENT AND CORRELATION OF CUSTOMER AND RATER RESPONSE TO COLD-START AND WARMUP DRIVEABILITY

  13. A Continuum Mechanical Approach to Geodesics in Shape Space

    Science.gov (United States)

    2010-01-01

    A CONTINUUM MECHANICAL APPROACH TO GEODESICS IN SHAPE SPACE By Benedikt Wirth Leah Bar Martin Rumpf and Guillermo Sapiro IMA Preprint Series # 2295...Benedikt Wirth† Leah Bar‡ Martin Rumpf† Guillermo Sapiro‡ †Institute for Numerical Simulation, University of Bonn, Germany ‡Department of Electrical and...mean curvature flow equation. Calc. Var., 3:253–271, 1995. [30] Siddharth Manay, Daniel Cremers , Byung-Woo Hong, Anthony J. Yezzi, and Stefano Soatto

  14. Assessing Performance Outcomes of New Graduates Utilizing Simulation in a Military Transition Program

    Science.gov (United States)

    2013-01-01

    reproduction of this article is prohibited. Jeffries, P. R. (2007). Simulation in nursing education . New York, NY: National League for Nursing. Kardong...Application of Benner’s theory in an interactive patient care simulation. Nursing Education Perspectives, 27(1), 16Y22. Leigh, G. (2011). The simulation...Applying theoretical frameworks to simulation in nursing education . International Journal of Nursing Education Scholarship, 4(1), 1Y14. 148

  15. DIAMETER SERAT DAN PANJANG SARKOMER DAGING SAPI BALI HASIL PENGGEMUKAN MENGGUNAKAN PAKAN DENGAN LEVEL KULIT BIJI KAKAO DAN OTOT BERBEDA

    OpenAIRE

    2015-01-01

    2015 NUR AMALIA (I111 11 271). Diameter Serat dan Panjang Sarkomer Daging Sapi Bali Hasil Penggemukan Menggunakan Pakan dengan Level Kulit Biji Kakao dan Otot Berbeda. Dibawah bimbingan Hikmah M. Ali sebagai pembimbing utama, dan Ratmawati Malaka sebagai pembimbing anggota. Penelitian ini bertujuan untuk mengetahui pengaruh jenis otot, level kulit biji kakao dalam pakan, dan interaksi keduanya terhadap panjang sarkomer dan diameter serat daging sapi Bali. Penelitian ini ...

  16. The Role of Isolation in Radicalization: How Important Is It?

    Science.gov (United States)

    2013-12-01

    York: Prometheus Books, 1996), (Kindle ed.), 643. 138 Michel, Herbeck and Telles, American Terrorist, 21. 139 Ibid., 25. 40...1972. Shafik came to the United States on a visa to study medicine in southern Alabama. Southern Alabama’s historically conservative culture appealed to...degree in medicine . One day, he disenrolled from the university.271 Around the same time, Hammami travelled back to Syria with his father to meet his

  17. The LHC

    CERN Multimedia

    2002-01-01

    The LHC will use the latest technologies on an enormous scale. 8000 superconducting magnets will keep the beams on track. The entire 27 km ring will be cooled by 700 000 litres of liquid helium to a temperature of -271 degrees Celsius , making the LHC the world's largest superconducting installation. Conventional superconducting wire will form the magnet coils, while high-temperature superconductors will carry a total of 2 300 000 amperes from the power supplies into the magnet cryostat

  18. Production of Antigens and Antibodies for Diagnosis of Arbovirus Diseases

    Science.gov (United States)

    1994-05-20

    ISS Phl-3 Vlsm2 7 314 VS-Indiana Indiana Lab sm9 5 271 VS-New Jersey Hazelhurst CEl8V4sml 4 364 Zika prototype smlSi 11 501 5 Additionally, 8 viruses...A no- cost extension was negotiated and another Associate in Research has been recruited to start in the next contract period. Emphasis will be on

  19. A Strategic Planning Framework for Predicting and Evaluating Soviet Interests in Arms Control. Volume 1

    Science.gov (United States)

    1988-08-01

    edited by Raymond Dennett and Joseph E. Johnson, Negotiating With the Russians, (Boston: World Peace Foundation, 1951). A useful summary of the Western...271-303. 35 Frekeric:k Osborn, "Negotiating on Atonic Energy, 1946-1947," in Dennett and Johnson, NegotiatinQ With the Pussians, pn. 234-235. - 43...Alamos, New Mexico 87545 - 109 - 10. Professor Don Daniel 101 Fischer Circle Portsmouth, RI 02871 11. Dr. William C. Green Center for International

  20. The Response of Monterey Bay to the Great Tohoku Earthquake of 2011

    Science.gov (United States)

    2011-01-01

    Loma Prieta earthquake and the 1964 Great Alaskan Earthquake. Science of Tsunami Hazards, 28, 255-271. Camfield, F.E. (1980), Tsunami Engineering...the amplitude of the tsunami at 1 km from the source assuming cylindrical spreading and thus the effects of refraction have not been taken into...primary signal, errors accrued because the effects of refraction were not taken into account, or that the empirical relation used to obtain the first

  1. Clinical Investigation Program: Annual Progress Report

    Science.gov (United States)

    1992-09-30

    Failure ....... 82 90/124 C The Effectiveness of Octreotide (Sandostatin*) to Prevent Pancreatitis Caused by Endoscopic Pancreacto- Biliary Procedures: A...203 T Cryoprecipitate in the Treatment of Seroma . 275 92/204 0 Effect of Intravenous Erythromycin on Post- Operative Ileus ...JE: Cutaneous sarcoidal granulo- mas in a patient with primary biliary cirrhosis. Cutis 49:271- 274, 1992. Homas PB, David-Bajar KM, Fitzpatrick JE

  2. Natural product antifoulants from the octocorals of Indian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V; LimnaMol, V.P.; Parameswaran, P.S.

    1 Author version: International Biodeterioration & Biodegradation, vol.65(1); 2011; 265-268 Natural Product Antifoulants from the Octocorals of Indian waters T.V. Raveendran * , V.P. Limna Mol, P.S. Parameswaran National Institute... the red alga Delisea pulchra in antifouling assays. Biofouling 8, 259–271. 12. Devi, P., Jayasree, V., Naik, C.G., Parameswaran, P.S., Raveendran, T.V., Kamat, S.Y. 1998. Antifouling activity of Indian marine invertebrates against the green mussel...

  3. Genome sequence and description of Actinomyces polynesiensis str. MS2 sp. nov. isolated from the human gut.

    Science.gov (United States)

    Cimmino, T; Metidji, S; Labas, N; Le Page, S; Musso, D; Raoult, D; Rolain, J-M

    2016-07-01

    Actinomyces polynesiensis strain MS2 gen. nov., sp. nov. is a newly proposed genus within the family Actinomycetaceae, isolated from the stools of a healthy individual in Raiatea Island (French Polynesia, South Pacific). Actinomyces massiliensis is an anaerobic, Gram-positive organism. Here we describe the features of this organism, together with the complete genome sequence and annotation-2 943 271 bp with a 70.80% G+C content, assembled into 15 scaffolds and containing 2080 genes.

  4. Spatial distribution of the nematodes in the subtidal community of the Central West Coast of India with emphasis on Tershellingia longicaudata (Nematoda: Linhomoeidae)

    Digital Repository Service at National Institute of Oceanography (India)

    Nanajkar, M.; Ingole, B.S.; Chatterjee, T.

    diverse and numerically dominant metazoans in the marine habitat (Heip et al. 1982; De Ley and Blaxter 2001), with a global species estimate (Lambshead and Boucher 2003) between 10 5 and 10 8 . Despite their remarkable diversity and their potential use..., laboratory and mesocosm studies. Oceanography and Marine Biology Annual Review. 30:191-271. Danovaro R. 1996. Detritus-bacteria-meiofauna interactions in a seagrass bed (Posidonia oceanica) of the NW Mediterranean. Marine Biology. 127:1-13. De Ley P...

  5. An Investigation of Sensory Information, Levels of Automation, and Piloting Experience on Unmanned Aircraft Pilot Performance

    Science.gov (United States)

    2012-03-01

    flight.parameters.that.are.not.monitored.constantly.(e .g .,. Kantowitz .&.Sorkin,.1983) . In.addition.to.its.effect.on.responses.to.system.failures...mental workload,.North- Holland,.Amsterdam,.The.Netherlands:.Elsevier. Science.Publications . Kantowitz ,.B .H ..&.Sorkin,.R .D ..(1983) ..Auditory.and...tactile.displays ..In.B .H .. Kantowitz .&.R .D ..Sorkin. (Eds .),.Human factors: Understanding people-system relationships.(pp ..232-271) ..New.York

  6. Short Range 10 Gb/s THz Communications. Proof of Concept Phase 2

    Science.gov (United States)

    2011-12-01

    GHz. After optical amplification using an EDFA , the combined optical heterodyne signal was modulated with a 27-1 PRBS data pattern using on-off...keying (OOK) at 1 Gb/s in a Mach- Zehnder electro-optic modulator. The resulting signal was re-amplified using a further EDFA and input to a packaged...distributed feedback DSB double sideband ECL external cavity laser EDFA erbium-doped fibre amplifier Gb/s giga bits per second IF

  7. AcEST: DK960436 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ....................done Score E Sequences producing significant alignments: (bits) Value sp|P49200|RS201_AR...Length = 124 Score = 207 bits (526), Expect = 4e-53 Identities = 103/123 (83%), P...CTDLVRGAKDKRLRVKGPVRM 61 Query: 271 PTKVLHITTRKSPCGEGTNTWDRFELRVHKRVIDLLSSSEVVKQITSITS...EPGVEVEVTI 450 PTKVL ITTRK+PCGEGTNTWDRFELRVHKRVIDL SS +VVKQITSIT EPGVEVEVTI Sbjct: 62 PTKVLKITTRKAPCGEG...TNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTI 121 Query: 451 ADS 459 ADS Sbjct: 122 ADS 124 >sp|P35686|RS20_OR

  8. Analysis of SEDL gene mutation in a Chinese pedigree with X-linked spondyloepiphyseal dysplasia tarda%X连锁迟发性脊椎骨骺发育不良SEDL基因突变的分析

    Institute of Scientific and Technical Information of China (English)

    李娟; 柴晓静; 陆莉; 朱江; 杜晓云; 赵丽

    2014-01-01

    目的 研究一个X-连锁迟发性脊椎骨骺发育不良(spondyloepiphyseal dysplasia tarda,SEDT)家系发病的分子遗传学机制,为其家系成员建立遗传咨询和产前诊断的方法.方法 应用PCR扩增及DNA测序分析方法,对1家系包括3例SEDT患者在内的7名家系成员SEDL基因的全部编码外显子及其邻近序列进行突变分析.结果 在3例SEDT患者及2例携带者中发现了致病突变,并经DNA序列分析证实,SEDL基因第5外显子发生移码突变c.267_271delAAGAC.结论 SEDL第5外显子的c.267_271delAAGAC突变为该家系的致病原因.%Objective To explore the molecular mechanism for a family with hereditary X-linked spondyloepiphysealdysplasia tarda (SEDT).Methods For 3 affected males and 2 obligate carrier females from the family,exons 3 to 6 of SEDL gene were amplified with PCR and sequenced.Results In the three patients,a deletional mutation (c.267_271delAAGAC) in exon 5 has been identified,which has caused frameshift of the protein product.Conclusion c.267_271delAAGAC frameshift mutation of the exon 5 of the SEDL gene probably underlies the disease in this family.

  9. Entanglement Purification with Higher Error Threshold for Imperfection of Local Operations and Bell State Measurements

    Institute of Scientific and Technical Information of China (English)

    SONG Xin-Guo; FENG Xun-Li

    2005-01-01

    @@ We analyse further the entanglement purification protocol proposed by Feng et al. [Phys. Lett. A 271 (2000) 44] in the case of imperfect local operations and measurements. It is found that this protocol allows of higher error threshold. Compared with the standard entanglement purification proposed by Bennett et al. [Phys. Rev.Lett. 76 (1996) 722], it turns out that this protocol is remarkably robust against the influences of imperfect localoperations and measurements.

  10. A Study of the Less-Developed-Countries Debt Crisis in Mexico and Subsequent Economic Policies

    Science.gov (United States)

    2012-09-01

    means to assess and measure risk, consolidated balance sheets, and income statements for financial groups.271 These measures were all designed to...funds that the Mexico financial sector owed private and corporate lenders .335 The initial capitalization program was made available to banks that...AVAILABILITY STATEMENT Approved for public release; distribution is unlimited 12b. DISTRIBUTION CODE A 13. ABSTRACT (maximum 200 words) On 11

  11. Engineering of Specific Tissue Inhibitors to Block ADAM Type Metalloprotease-Mediated Mammary Neoplasia

    Science.gov (United States)

    2001-07-01

    ADAM9 cleaves the HB- EGF when PKCd is activated, but neither the wildtype, nor the dominant-negative ADAM9, affects the EGFR transactivation (Izumi et...S. V. Subramanian, M. L. Fitzgerald, M. Bernfield, J. Bi- that accounts for these observations re- not other TIMPs, induce apoptosis (19). e!. Chem...12. D. Pan and G. M. Rubin, Cell90, 271 (1997). fy the cytoplasmic domains of the pro- and induces apoptosis by binding to the Fas 13. C. Cho et a

  12. Feasibility of Using Individual Differences in Emotionality as Predictors of Job Performance

    Science.gov (United States)

    1998-05-01

    DIRECTORATE Cognition and Performance Division 7909 Lindbergh Drive Brooks Air Force Base, TX 78235-5352 19980526 153 Walter Driskill Metrica , Inc...Univ of Minnesota Metrica , Inc. 110 First Avenue, N.E., #706 271 19th Avenue South 10010 San Pedro...Emotionality 26 IV PREFACE This literature review was performed under contract number F33615-91-D-0010, task number 0008 awarded to Metrica , Incorporated

  13. Space Based Infrared System High (SBIRS High)

    Science.gov (United States)

    2015-12-01

    Aviation Blvd Bldg 271 Los Angeles Air Force Base (LAAFB) El Segundo, CA 90245-2808 michael.guetlein@us.af.mil Phone: 310-653-3018 Fax: 310-653-4414 DSN...mission areas: Missile Warning , Missile Defense, Technical Intelligence and Battlespace Awareness. The constellation architecture for SBIRS High...Integrated Tactical Warning /Attack Assessment (ITW/AA) mission in November 2008 and technical intelligence mission in August 2009. The SBIRS GEO 1

  14. Endogenous 6-Hydroxymelatonin Excretion and Subsequent Risk of Breast Cancer: A Prospective Study

    Science.gov (United States)

    2005-03-01

    Epidemiologia e Prevenzione 46:359-363; 1991. Bojkowski CJ. Arendt J. Shih MC. Markey SP. Melatonin secretion in humans assessed by measuring its...expected cases in a dynamic cohort. Epidemiologia e Prevenzione. 18(60): 164-9; 1994. Muti P, Celentano E, Panico S, Berrino F. Measurement of cutaneous...Epidemiol Biomarkers Prey 2005;14(1):271-4) Introduction There is increasing evidence that obesity and diabetes mellitus measurement of markers of

  15. Ohio River Environmental Assessment Cultural Resources Reconnaissance Technical Report for the State of Kentucky Portion,

    Science.gov (United States)

    1977-09-15

    Pusey, William Allen 124. 1921 The Wilderness Road to Kentuck: Its Location and Features. George H. Owen. New York. Putman , Frederick Ward 125. 1875...102. New York. Putman , Frederick Ward 271. 1875 Archaeological Exploration in Kentucky and Indiana. American Naturalist, 9:410-415. Salem. 272. 1875...34Memorandum Relative To Gen. James Taylor Mansion In Newport, Ky." The Christopher Gist Historical Society, Newport. Turner, Justin G., and Linda Levitt Turner

  16. Catalytic Properties of Surfaces Sites on Metal Oxides and Their Characterization by X-Ray Photoelectron Spectroscopy

    Science.gov (United States)

    1974-01-01

    initial rates reported by Dalla Betta using a recirculatin batch reactor suggest the importance of careful characterization of the surface and...York, 4, 271 (1952). M. A. Vannice, to be published in J. Catal. R. A. Dalla Betta , A. G. Piken, and M. Shelef, J. Catal...T. A. Egerton, F. S. Stone, and J. C. Vickerman, J. of Catal., 38, 4(1974)299-306. 31. R. A. Dalla Betta , J. of Catal. , 34

  17. A Guide to the Computerized Medical Data Resources of the Naval Health Research Center.

    Science.gov (United States)

    1987-04-09

    Hereditary Ataxia Q6+ 01 1 Other Hereditary Familial Dis Nerv System 317 01 Multiple Sclerosis 318 (1 06 Other [rmyelinatinq Diseases of Central Nervous...1973. This variable refers to common ethnic characteristics and cultural heritage ; this information is provided by the member. Ethnic group includes the...M"A AnJAP! contained in multiple subfiles can be linked through the social security number, if necessary. 271 Section III Analytical Support

  18. Kinetic Metallization. Repair of IVD Al Coatings and Mg Alloys Aircraft Components Using Portable Kinetic Metallization Systems

    Science.gov (United States)

    2008-02-27

    person shall be subject to a penalty for failing to comply with a collection of information if it does not display a currently valid OMB control number...aircraft carriers & depots Environmentally sustainable Meets Navy JTP-2003 Portable system & Handheld spray gun Robotic deployment for OEM Applications...Problem - Field & Depot Repair of Damaged IVD-Al & Mg Alloys NADEP Facilities PEO(T) F/A-18, EA-18G PMA -271 E-6B

  19. Guide to Managing Occupational Exposure to Bloodborne Pathogens

    Science.gov (United States)

    1992-10-01

    containing the pathogen. Other examples include hepatitis C, malaria, syphilis, babesiosis, brucellosis , leptospirosis, arboviral infections...Avenue SECRETARY Des Moines, IA 50319 New Mexico Environment Dept. (515) 281-3447 Occupational Health and Safety Bureau 1190 St. Francis Drive ACTING...Nevada (702) 688-1474 4-9 New Hampshire (603) 271-3170 New Jersey (609) 292-0404 New Mexico (505) 827-2885New York (518) 457-2481 North Carolina (919

  20. A Neural Relevance Model for Feature Extraction from Hyperspectral Images, and Its Application in the Wavelet Domain

    Science.gov (United States)

    2006-08-01

    An indicator of a "well defined" boundary is the monitoring of the train and test classification history . Properly decaying the sigmoid function is...the wining history for each prototype wP so as to discourage frequent 31 winners from winning more often and encourage the selection of infrequent...Learning Vector Quantization. In Proceed- ings of European Symposium on Artificial Neural Networks (ESANN01), pages 271-276, Bruges , Belgium, Apr 2001. D

  1. The Shock and Vibration Digest. Volume 12, Number 2,

    Science.gov (United States)

    1980-02-01

    field NDE inspection results as input to the cal- susceptible, is introduced. The effect of varying engine in- culations is investigated. Tasks formed...Track Dynamics Program Railroad Retarder Noise Reduction: Study of Acous- H.C. Meacham, Jr., J.C. Swain, J.P. Wilcox , and G.R. tical Barrier...Wickens, A. H............. 275 Zaschel, J.M............. 400 Tezduyar, H.T ............ 333 Wilcox , J.P.............. 271 Zimmie, T.F

  2. War by Other Means. Building Complete and Balanced Capabilities for Counterinsurgency

    Science.gov (United States)

    2008-01-01

    criminal law Kosovo 312 271 NA NA UN High Commissioner for Refugees ( UNHCR ) International organization Security Worldwide 650 629 NA NA UN...people to do). Such a registry-census has to include who lives where, their sex and ages, and other basic demographic information (birthplace, length...accessible forms of terrain? Are these areas near where the initial cadre of the group is based? Are they easily cordoned off? Are there refugee camps

  3. Dicty_cDB: Contig-U12404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 CP001614_271( CP001614 |pid:none) Teredinibacter turnerae T7901, c... 71 1e-10 CP000282_3313( CP000282 |pi...14_2327( CP001614 |pid:none) Teredinibacter turnerae T7901, ... 64 2e-08 CU207366...e) Shewanella woodyi ATCC 51908, co... 38 1.0 CP001614_3025( CP001614 |pid:none) Teredinibacter turner

  4. Campaign-level Science Traceability for Earth Observation System Architecting

    Science.gov (United States)

    2009-05-01

    aerosol size and size distribution 2.4.4 canopy density 1.2.1 Atmospheric temperature fields 2.6.2 landcover status 1.3.1 Water vapor profiles 2.7.1...imagery (land) 3.15516 1.5.2 Cloud type 0.20923951 2.6.1 land use 0.060095 1.5.3 Cloud amount/distribution 0.26680361 2.6.2 landcover status

  5. Recruiter Selection Model

    Science.gov (United States)

    2006-05-01

    interests include feature selection, statistical learning, multivariate statistics, market research, and classification. He may be contacted at...current youth market , and reducing barriers to Army enlistment. Part of the Army Recruiting Initiatives was the creation of a recruiter selection...Selection Model DevelPed by the Openuier Reseach Crate of E...lneSstm Erapseeeng Depce-teo, WViitd Ntt. siliec Academy, NW..t Point, 271 Weau/’itt 21M

  6. Domain Modeling: NP_001607.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001607.1 chr2 Crystal structure of Activin receptor type II kinase domain from h...uman p2qlua_ chr2/NP_001607.1/NP_001607.1_holo_192-485.pdb blast 198K,199A,206V,217A,247L,267T,268A,269F,270H,271E,273G,329L 322D,324K,326K __A 0 ...

  7. AA, assembly of wide bending magnet

    CERN Multimedia

    1980-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

  8. Recent Advances in the Study of Microbiologically Influenced Corrosion

    Science.gov (United States)

    1993-01-01

    sufficient to kill planktonic or free floating cells of the same species. Blenkinsopp et al. [271 discovered that the application of a low strength electric...lower than the planktonic minimum inhibitory concentration. This enhanced biocide efficacy in the presence of an electric field/current density has...copy (SEM). ESEM images of wet estuarine biofilms on stainless steel surfaces indicated 349 a gelatinous layer in which numerous algae were located

  9. Intelligent Agent Integration Technology

    Science.gov (United States)

    1998-04-01

    The DARPA knowledge sharing effort: Progress report. In B. Nebel , C. Rich, and W. Swartout, editors, Principles of Knowledge Representation and...and Automation, pages 2,785-2,788. IEEE CS Press. [18] Carl Hewitt. Offices are open systems. Communications of the ACM, 4(3):271-287, July 1986...19] Carl Hewitt and Jeff Inman. DAI betwixt and be- tween: From "intelligent agents" to open systems sci- ence. IEEE Transactions on Systems, Man

  10. EST Table: CK563240 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/01 58 %/106 aa FBpp0191285|DperGL271...04775 10/09/10 n.h 10/09/10 53 %/113 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swp ...

  11. Bifurcation analysis and the travelling wave solutions of the Klein–Gordon–Zakharov equations

    Indian Academy of Sciences (India)

    Zaiyun Zhang; Fnag-Li Xia; Xin-Ping Li

    2013-01-01

    In this paper, we investigate the bifurcations and dynamic behaviour of travelling wave solutions of the Klein–Gordon–Zakharov equations given in Shang et al, Comput. Math. Appl. 56, 1441 (2008). Under different parameter conditions, we obtain some exact explicit parametric representations of travelling wave solutions by using the bifurcation method (Feng et al, Appl. Math. Comput. 189, 271 (2007); Li et al, Appl. Math. Comput. 175, 61 (2006)).

  12. Molecular mapping of a new induced gene for nuclear male sterility in sunflower (Helianthus annuus L.)

    Science.gov (United States)

    A new NMS line, NMS HA89-872, induced by mitomycin C and streptomycin carries a single recessive male-sterile gene ms6. An F2 population of 88 plants was obtained from a cross between nuclear male-sterile mutant NMS HA89-872 (msms) and male-fertile line RHA271 (MsMs). 225 SSR primers and 9 RFLP-deri...

  13. Aleph Cero / El gran colisionador

    CERN Multimedia

    2008-01-01

    If everything is going as foreseen, in summer 2008, the great collider of CERN (European Center for Nuclear Researches) will begin to work. It's a circular tunnel, 27km long, in which protons will circulate at the speed of the light, guided by magnetic fiels produced by 700 superconductors magnets, cooled to temperatures of two degrees below the absolute zero (271 degrees below the absolute zero)

  14. Assessing Technology Innovation in the PLA

    Science.gov (United States)

    2015-03-01

    include defense out to the second island chain, anti- piracy operations, and military operations other than war (MOOTW).124 This growth has happened...Counterfeit Electronic Parts Can Be Found on Internet Purchasing Platforms (GAO, February 2012), http://www.gao.gov/assets/590/588736.pdf. 271...c_132312681.htm. DOD Supply China: Suspect Counterfeit Electronic Parts Can Be Found on Internet Purchasing Platforms. GAO, February 2012. http

  15. A Nonlinear Transfer Operator Theorem

    Science.gov (United States)

    Pollicott, Mark

    2017-02-01

    In recent papers, Kenyon et al. (Ergod Theory Dyn Syst 32:1567-1584 2012), and Fan et al. (C R Math Acad Sci Paris 349:961-964 2011, Adv Math 295:271-333 2016) introduced a form of non-linear thermodynamic formalism based on solutions to a non-linear equation using matrices. In this note we consider the more general setting of Hölder continuous functions.

  16. Evaluation and Repair of Concrete Structures: Annotated Bibliography 1978 - 1988. Volume 1. (Repair, Evaluation, Maintenance and Rehabilitation Research Program)

    Science.gov (United States)

    1991-06-01

    337 Baggot, R., D-671 Beresford, F. D., A-40- Bahlis, J. B., B-370 Berg, J. H., A-92- Bailey, 14. W., D-4 Berger, R., D-25 Bai- leys ,- R. T.,, C-il...Henderson, G.-, D-174, D-188, D-191 Horswill, P., D-685 Henel, E., D-47 Hoshino, Y. B-271 Hengquan,- G., A-224 Hosoi, T., D-382 - Herod , S., 0-49 Houghton, D

  17. Naval Research Logistics Quarterly. Volume 27, Number 2.

    Science.gov (United States)

    1980-06-01

    Borsting, Naval Postgraduate School Charles Kriebel, Carnegie-Mellon University Leon Cooper, Southern Methodist University Jack Laderman, Bronx, New...whose solution p° will be the focal point of this paper. Condition (4), known as the Walras Law [271, is the aggregated form of Eq. (1) and holds for...excess demand function to be less than or equal to zero; and the fourth condition is Walras ’ Law and reflects the following circumstances: if x,, the

  18. A Cross-Shore Model of Barrier Island Migration over a Compressible Substrate

    Science.gov (United States)

    2010-01-01

    substrate Marine Geology 271 (2010) 1–16 ⁎ Corresponding author. Tel.: +1 251 694 3719; fax: +1 251 690 3464. E-mail address: Julie.D.Rosati...ScienceDirect Marine Geology j ourna l homepage: www.e lsev ie r.com/ locate /margeo Report Documentation Page Form ApprovedOMB No. 0704-0188 Public reporting...Egypt (Stanley and Warne, 1998), the Ganges–Brahmaputra Rivers, Bangladesh , India (Allison, 1998); and the Yangtze River, China (Xiqing, 1998

  19. Molecular Engineering of Liquid Crystal Polymers by Living Polymerization. 14. Synthesis and Characterization of Binary Copolymers of Omega-4-Cyano-4’-Biphenyl)oxyAlkyl Vinyl Ethers Containing Undecanyl and Hexyl Pentyl and Propyl, and Undecanyl and Propyl Pairs of Alkyl Groups

    Science.gov (United States)

    1991-04-10

    Noel, C. Polym. Bull. 1986, 15, 341; Lacoudre, N.; Le Borgue , A.; Spassky, N.; Vairon, J. P.; Le Barny, P.; Dubois, . C.; Esselin, S.; Friedrich, C...Noel, C. Mol. Cryst. Liq. Cryst. 1988, 155, 113; Spassky, N.; Lacoudre, N.; Le Borgue , A.; Vairon J. P.; Jun, C. L.; Friedrich, C.; Noel, C. Makromol...Chem. Macromol. Symp. 1989, 24, 271; Legrand, C.; Le Borgue , A.; Bunel, C.; Lacoudre, N.; Le Barny, P.; Spassky, N.;Vairon, 3. P. Makromol. Chem

  20. Hyperekplexia in neonates

    OpenAIRE

    V. Praveen; Patole, S; Whitehall, J

    2001-01-01

    Hyperekplexia (startle disease) is a rare non-epileptic disorder characterised by an exaggerated persistent startle reaction to unexpected auditory, somatosensory and visual stimuli, generalised muscular rigidity, and nocturnal myoclonus. The genetic basis is a mutation usually of the arginine residue 271 leading to neuronal hyperexcitability by impairing glycinergic inhibition. Hyperekplexia is usually familial, most often autosomal dominant with complete penetrance and variable expression. ...

  1. Wooden Model of Wide AA Bending Magnet

    CERN Multimedia

    1978-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets: BLG, long and narrow; BST, short and wide). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see a wooden model, built in 1978, to gain dimensional experience with such a monster.

  2. Transnistria: The Hot Nature of a Frozen Conflict

    Science.gov (United States)

    2013-05-23

    and the European security paradigm. In seeking to answer the primary research 1Max Jakobson , “Collective Security in Europe Today,” in Order and...Romanian language, the modern form of Dacian Latin.”30 In 106 A.D., a portion of Dacia was conquered by the Roman Empire and transformed into a Roman ...province. The Roman occupation lasted until Aurelian withdrew from Dacia in 271 A.D. Throughout this period the Romans began a Romanization process

  3. Influence of light on DNA content of Helianthus annuus Linnaeus.

    Science.gov (United States)

    Price, H J; Johnston, J S

    1996-10-01

    Mean nuclear 2C DNA content (C equaling haploid DNA per nucleus) of the first leaf of the sunflower, Helianthus annuus L., is influenced by the quality and the quantity of light. Seedlings of two inbred lines, RHA 299 and RHA 271 were germinated and grown in controlled environmental conditions. Lighting was adjusted to provide different combinations of photon flux densities and red to far red (R:FR) ratios. At R:FR = 5.8 and photon flux densities of 170 mumol.m-2.s-1, 200 mumol.m-2.s-1, and 230 mumol.m-2.s-1, DNA content remained high and relatively constant (x = 6.97 pg for RHA 271 and x = 7.32 pg for RHA 299). When the photon flux density range (R:FR = 5.8) was elevated to 350 mumol.m-2.s-1, 410 mumol.m-2.s-1, and 470 mumol.m-2.s-1, mean DNA content was reduced to 6.23 pg (RHA 271) and 6.46 pg (RHA 299). At R:FR = 1.5, mean DNA content was consistently high (7.2-7.9 pg) only at the lowest photon flux density of 170 mumol.m-2.s-1. Significant decreases in DNA content (densities of 200 mumol.m-2.s-1 and 230 mumol.m-2.s-1. At the higher photon flux densities (350 mumol.m-2.s-1, 410 mumol.m-2.s-1, and 470 mumol.m-2.s-1) and R:RF = 1.5, the plants had extremely low DNA contents (mean x = 3.36 pg for RHA 271 and 3.41 pg for RHA 299) and high between-plant variance. The instability of DNA content, particularly for plants grown under light that is far red rich, suggests that phytochromes may be involved in regulating DNA content of the sunflower.

  4. The Dependence of All-Atom Statistical Potentials on Structural Training Database

    OpenAIRE

    Zhang, Chi; Liu, Song; Zhou, Hongyi; Zhou, Yaoqi

    2004-01-01

    An accurate statistical energy function that is suitable for the prediction of protein structures of all classes should be independent of the structural database used for energy extraction. Here, two high-resolution, low-sequence-identity structural databases of 333 α-proteins and 271 β-proteins were built for examining the database dependence of three all-atom statistical energy functions. They are RAPDF (residue-specific all-atom conditional probability discriminatory function), atomic KBP ...

  5. Gram-scale Plutonium Samples Measured by Experimental Device of Four Detectors Well-type Fast Neutron Coincidence Measurement

    Institute of Scientific and Technical Information of China (English)

    LIU; Guo-rong; LIANG; Qing-lei; LI; Jing-huai; LI; An-li

    2013-01-01

    Experimental device of four detectors well-type fast neutron coincidence measurement(see Fig.1)consists of four?127 mm×50.8 mm BC501A liquid scintillation detectors,DC271A digitizer and other circuits.Application program simultaneously acquires the waveform of each pulse output from each detector,and identifies each pulse from neutron or?particle by offline model,and gets their arrival timing.

  6. Human Eating Behavior: Preferences. Consumption Patterns, and Biorhythms

    Science.gov (United States)

    1978-06-01

    fMCDC) CWD(DD(DD(ZD(D 145 Frijole Salad C) Q )(DDZaD (I)DDCD aCD)XQ®DCDDCD® 146 Burritos C) C)DM MZ M (DC)CD WDC)DCX )MWMMMZCD 147 Chocolate Cookies C) C...Hominy Grits 263 Cucumber & Onion Salad 192 ID NAME 46 Caesar Dressing 149 Rice Pilaf 351 Minestrone Soup 145 Frijole Salad 271 Pork Hocks 210

  7. Deep Hubble Space Telescope imaging of IC 1613. II. The star formation history

    NARCIS (Netherlands)

    Skillman, ED; Tolstoy, E; Cole, AA; Dolphin, AE; Saha, A; Gallagher, JS; Dohm-Palmer, RC; Mateo, M

    2003-01-01

    We have taken deep images of an outlying field in the Local Group dwarf irregular galaxy IC 1613 with the WFPC2 aboard the Hubble Space Telescope in the standard broadband F555W (V, 8 orbits) and F814W (I,16 orbits) filters. The photometry reaches to V=27.7 (M-V=+3.4) and I=27.1 (M-I=+2.8) at the 50

  8. EST Table: FS825195 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: similar to ribosome biogenesis protein brix [Nasonia vitripennis] 10/09/10 67 %/218 aa FBpp012793...1|gene:AGAP005365 10/09/10 66 %/220 aa gnl|Amel|GB12626-PA 10/09/10 61 %/271 aa gi|91090402|ref|XP_970542.1|... PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS825195 fmgV ...

  9. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  10. Arctic Dinoflagellate Migration Marks the Oligocene Glacial Maximum: Implications for the Rupelian-Chattian Boundary

    Science.gov (United States)

    van Simaeys, S.; Brinkhuis, H.; Pross, J.; Williams, G. L.; Zachos, J. C.

    2004-12-01

    Various geochemical and biotic climate proxies, and notably deep-sea benthic foraminiferal δ 18O records indicate that the Eocene 'greenhouse' state of the Earth gradually evolved towards an earliest Oligocene 'icehouse' state, eventually triggering the abrupt appearance of large continental ice-sheets on Antarctic at ˜33.3 Ma (Oi-1 event). This, however, was only the first of two major glacial events in the Oligocene. Benthic foraminiferal δ 18O records show a second positive excursion in the mid Oligocene, consistent with a significant ice-sheet expansion and/or cooling at 27.1 Ma (Oi-2b) coincident with magnetosubchron C9n. Here, we report on a mid Oligocene, globally synchronous, Arctic dinoflagellate migration event, calibrated against the upper half of C9n. A sudden appearance, and abundance increases of the Arctic taxon Svalbardella at lower-middle latitudes coincides with the so-called Oi-2b benthic δ 18O event, dated at ˜27.1 Ma. This phenomenon is taken to indicate significant high-latitude surface water cooling, concomitant Antarctic ice-sheet growth, and sea level lowering. The duration of the Svalbardella migrations, and the episode of profound cooling is estimated as ˜500 ka, and is here termed the Oligocene Glacial Maximum (OGM). Our records suggest a close link between the OGM, sea-level fall, and the classic Rupelian-Chattian boundary, magnetostratigraphically dating this boundary as ˜27.1 Ma.

  11. The Tomato Hoffman's Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures.

    Science.gov (United States)

    Qiu, Zhengkun; Wang, Xiaoxuan; Gao, Jianchang; Guo, Yanmei; Huang, Zejun; Du, Yongchen

    2016-01-01

    Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF) gene, which corresponds to the ah (Hoffman's anthocyaninless) locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses.

  12. The Escherichia coli RNA polymerase alpha subunit and transcriptional activation by bacteriophage lambda CII protein.

    Science.gov (United States)

    Gabig, M; Obuchowski, M; Ciesielska, A; Latała, B; Wegrzyn, A; Thomas, M S; Wegrzyn, G

    1998-01-01

    Bacteriophage lambda is not able to lysogenise the Escherichia coli rpoA341 mutant. This mutation causes a single amino acid substitution Lys271Glu in the C-terminal domain of the RNA polymerase alpha subunit (alphaCTD). Our previous studies indicated that the impaired lysogenisation of the rpoA341 host is due to a defect in transcriptional activation by the phage CII protein and suggested a role for alphaCTD in this process. Here we used a series of truncation and point mutants in the rpoA gene placed on a plasmid to investigate the process of transcriptional activation by the cII gene product. Our results indicate that amino-acid residues 265, 268 and 271 in the a subunit may play an important role in the CII-mediated activation of the pE promoter (most probably residue 271) or may be involved in putative interactions between alphaCTD and an UP-like element near pE (most probably residues 265 and 268). Measurement of the activity of pE-lacZ, pI-lacZ and p(aQ)-lacZ fusions in the rpoA+ and rpoA341 hosts demonstrated that the mechanism of activation of these CII-dependent promoters may be in each case different.

  13. Chondrogenic potential of subpopulations of cells expressing mesenchymal stem cell markers derived from human synovial membranes.

    Science.gov (United States)

    Arufe, M C; De la Fuente, A; Fuentes, I; de Toro, F J; Blanco, F J

    2010-11-01

    In this study we analyzed the chondrogenic potential of subpopulations of mesenchymal stem cells (MSCs) derived from human synovial membranes enriched for CD73, CD106, and CD271 markers. Subpopulations of human synovial membrane MSCs enriched for CD73, CD106, and CD271 markers were isolated using a cytometry sorter and characterized by flow cytometry for MSC markers. The expression of Sox9, Nanog, and Runx2 genes by these cells was measured by reverse transcriptase-polymerase chain reaction. The chondrogenesis of each subpopulation was assessed by culturing the cells in a defined medium to produce spontaneous spheroid formation and differentiation towards chondrocyte-like cells. The examination of the spheroids by histological and immunohistochemical analyses for collagen type II (COL2), aggrecan, collagen type I (COL1), metalloprotease 13 (MMP13), and collagen type X (COLX) levels were performed to assess their chondrogenesis capacity. The adipogenesis and osteogenesis potential of each subpopulation was determined using commercial media; the resulting cells were stained with oil red O or red alizarin to test the degree of differentiation. The subpopulations had different profiles of cells positive for the MSC markers CD44, CD69, CD73, CD90, and CD105 and showed different expression levels of the genes Sox9, Nanog, and Runx2 involved in chondrogenesis, undifferentiation, and osteoblastogenesis, respectively. Immunohistochemical analysis demonstrated that COL1, COL2, COLX, MMP13, and aggrecan were expressed in the spheroids as soon as 14 days of culture. The CD271(+) subpopulation expressed the highest levels of COL2 staining compared to the other subpopulations. CD105 and Runx2 were shown by immunohistochemistry and genetic analysis to have significantly higher expression CD271(+) subpopulation than the other subpopulations. Spheroids formed from CD271-enriched and CD73-enriched MSCs from normal human synovial membranes mimic the native cartilage extracellular

  14. Molecular characteristics and efficacy of 16D10 siRNAs in inhibiting root-knot nematode infection in transgenic grape hairy roots.

    Directory of Open Access Journals (Sweden)

    Yingzhen Yang

    Full Text Available Root-knot nematodes (RKNs infect many annual and perennial crops and are the most devastating soil-born pests in vineyards. To develop a biotech-based solution for controlling RKNs in grapes, we evaluated the efficacy of plant-derived RNA interference (RNAi silencing of a conserved RKN effector gene, 16D10, for nematode resistance in transgenic grape hairy roots. Two hairpin-based silencing constructs, containing a stem sequence of 42 bp (pART27-42 or 271 bp (pART27-271 of the 16D10 gene, were transformed into grape hairy roots and compared for their small interfering RNA (siRNA production and efficacy on suppression of nematode infection. Transgenic hairy root lines carrying either of the two RNAi constructs showed less susceptibility to nematode infection compared with control. Small RNA libraries from four pART27-42 and two pART27-271 hairy root lines were sequenced using an Illumina sequencing technology. The pART27-42 lines produced hundred times more 16D10-specific siRNAs than the pART27-271 lines. On average the 16D10 siRNA population had higher GC content than the 16D10 stem sequences in the RNAi constructs, supporting previous observation that plant dicer-like enzymes prefer GC-rich sequences as substrates for siRNA production. The stems of the 16D10 RNAi constructs were not equally processed into siRNAs. Several hot spots for siRNA production were found in similar positions of the hairpin stems in pART27-42 and pART27-271. Interestingly, stem sequences at the loop terminus produced more siRNAs than those at the stem base. Furthermore, the relative abundance of guide and passenger single-stranded RNAs from putative siRNA duplexes was largely correlated with their 5' end thermodynamic strength. This study demonstrated the feasibility of using a plant-derived RNAi approach for generation of novel nematode resistance in grapes and revealed several interesting molecular characteristics of transgene siRNAs important for optimizing plant RNAi

  15. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  16. Infrared imaging and optical imaging and spectroscopy of (mostly type I Planetary Nebulae. I.

    Directory of Open Access Journals (Sweden)

    J. Bohigas

    2001-01-01

    Full Text Available Se presenta información espectroscópica, imágenes en las principales líneas ópticas de emisión e imágenes infrarojas para descubrir la presencia de hidrógeno molecular, de 14 nebulosas planetarias (NPs. Nueve de ellas satisfacen los dos criterios que definen a las NPs de tipo I (ricas en helio con un alto cociente de N/O. Todas éstas son bipolares y, excepto Sh 2-71, muestran H2 chocado. La composición química de JnEr 1 implica que fue producida por una progenitora masiva y puede ser tentativamente clasificada como de tipo I. A 26 es una NP elíptica rica en helio, con un bajo cociente de N/O y probablemente sin H2. Se encontró hidrógeno molecular chocado en K 3-92, una NP elíptica de tipo IIb, lo que significa que este objeto es probablemente joven. La composición química de K 3-72, K 4-55, M 1-75 y Sh 2-71 indica que se produjeron episodios de tercer dragado en su estrella progenitora. Las temperaturas y propiedades espectrales de BV 5-1, K 4-55, M 1-41, M 1-75 y Sh 2-71 sugieren la existencia de ondas de choque en su componente ionizada.

  17. MASP-1 Induced Clotting--The First Model of Prothrombin Activation by MASP-1.

    Directory of Open Access Journals (Sweden)

    Lorenz Jenny

    Full Text Available Mannan-binding lectin-associated serine protease-1 (MASP-1, a protein of the complement lectin pathway, resembles thrombin in terms of structural features and substrate specificity. Due to its interplay with several coagulation factors, it has the ability to induce fibrin clot formation independent of the usual coagulation activation pathways. We have recently shown that MASP-1 activates prothrombin and identified arginine (R 155, R271, and R393 as potential cleavage sites. FXa cleaves R320 instead of R393, and thrombin cleaves R155 and R284 in prothrombin. Here we have used three arginine-to-glutamine mutants of prothrombin, R271Q, R320Q, R393Q and the serine-to-alanine active site mutant S525A to investigate in detail the mechanism of MASP-1 mediated prothrombin activation. Prothrombin wildtype and mutants were digested with MASP-1 and the cleavage products were analysed by SDS-PAGE and N-terminal sequencing. A functional clotting assay was performed by thrombelastography. We have found that MASP-1 activates prothrombin via two simultaneous pathways, either cleaving at R271 or R393 first. Both pathways result in the formation of several active alternative thrombin species. Functional studies confirmed that both R393 and R320 are required for prothrombin activation by MASP-1, whereas R155 is not considered to be an important cleavage site in this process. In conclusion, we have described for the first time a detailed model of prothrombin activation by MASP-1.

  18. Kisspeptin signaling is required for the luteinizing hormone response in anestrous ewes following the introduction of males.

    Directory of Open Access Journals (Sweden)

    Julie-Ann P De Bond

    Full Text Available The introduction of a novel male stimulates the hypothalamic-pituitary-gonadal axis of female sheep during seasonal anestrus, leading to the resumption of follicle maturation and ovulation. How this pheromone cue activates pulsatile secretion of gonadotropin releasing hormone (GnRH/luteinizing hormone (LH is unknown. We hypothesised that pheromones activate kisspeptin neurons, the product of which is critical for the stimulation of GnRH neurons and fertility. During the non-breeding season, female sheep were exposed to novel males and blood samples collected for analysis of plasma LH profiles. Females without exposure to males served as controls. In addition, one hour before male exposure, a kisspeptin antagonist (P-271 or vehicle was infused into the lateral ventricle and continued for the entire period of male exposure. Introduction of a male led to elevated mean LH levels, due to increased LH pulse amplitude and pulse frequency in females, when compared to females not exposed to a male. Infusion of P-271 abolished this effect of male exposure. Brains were collected after the male effect stimulus and we observed an increase in the percentage of kisspeptin neurons co-expressing Fos, by immunohistochemistry. In addition, the per-cell expression of Kiss1 mRNA was increased in the rostral and mid (but not the caudal arcuate nucleus (ARC after male exposure in both aCSF and P-271 treated ewes, but the per-cell content of neurokinin B mRNA was decreased. There was also a generalized increase in Fos positive cells in the rostral and mid ARC as well as the ventromedial hypothalamus of females exposed to males. We conclude that introduction of male sheep to seasonally anestrous female sheep activates kisspeptin neurons and other cells in the hypothalamus, leading to increased GnRH/LH secretion.

  19. Identification of virus and nematode resistance genes in the Chilota Potato Genebank of the Universidad Austral de Chile

    Directory of Open Access Journals (Sweden)

    Marlon López

    2015-09-01

    Full Text Available Potato Genebank of the Universidad Austral de Chile (UACh is an important gene bank in Chile. The accessions collected all over the country possess high genetic diversity, present interesting agronomic and cooking traits, and show resistance to biotic and abiotic stress. A particularly interesting subgroup of the gene bank includes the accessions collected in the South of Chile, the Chilota Potato Genebank. The focus of this study is the identification of virus and nematode resistant genes in potatoes (Solatium tuberosum L., using the RYSC3 and YES3-3B molecular markers. The Potato virus Y(PVY resistance genes Ry adg and Ry sto were identified. Furthermore, the CP60 marker was used to assess the Rx resistance gene that confers resistance to Potato virus X (PVX. In addition, the HC and GRO1-4 markers were utilized to identify the GpaVvrn_QTL and Gro1-4, resistance genes of Globodera pallida and Globodera rostochiensis, respectively. Both G. pallida and G. rostochiensis are Potato Cyst Nematodes (PCN. The plant material used in this study included leaves from 271 accessions of the gene bank. These samples were collected in the field where natural pathogen pressure of potential viruses and diseases exists. ELISA assays were run for field detection of PVY and PVX. However, there have been no previous reports of nematode presence in the plant material. The results herein presented indicate presence of virus and nematode resistance genes in accessions of the Chilota Potato Genebank. In terms of virus resistance, 99 accessions out of the 271 tested possess the Ry adg resistance gene and 17 accessions of these 271 tested have the Ry sto resistance gene. Also, 10 accessions showed positive amplification of the Rxl resistant gene marker. As to nematode resistance, 99 accessions have possible resistance to G. pallida and 54 accessions show potential resistance to G. rostochiensis as detected using the available molecular markers.

  20. [Genetic characterization of the Zaliv Terpeniya virus (ZTV, Bunyaviridae, Phlebovirus, Uukuniemi serogroup) strains isolated from the ticks Ixodes (Ceratixodes) uriae White, 1852, obligate parasites of the Alcidae birds, in high latitudes of Northern Eurasia and the mosquitoes Culex modestus Ficalbi, 1889, in subtropics Transcaucasus].

    Science.gov (United States)

    L'vov, D K; Al'khovskiĭ, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Gitel'man, A K; Samokhvalov, E I; Botikov, A G

    2014-01-01

    Complete genome sequences were obtained for the LEIV-13841Ka (ID GenBank KF767463-65) and LEIV-279Az (ID GenBank KF767460-62) virus strains, which were classified as different strains of the Zaliv Terpeniya virus (ZTV). LEIV-13841Ka was isolated from the ticks Ixodes (Ceratixodes) uriae White, 1852 collected on Ariy Kamen (Commander Islands) in 1986. LEIV-279Az was isolated from the mosquitoes Culex modestus Ficalbi, 1889, collected in heron colony (Ardea Linnaeus, 1758) in Azerbaijan (1969) and was initially identified as Uukuniemi virus (UUKV). According to the results obtained LEIV-279Az is ZTV strain as well. LEIV-13841Ka and LEIV-279Az RdRp sequences have high level of homology (99%) with previously sequenced ZTV/LEIV-271Ka. The L-segment nucleotide sequences are homological with ZTV/LEIV-271Ka on the level of 94% and 98% for LEIV-13841Ka and LEIV-279Az, respectively; M-segment--89% and 88%, respectively. Such homologies for the amino acid sequences of Gn/Gc polyprotein are 98.3% and 97.7%. NP proteins of ZTV/LEIV-13841Ka and LEIV-279Az have 88.7% and 84.6% homologies with ZTV/LEIV-271Ka both for amino acid and nucleotide sequences, respectively. Thus, for the very first time we demonstrated ZTV strain isolated from mosquitoes in subtropical Transcaucasia zone. Obtained results permit to expand suggested areal of ZTV and to fill up data upon the ecology of the Uukuniemi virus group.

  1. Survey of chloroquine-resistant mutations in the Plasmodium falciparum pfcrt and pfmdr-1 genes in Hadhramout, Yemen.

    Science.gov (United States)

    Bamaga, Omar A A; Mahdy, Mohammed A K; Lim, Yvonne A L

    2015-09-01

    Malaria is still a major public health problem in Yemen. More than 95% of the malaria cases are due to Plasmodium ‎falciparum‎. Recently in Yemen, the antimalarial treatment policy was changed from chloroquine (CQ) to artemisinin combination therapy (ACTs). However, CQ is still available and prescribed in the Yemeni market. The persistence of CQ resistance will be prolonged if the shift to ACT and the simultaneous withdrawal of CQ are not rigorously implemented. The aim of the current survey is to detect chloroquine-resistant mutations in P. falciparum chloroquine-resistance transporter (pfcrt) and P. falciparum multi-drug resistance-1 (pfmdr1) genes. These data will be important for future monitoring and assessment of antimalarial drug policy in Yemen. Blood specimens were collected from 735 individuals from different districts of the Hadhramout province, Yemen by house-to-house visit. Mutation-specific nested polymerase chain reaction (PCR) and restriction fragment length polymorphism (PCR-RFLP) methods were used to investigate the mutations in the pfmdr1(codons 86 and 1246) and pfcrt (codons 76, 271, 326, 356 and 371) genes. The overall prevalence of pfcrt mutations at codons 76, 271, 326 and 371 were 50.4%, 58.7%, 54.3% and 44.9%, respectively. All isolates had wild-type pfcrt 356 allele. The majority of pfmdr1 86 alleles (83.3%) and all pfmdr1 1246 alleles were wild type. There was no association between pfcrt mutations and symptomatology, gender and age groups. In conclusion, point mutations in codons 76, 271, 326 and 371 of pfcrt of P. falciparum are high suggesting a sustained high CQ resistance even after 4 years of shifting to ACTs. These findings warrant complete withdrawal of CQ use from the Yemeni market for P. falciparum and careful usage of CQ for treating Plasmodium vivax.

  2. Structure and tectonics of the southwestern continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Subrahmanyam, V.; Rao, D; Ramana, M.V.; Krishna, K.S.; Murty, G.P.S.; Rao, M.G.

    . 6) were used for interpretation. In addition, these interpretations ,~" E ~p' ;'?" :50 • t N \\[ " /-~ °,,a- ,, I~~ I RVG - IO R'~VG_@. 3d- ," .... RV!-~ ,~','" " ..... " ~,~ ~ RVG - 5 ) .;27m !CORA DIk/H S i~ 2~m ," / / / /,. / /./. 36m... ~'1 \\x \\ i 7"5* -3d -3d -d -56 r'~ ° 3'd A" 3'd so' Fig. 3. Total magnetic intensity anomaly profiles. V. Subrahmanyam et al. / Tectonophysics 249 (1995) 267-282 271 are supplemented by seismic refraction records (Rao, 1976), well-log data...

  3. High frequencies of Y chromosome lineages characterized by E3b1, DYS19-11, DYS392-12 in Somali males

    DEFF Research Database (Denmark)

    Sanchez Sanchez, Juan Jose; Hallenberg, Charlotte; Børsting, Claus;

    2005-01-01

    f2) (27.1%), R1b3*(xR1b3d, R1b3f) (20.3%), E3b3 and R1a1*(xR1a1b) (both 11.9%). In Iraqis, 12 haplogroups were identified including J2*(xJ2f2) (29.7%) and J*(xJ2) (26.6%). The data suggest that the male Somali population is a branch of the East African population - closely related to the Oromos...

  4. Safety and Immunogenicity Testing of a Pilot Polysaccharide Vaccine Preparation to Pseudomonas aeruginosa.

    Science.gov (United States)

    1985-02-15

    aeruginosa the sera of 15 of 22 kelsen 1261, Ullmann and Schmulling (271, and patients contained at least one precipitin for LPS Southern et al. (28...froml I - [SI had a I han iarinan,. t rat ion of tilie ’IS I did noi t siicces’..fills rilc io redti :ed corntent of mannose coiiipred with IDS s...mncic i tat c pai ition oft (T[he Itlianilos Cotnt in I’S froit 1)-11. -IBI could han -depleted1 high- molecula r-iws eicht PS frim eoite Ul:-151) be

  5. Two-band superconductivity in MgB2.

    Science.gov (United States)

    Iavarone, M; Karapetrov, G; Koshelev, A E; Kwok, W K; Crabtree, G W; Hinks, D G; Kang, W N; Choi, Eun-Mi; Kim, Hyun Jung; Kim, Hyeong-Jin; Lee, S I

    2002-10-28

    The study of the anisotropic superconductor MgB2 using a combination of scanning tunneling microscopy and spectroscopy reveals two distinct energy gaps at Delta(1)=2.3 meV and Delta(2)=7.1 meV at 4.2 K. Different spectral weights of the partial superconducting density of states are a reflection of different tunneling directions in this multiband system. Temperature evolution of the tunneling spectra follows the BCS scenario [Phys. Rev. Lett. 3, 552 (1959)

  6. FAA Air Traffic Activity, Fiscal Year 1980,

    Science.gov (United States)

    2014-09-26

    MUNICIPAL CK M I ZF 5 0 0 5 0 CLINTON SHERHAN GK N I CSM 271 I 22 139 96 C LINTONVILLE NI N ORB 135 0 10 125 0 CLOOUET 1N S I OLH 55 0 0 55 . CLOVIS NM...NM 1314 962 205 46 130. TOTAL 1314 4K, 205 961 180,-" CANNON AFe ICVS) NM 0 o 0 3 0 * CLOVIS |CVNI NM 35 1 11 20 3 PORTALES MUN] (Q34) NM 6 C 0 6 0

  7. Asphyxia-related risk factors and their timing in spastic cerebral palsy

    DEFF Research Database (Denmark)

    Nielsen, Lene F.; Schendel, Diana; Grove, Jakob;

    2008-01-01

    Objective To investigate the association of asphyxia-related conditions (reducing blood flow or blood oxygen levels in the fetus) with spastic cerebral palsy (CP) considering different gestational age groups and the timing of risk. Design Population-based case-control study. Setting Danish Cerebral...... Palsy Register in eastern Denmark and Danish Medical Birth Register. Population or Sample 271 singletons with spastic CP and 217 singleton controls, frequency matched by gestational age group, born 1982-1990 in eastern Denmark. Methods Data were abstracted from medical records, and a priori asphyxia...

  8. Subjective Well-Being and Big Five Personality Model at Adolescence

    Directory of Open Access Journals (Sweden)

    Ali ERYILMAZ

    2010-12-01

    Full Text Available The psychological meaning of happiness is subjective well-being. Nowadays, researches on subjective well-being are increasing. The aim of this study was to investigate the relationships between adolescents’ subjective well-being and personality traits. This studyincludes 541 (270 females and 271 males adolescents who were between ages 14-18. Satisfaction with Life Scale, Adjective Based Personalitiy Test and Positive-Negative Affect Scale were used for gathering the data. The method of this study was hierarchal reggression analysis. According to results, Conscientiousness, Extraversion and Neoroticism are the most important traits as a predictors for adolescents’ subjective wellbeing.

  9. Stress-caused Anergy of Leukocytes towards Staphylococcal enterotoxin B and Exposure Transcriptome Signatures

    Science.gov (United States)

    2015-05-28

    Enriched pathways associated with these 51 transcripts were reflective of compromised immunity of SEB-exposed post-RASP APCs and T-cells (Figure 2...Regulation of synaptic plasticity and transmission of nerve impulse 33625 2.71E-05 2 Positive regulation of integrin activation 5126 4.59E-05 7 Cytokine...Apoptotic caspase activator activity 48469 2.82E-03 7 Cell maturation 77 3.07E-03 5 DNA damage checkpoint 7268 3.42E-03 12 Synaptic transmission 45296 4.12E

  10. The influence of strengthening education and toothbrushing on oral health in preschool children%口腔卫生宣教和强化刷牙对学龄前儿童口腔卫生的影响

    Institute of Scientific and Technical Information of China (English)

    翁金龙; 凌广慧; 徐天婷; 刘敏; 孙凤; 陈霄迟

    2013-01-01

    目的 研究口腔卫生宣教和强化刷牙对学龄前儿童口腔卫生的影响.方法 以全口牙平均菌斑指数(PLI)为指标,比较实验组和对照组的强化卫生宣教和强化刷牙前后儿童口腔菌斑指数的变化.结果 半年后的检查结果对照组平均菌斑指数为3.14±0.53,实验组为2.71 ±0.56,两者差异显著(P=0.012);实验组在强化卫生宣教和强化刷牙前后全口平均菌斑指数分别为3.23±0.51和2.71 ±0.56,两者有显著性差异(P=0.002).结论 口腔卫生宣教和强化刷牙有助于提高儿童的口腔卫生.%Objective To study the influence of strengthening education and toothbrushing on oral health in preschool children.Methods We used full-mouth mean dental plaque index (PLI) as an indicator,observed PLI changes in the experimental group and control group before and after strengthening health education and toothbrushing.Results After six months,the mean plaque index was 3.14 ± 0.53 for control group,2.71 ± 0.56 for experimental group,the difference was statistically significant (P=0.012); In the experimental group,the mean plaque index was 3.23 ± 0.51 before and 2.71 ± 0.56 after strengthening health education and toothbrushing,the difference was statistically significant (P=0.002).Conclusion Strengthening oral health education and toothbrushing can improve the oral health of preschool children.

  11. Optimal reactions for synthesis of nuclides of element 108

    Institute of Scientific and Technical Information of China (English)

    Liu Zu-Hua; Zhou Hong-Yu

    2007-01-01

    The cross sections for the production of nuclides of element 108 via hot fusion evaporation reactions are studied using a two-parameter Smoluchowski equation. The optimal reactions for the synthesis of new nuclides of element 108 with mass numbers from 266 to 271 are suggested. The macroscopic-microscopic approach predicts a strong deformed shell closure at Z ≈ 108 and N = 162. The synthesis of more nuclides of element 108 is meaningful to the confirmation of the existence of this deformed shell closure.

  12. Cardiovascular Autonomic Neuropathy Is Associated With Macrovascular Risk Factors in Type 2 Diabetes

    DEFF Research Database (Denmark)

    Fleischer, Jesper; Yderstraede, Knud; Gulichsen, Elisabeth

    2014-01-01

    The objective was to identify the presence of cardiovascular autonomic neuropathy (CAN) in a cohort of individuals with diabetes in outpatient clinics from 4 different parts of Denmark and to explore the difference between type 1 and type 2 diabetes in relation to CAN. The DAN-Study is a Danish...... multicenter study focusing on diabetic autonomic neuropathy. Over a period of 12 months, 382 type 1 and 271 type 2 individuals with diabetes were tested for CAN. Patients were randomly recruited and tested during normal visits to outpatient clinics at 4 Danish hospitals. The presence of CAN was quantified......, whereas in type 2 CAN was associated with macrovascular risk factors....

  13. Relationship of Estuarine Plant Contaminants to Existing Data Bases

    Science.gov (United States)

    1988-02-01

    Experiments. Plant and Soil, ?8: 271-282. COMISSAO NACIONAL DO AMBIENTE (1980). Atlas do Ambiente de Portugal.CNA, Lisboa. CROWDER, A.A. & Macfie, S.M...Photo- synthetica, 18: 134-138. INSTITUTO AGRONONICO DE S. PAULO (1978). Andlise Quimica de Plantas.Cir cular N2 87, Sic Paulo. KIEKENS, L. Cottenie, A...Estudos de Am- biente, Lisboa. PENEDA, M.C. & Coelho, A.T. (1978). Valor e Potencialidade8 do Estudrio do Sado. ServiCo de Estudos de Ambiente , Lisboa

  14. Design Tool for Planning Permanganate Injection Systems

    Science.gov (United States)

    2010-08-01

    of NOD for Different Sites. Source NOD Site Description g/Kg mmol/Kg Mumford et al., 2005 1.2 10 CFBase Borden Batch test 0.35 3 Column test... Mumford et al., 2004 0.51-0.75 4.3-6.3 CFBase Borden Push-pull test Static 0.29-0.42 2.4-3.5 Push-pull test, Drift or Reaction Urynowicz, 2008 2.9...medium sand 2.28 19.2 National Test Site, Dover AFB, DE sandy loam 32.29 27.1 East Gate Disposal Yard, Fort, Lewis , WA loamy sand, gravel

  15. Development of a Design Tool for Planning Aqueous Amendment Injection Systems Permanganate Design Tool

    Science.gov (United States)

    2010-08-01

    Sites. Source NOD Site Description g/Kg mmol/Kg Mumford et al., 2005 1.2 10 CFBase Borden Batch test 0.35 3 Column test Mumford et al., 2004...National Test Site, Dover AFB, DE sandy loam 32.29 27.1 East Gate Disposal Yard, Fort, Lewis , WA loamy sand, gravel, cobbles 0.77 6.5 Milan Army...consumption by NOD (Hood and Thomson, 2000; Reitsma and Dai, 2001; Mumford , 2002; Xu, 2006; Jones, 2007; Hønning et al., 2007; Urynowicz et al

  16. Seroprevalencia de la hepatitis C en adultos de México: ¿un problema de salud pública emergente? Seroprevalence of hepatitis C among Mexican adults: an emerging public health problem?

    OpenAIRE

    José Luis Valdespino; Carlos J Conde-González; Gustavo Olaiz-Fernández; Oswaldo Palma; David Kershenobich; Jaime Sepúlveda

    2007-01-01

    OBJETIVO: La infección por virus de la hepatitis (VHC) evoluciona hacia la cronicidad en 60 a 85% de los sujetos que la sufren y ocasiona cirrosis hepática y cáncer primario de hígado. El objetivo de este estudio fue notificar la seroprevalencia de infección por VHC en una muestra probabilística de la población en el plano nacional. MATERIAL Y MÉTODOS: Se estudiaron 21 271 sueros seleccionados de manera aleatoria de la Encuesta Nacional de Salud 2000, para anti-VHC y RNA de VHC. El estudio se...

  17. The Role of GADD34 (Growth Arrest and DNA Damage-Inducible Protein) in Regulating Apoptosis, Proliferation, and Protein Synthesis in Human Breast Cancer Cells

    Science.gov (United States)

    2005-07-01

    and Lee, E. Y. (1994) J. Biol. Chein . 269, 12. Wakula, P., Bcullena, M., Ceulemans, H,, Stalinans, W., and Bollen, M. (2003) 13766-13770 J. Biol... Chein . 271, 28478-28484 14. Conner. J. H., Kicernan, T., Banik. S., Honkanen, R. E., and Shenolikar, S. 34. Schiender, K. K., Wang, W., and Wilson, S...E. (1989) Biochem. Biophys. Res. (1999) J. Riol. Chein .. 274, 22366-22372 Commun. 159, 72-78 15. Watanabe, T., Huang, H. B., Horiuchi, A., da Cruze

  18. Investigation on the Evolution of Structural, Electrical and Transmitting Properties of Aluminium Doped Zinc Oxide Thin Film as a function of substrate temperature

    Science.gov (United States)

    Devasia, Sebin; Athma, P. V.; Jose, Anumol; Anila, E. I.

    2016-09-01

    Improved electrical conductivity of aluminium doped zinc oxide (AZO) thin films deposited by chemical spray pyrolysis method at various substrate temperatures is reported. Detailed investigation on the structural, electrical and optical properties were carried out using XRD, four point probe and UV-Vis-NIR measurements. The films deposited at 450 °C shows better conductivity and transparency as compared to the films grown at lower temperatures. Electrical conductivity, determined using four point probe measurements, is 6.271 × 102 μcm with an average transmittance of 70 % in the visible and IR region.

  19. Dicty_cDB: Contig-U16436-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Burkholderia vietnamiensis G4 c... 271 8e-71 AM902716_277( AM902716 |pid:none) Bordetella petrii... synthase; ... 244 1e-62 CP000614_1059( CP000614 |pid:none) Burkholderia vietnami...6 0.007 1 ( CO013215 ) EST801550 Coccidioides posadasii spherule cDNA li... 56 0.007 1 ( AC117075 ) Dictyostelium discoid...001157_4095( CP001157 |pid:none) Azotobacter vinelandii DJ, comp... 253 2e-65 AL646053_1106( AL646053 |pid:none) Ralstonia solana...:none) Francisella tularensis subsp. ho... 38 1.5 AL939120_104( AL939120 |pid:none) Streptomyces coelico

  20. An Analysis of Department of Defense Services Contract Trends, 1990-2011

    Science.gov (United States)

    2012-12-01

    Express Scripts $425 Subtotal for Top 5 $1,685 $10,493 6 Christus  Health $135 Johns Hopkins APL $297 7 Martin’s Point Health Care $122 Martin’s Point Health...Care $271 8 Johns Hopkins University $89 LHI $214 9 Pacific Medical Centers $81 Christus  Health $175 10 Electronic Data Systems $28 Brighton Marine

  1. Moderate Physical Work Effects on Performance and Mood during Sustained Operations (SUSOPS)

    Science.gov (United States)

    1983-02-01

    Mitsuhashi, T. Validity of three components of subjective fatigue feelings. Journal of Science of Labour, 1970, 46. 251-270. Lisper, H.O., and Kjellberg...Psychology 1961, 62, 263-271- Wilkinson, R.T., and Stretton, N. Performance after awakening at different times of night. Psychomotor Science , 1971, 23, 283...Medicine, 1981, 72, 23-27. S1 | 14 Tabl e I OegraphjC, Physicall tan%1s6etcot CiAgractortst~ic~s of Sukb1eCts (M-22) "Variable Group Mean S.D. Variable

  2. Qualidade do sono em mulheres paulistanas no climatério Quality of sleep of climacteric women in São Paulo: some significant aspects

    OpenAIRE

    Carmen Lúcia Souza; José Mendes Aldrighi; Geraldo Lorenzi Filho

    2005-01-01

    OBJETIVO: O climatério é um período de grandes transformações em que a qualidade do sono usualmente se deteriora. O objetivo foi avaliar subjetivamente a qualidade do sono em mulheres no climatério (35 a 65 anos). MÉTODOS: Um questionário contendo informações pessoais, hábitos/saúde, sexualidade e sono foi aplicado a 271 mulheres. RESULTADOS: A amostra estudada constituiu-se principalmente de mulheres casadas, ativas profissionalmente, de alta condição econômica e escolaridade, não usuárias d...

  3. Análisis y adecuación de los procesos de electromigración y transporte en células de combustible PEM de hidrógeno

    OpenAIRE

    Barrio Jiménez, Aránzazu

    2014-01-01

    271 p. La célula de combustible de membrana polimérica puede constituir uno de los elementos clave para la materialización de un sistema energético basado en el hidrógeno como vector energético. Pero estos dispositivos electroquímicos aún se enfrentan a una serie de limitaciones que influyen negativamente en su funcionamiento fiable y correcto. Por esta razón, el objetivo global ha sido aportar un conocimiento adicional para el desarrollo de dichas células. Para ello, en esta tesis doctora...

  4. AcEST: BP912609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H04 400 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H04. BP91260...9 CL1957Contig1 Show BP912609 Clone id YMU001_000020_H04 Library YMU01 Length 400 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_H04. Accession BP912609 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912609|...Gaps = 2/71 (2%) Frame = -3 Query: 260 KVMSPLQSR*GQHKSAALKSTPL*QAANVHPHANQEVLY-PKTPIGYDGHDGQFVQPQ-T 87 KV++P

  5. Curious cases of the enzymes

    OpenAIRE

    Ulusu Nuriye Nuray

    2015-01-01

    J Med Biochem 2015; 34 (3) DOI: 10.2478/jomb-2014-0045 UDK 577. 1 : 61 ISSN 1452-8258 J Med Biochem 34: 271–281, 2015 Review article Pregledni ~lanak CURIOUS CASES OF THE ENZYMES NEOBI^NA ISTORIJA ENZIMA Nuriye Nuray Ulusu Koç University, School of Medicine, Sariyer-Istanbul, Turkey Address for correspondence: N. Nuray Ulusu, PhD Koç University School of Medicine Professor of Biochemistry Rumelifeneri Yolu Sarıyer-Istanbul – Turkey Phone: +90 (212)...

  6. 1992 Technical Digest Series. Volume 16. Conference Edition: Summaries of Papers Presented at the Nonlinear Dynamics in Optical Systems Topical Meeting Held in Alpbach, Austria on 22-26 June 1992

    Science.gov (United States)

    1992-06-01

    Physique Lett. 42, L- 271(1981). 2. J. Y. Huang and J. J. Kim, Phys. Rev. A. 26, 2117(1982). 3. M. Dubois, M. A. Rubio, and P. Berge , Phys. Rev. Lett...R35(1991). 6. P. Berge , Y. Pomeau, and C. Vidal, Order Within Chaos (Wiley, New York,1984). 7. C. 0. Weiss, W. Klische, P. S. Ering, and M. Cooper...including arrays and networks of coupled nonlinear elements. References: 1. R. Georgii, W. Eberl, E. Luscher and A. Hubler, Helvetica Physica Acta 62, 290

  7. Experimental investigation of Reykjavik city footbridge

    DEFF Research Database (Denmark)

    Zivanovic, Stana; Ingólfsson, Einar Thór; Pavic, Aleksandar

    2011-01-01

    This study describes experimental investigation of a 160 m long footbridge in Reykjavik. The bridge is a continuous post tensioned concrete beam spanning eight spans, the longest being 27.1 m. In plan, the structure has eye-catching spiral shape. Modal testing of the structure was conducted...... to identify its dynamic properties. As many as seven modes of vibration were identified in the low-frequency region up to 5 Hz. After this a series of controlled tests involving up to 38 test subjects were performed. These were designed to test vibration performance of the footbridge under various loading...

  8. The Distribution, Levels, and Relevance of the Interleukin-1 Family of Cytokines and Receptors in Human Breast Carcinoma-Induced Osteolysis

    Science.gov (United States)

    2005-10-01

    1974;290(16):867-71. 15. Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T. Interleukin-1 alpha activates an NF- kappaB-like factor in osteoclast-like...cells. J Biol Chem 1996;271(9):4605-8. 16. Jimi E, Nakamura I, Duong LT, Ikebe T, Takahashi N, Rodan GA, et al. Interleukin 1 induces...TNF alpha. J Dent Res 1999;78(10):1617-23. 19. Jimi E, Nakamura I, Ikebe T, Akiyama S, Takahashi N, Suda T. Activation of NF-kappaB is involved in the

  9. Radioactivity in the Risø District July-December 2015

    DEFF Research Database (Denmark)

    Nielsen, Sven Poul; Andersson, Kasper Grann; Miller, Arne

    The environmental surveillance of the Risø environment was continued in July-December 2015. The mean concentrations in air were: 0.24±0.18 μBq m–3 of 137Cs, 2.71±0.88 mBq m–3 of 7Be and 0.28±0.20 mBq m–3 of 210Pb (±1 S.D.). The depositions by precipitation at Risø in the second half of 2015 were:...

  10. Radioactivity in the Risø District January-June 2010

    DEFF Research Database (Denmark)

    Nielsen, Sven Poul; Andersson, Kasper Grann; Miller, Arne

    The environmental surveillance of the Risø environment was continued in January - June 2010. The mean concentrations in air were: 0.99±1.11 μBq m–3 of 137Cs, 4.56±2.71 mBq m–3 of 7Be and 0.49±0.57 mBq m–3 of 210Pb (±1 S.D.; N = 26). The depositions by precipitation at Risø in the first half of 20...

  11. Wetting Transition in Water

    Science.gov (United States)

    Friedman, S. R.; Khalil, M.; Taborek, P.

    2013-11-01

    Optical images were used to study the wetting behavior of water on graphite, sapphire, and quartz along the liquid vapor coexistence curve from room temperature to 300°C. Wetting transitions were identified by the temperature at which the contact angle decreased to zero and also by the disappearance of dropwise condensation. These two methods yielded consistent values for the wetting temperatures, which were 185°C, 234°C, and 271°C for water on quartz, sapphire, and graphite, respectively. We compare our results with the theoretical predictions based on a simplified model of the water-substrate potential and sharp interfaces.

  12. Mandarin Oriental, Las Vegas%拉斯维加斯文华东方酒店

    Institute of Scientific and Technical Information of China (English)

    KPF建筑师事务所

    2010-01-01

    @@ 由世界知名建筑公司KPF事务所设计的拉斯维加斯文华东方酒店于2009年12月4日正式揭幕营业.作为美高梅(MGM Mirage)公司与迪拜世界公司的分支无限世界开发公司的合资项目的重要组成部分,这一开发项目地处著名的拉斯维加斯赌城一条街,共占地27.1hm2.

  13. Disease: H00166 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00166 Hermansky-Pudlak syndrome (HPS) Hermansky-Pudlak syndrome (HPS) is a group o...S8) BLOC1S3 [HSA:388552] ICD-10: E70.3 MeSH: D022861 OMIM: 203300 608233 PMID:16420244 Wei ML Hermansky-Pudl...l Res 19:19-42 (2006) PMID:15941404 Di Pietro SM, Dell'Angelica EC The cell biology of Hermansky-Pudlak synd...olecular machinery for the biogenesis of lysosome-related organelles: lessons from Hermansky-Pudlak syndrome. Semin Cell Dev Biol 13:271-8 (2002) ...

  14. AcEST: DK944403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK944403 - Show DK944403 Clone id YMU02A01NGRL0005_P03 Library YMU02 Length 271 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_P03. 5' end sequence. Accession DK944403 Tissue t...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944403|Adian

  15. In-Water Treatment of Biofouling in Internal Systems: Field Validation of Quaternary Ammonium Compound (QAC) Chemical Treatment Protocols

    Science.gov (United States)

    2013-06-01

    in European power stations: biology and control of fouling. Hydroecologie Appliquee, 1998. 10(1-2): p. 1-225. 25. Post, R.M., et al., A decade of...p. 227-271. 28. Bax, N.J., et al. Man-made marinas as sheltered islands for alien marine organisms: Establishment and eradiction of an alien...Journal of Experimental Marine Biology and Ecology, 2004. 300: p. 189-215. 32. Lee, J.E. and S.L. Chown, Mytilus on the move: transport of an

  16. Nowcasting, forecasting and warning for ionospheric propagation: supporting databases

    Directory of Open Access Journals (Sweden)

    N. Jakowski

    2004-06-01

    Full Text Available The use of data is essential in the context of nowcasting, forecasting and warning of ionospheric propagation conditions, with roles to play in the development, evaluation and operation of models and services. Descriptions are given of three databases that have been established in the course of the COST 271 Action: a database of prompt ionospheric soundings, an extension to a database generated by the EISCAT incoherent scatter radars, and a database intended to facilitate evaluation of TEC estimation methods. Each database includes some background information, a description of the contents and interface, and instructions as to how to gain access to it.

  17. Mineral Composition, Microstructure Characteristics and Generation of Taiwan Nephrite%台湾软玉的矿物成分、显微结构特征及形成世代

    Institute of Scientific and Technical Information of China (English)

    任戍明; 张良钜; 张杰

    2012-01-01

    The nephrite samples from Hualien Fengtien nephrite belt of Taiwan are studied by Fourier transform infrared absorption spectra and XRD, indicating that the nephrite samples are mainly composed of tremolite. The major absorption frequencies of the samples appear around 940 -1 105 cm-1, 650 -760 cm-1, 460 -510 cm-1 and 3 670 cm-1, and the main X-ray spectrogram are 0. 844 3 -0. 845 8 nm( 110) , 0. 271 1 -0. 271 5 nm(151) , 0. 313 1.-0. 313 5 nm(310) and 0. 328 3 -0. 328 6 nm (240).The microstructures of nephrite are felt-like blastic texture, columnar blastic texture, bundle-like blastic texture and parallel fibroblastic texture. The tremolite went through four different generations. The first is coarse columnar. The second is fine columnar, interspersed among the first generation. The third is felt-like aggregate. The fourth is parallel fiber-shaped, formed in last stage.%对采自台湾花莲县丰田矿区的软玉样品利用傅里叶变换红外光谱(FTIR)和X射线粉晶衍射(XRD)进行矿物成分分析,红外吸收频率主要出现在940~1 105cm-1、650~760 cm-1、460~510 cm-1和3 670 cm-1处,X射线粉晶衍射主要特征谱线为0.844 3~0.845 8 nm (110)、0.271 1 ~0.271 5 nm (151)、0.313 1 ~0.313 5 nm (310)和0.328 3 ~0.328 6 nm (240),结果表明其主要矿物为透闪石.软玉具有毛毡状变晶结构、柱状变晶结构、梱状变晶结构和平行纤维变晶结构.透闪石的形成可分为4个世代:第1世代为粗粒柱状;第2世代为细粒柱状,并切穿第1世代透闪石;第3世代为毛毡状集合体;第4世代为平行纤维状,为后期贯入形成.

  18. Bilateral frontoparietal polymicrogyria: a novel GPR56 mutation and an unusual phenotype.

    Science.gov (United States)

    Santos-Silva, Rita; Passas, Armanda; Rocha, Carla; Figueiredo, Rita; Mendes-Ribeiro, Jose; Fernandes, Susana; Biskup, Saskia; Leão, Miguel

    2015-04-01

    Loss of function of GPR56 causes a specific brain malformation called the bilateral frontoparietal polymicrogyria (BFPP), which has typical clinical and neuroradiological findings. So far, 35 families and 26 independent mutations have been described.We present a Portuguese 5-year-old boy, born from nonconsanguineous parents, with BFPP. This patient has a novel GPR56 mutation (R271X) and an unusual phenotype, because he presents hot water epilepsy.To the best of our knowledge, this is the first reported case of BFPP evolving hot water epilepsy.

  19. Dicty_cDB: Contig-U06151-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 50302 ) Ost1T_757 Oak tissue culture growing 1 hour in hy... 30 0.003 3 ( DN951030 ) Ost2T_963 Oak tissue culture growing... 2 days in hy... 30 0.003 3 ( DN950791 ) OST2T_454 Oak tissue culture growing 2 days in hy... 3...0 0.003 3 ( DN950672 ) Ost2T_271 Oak tissue culture growing 2 days in hy... 30 0.003 3 ( FD423693 ) RT00029R

  20. Co-culture fermentation of peanut-soy milk for the development of a novel functional beverage.

    Science.gov (United States)

    Santos, Claudia Cristina Auler do Amaral; Libeck, Bárbara da Silva; Schwan, Rosane Freitas

    2014-09-01

    Most of the commercial probiotic products are dairy-based, and the development of non-dairy probiotic products could be an alternative for new functional products. The peanut-soy milk (PSM(1)) was inoculated with six different lactic acid bacteria (LAB), including probiotic strains and yeasts and fermentation was accomplished for 24h at 37 °C and afterwards, another 24h at ±4 °C. The Pediococcus acidilactici (UFLA BFFCX 27.1), Lactococcus lactis (CCT 0360), Lactobacillus rhamnosus (LR 32) probiotic LAB, and the Lactobacillus delbrueckii subsp. bulgaricus (LB 340) yogurt starter culture reached cell concentrations of about 8.3log CFU/mL during fermentation. However, these strains were not able to acidify the substrate when inoculated as pure culture. The Lactobacillus acidophilus (LACA 4) probiotic produced significant amounts of lactic acid (3.35 g/L) and rapidly lowered the pH (4.6). Saccharomyces cerevisiae (UFLA YFFBM 18.03) did not completely consume the available sugars in PSM and consequently produced low amounts of ethanol (0.24 g/L). In pure culture, S. cerevisiae (UFLA YFFBM 18.03), L. rhamnosus (LR 32), L. acidophilus (LACA 4), and P. acidilactici (UFLA BFFCX 27.1) promoted the increase of total amino acids (48.02%, 47.32%, 46.21% and, 44.07%, respectively). However, when in co-cultured, the strains consumed the free amino acids favoring their growth, and reaching the population of 8log CFU/mL in PSM. Lactic acid production increased, and 12 h was required to reach a pH value of 4.3. In general, the strains were more efficient in the use of available carbohydrates and release of metabolites in co-cultured than in single culture fermentations. An average of 58% and 78% of available carbohydrates was consumed when single and co-cultures were evaluated, respectively. Higher lactic acid contents were found in a binary culture of P. acidilactici (UFLA BFFCX 27.1) and L. acidophilus (LACA 4), and by co-culture of P. acidilactici (UFLA BFFCX 27.1), L