WorldWideScience

Sample records for bohrium 267

  1. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  2. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  4. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  5. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  6. 40 CFR 1065.267 - Gas chromatograph.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Gas chromatograph. 1065.267 Section 1065.267 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Hydrocarbon Measurements § 1065.267 Gas...

  7. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  8. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  9. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  10. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  11. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  12. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  13. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  14. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  15. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  16. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  17. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  18. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  19. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  20. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  1. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  2. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  3. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  4. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  5. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  6. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  7. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  8. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  9. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  10. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  11. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  12. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  13. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  14. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  15. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  16. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  17. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  18. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  19. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  20. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  1. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  2. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  3. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  4. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  5. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  6. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  7. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  8. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  9. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  10. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  11. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  12. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  13. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  14. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  15. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  16. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  17. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  18. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  19. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  20. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  1. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  2. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  3. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  4. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  5. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  6. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  7. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  8. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  9. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  10. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  11. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  12. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  13. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  14. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  15. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  16. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  17. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  18. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  19. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  20. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  1. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  2. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  3. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  4. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  5. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  6. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  7. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  8. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  9. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  10. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  11. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  12. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  13. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  14. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  15. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  16. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  17. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  18. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  19. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  20. 39 CFR 267.3 - Responsibility.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Responsibility. 267.3 Section 267.3 Postal Service... Responsibility. (a) Chief Postal Inspector and Chief Privacy Officer. The Chief Postal Inspector and the Chief... compliance with this policy and related standards and procedures; and (2) Implementation of remedial...

  1. Dicty_cDB: SLD267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD267 (Link to dictyBase) sld267 - - Contig-U14171-1 SLD267Z ...(Link to Original site) - - SLD267Z 524 - - - - Show SLD267 Library SL (Link to library) Clone ID SLD267 (Li...nk to dictyBase) Atlas ID sld267 NBRP ID - dictyBase ID - Link to Contig Contig-U14171-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLD2-C/SLD267Q.Seq.d/ Representative seq. ID SLD2...67Z (Link to Original site) Representative DNA sequence >SLD267 (SLD267Q) /CSM/SL/SLD2-C/SLD267Q.Se

  2. 40 CFR 267.150 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false State assumption of responsibility. 267.150 Section 267.150 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID... STANDARDIZED PERMIT Financial Requirements § 267.150 State assumption of responsibility. (a) If a State...

  3. 39 CFR 267.4 - Information security standards.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Information security standards. 267.4 Section 267... INFORMATION § 267.4 Information security standards. (a) The Postal Service will operate under a uniform set of information security standards which address the following functional aspects of information flow...

  4. 25 CFR 700.267 - Disclosure of records.

    Science.gov (United States)

    2010-04-01

    ... Information Act, reasonable efforts shall be made to assure that the records are accurate, complete, timely... 25 Indians 2 2010-04-01 2010-04-01 false Disclosure of records. 700.267 Section 700.267 Indians... Privacy Act § 700.267 Disclosure of records. (a) Prohibition of disclosure. No record contained in...

  5. 40 CFR 267.142 - Cost estimate for closure.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Cost estimate for closure. 267.142... PERMIT Financial Requirements § 267.142 Cost estimate for closure. (a) The owner or operator must have at the facility a detailed written estimate, in current dollars, of the cost of closing the facility...

  6. 27 CFR 28.267 - Exportation from interior port.

    Science.gov (United States)

    2010-04-01

    ... provisions of U.S. Customs regulations (19 CFR chapter I). On completion of the lading, the seals shall be... port. 28.267 Section 28.267 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Proceedings at Ports of Export §...

  7. 7 CFR 2.67 - Administrator, Economic Research Service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Economic Research Service. 2.67 Section... Research, Education, and Economics § 2.67 Administrator, Economic Research Service. (a) Delegations... Administrator, Economic Research Service: (1) Conduct economic research on matters of importance to...

  8. 40 CFR 267.14 - What are my security requirements?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are my security requirements? 267... PERMIT General Facility Standards § 267.14 What are my security requirements? (a) You must prevent, and minimize the possibility for, livestock and unauthorized people from entering the active portion of...

  9. Dicty_cDB: AFG267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFG267 (Link to dictyBase) - - - Contig-U16243-1 AFG267E (Link to Original ... o... 751 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 413 e-114 AM474896_9( AM4 ...

  10. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  11. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  12. 47 CFR 73.267 - Determining operating power.

    Science.gov (United States)

    2010-10-01

    ... described in § 73.267(c); or (2) Operating the transmitter into a load (of substantially zero reactance and... (within ±5% accuracy) or temperature and coolant flow indicator (within ±4% accuracy) to determine...

  13. CYP267A1 and CYP267B1 from Sorangium cellulosum So ce56 are Highly Versatile Drug Metabolizers.

    Science.gov (United States)

    Kern, Fredy; Khatri, Yogan; Litzenburger, Martin; Bernhardt, Rita

    2016-04-01

    The guidelines of the Food and Drug Administration and International Conference on Harmonization have highlighted the importance of drug metabolites in clinical trials. As a result, an authentic source for their production is of great interest, both for their potential application as analytical standards and for required toxicological testing. Since we have previously shown promising biotechnological potential of cytochromes P450 from the soil bacterium Sorangium cellulosum So ce56, herein we investigated the CYP267 family and its application for the conversion of commercially available drugs including nonsteroidal anti-inflammatory, antitumor, and antihypotensive drugs. The CYP267 family, especially CYP267B1, revealed the interesting ability to convert a broad range of substrates. We established substrate-dependent extraction protocols and also optimized the reaction conditions for the in vitro experiments and Escherichia coli-based whole-cell bioconversions. We were able to detect activity of CYP267A1 toward seven out of 22 drugs and the ability of CYP267B1 to convert 14 out of 22 drugs. Moderate to high conversions (up to 85% yield) were observed in our established whole-cell system using CYP267B1 and expressing the autologous redox partners, ferredoxin 8 and ferredoxin-NADP(+) reductase B. With our existing setup, we present a system capable of producing reasonable quantities of the human drug metabolites 4'-hydroxydiclofenac, 2-hydroxyibuprofen, and omeprazole sulfone. Due to the great potential of converting a broad range of substrates, wild-type CYP267B1 offers a wide scope for the screening of further substrates, which will draw further attention to future biotechnological usage of CYP267B1 from S. cellulosum So ce56. PMID:26842594

  14. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  15. 40 CFR 267.53 - Who must have copies of the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... contingency plan? 267.53 Section 267.53 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... UNDER A STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.53 Who must have copies of the contingency plan? (a) You must maintain a copy of the plan with all revisions at the facility;...

  16. 40 CFR 267.1108 - What must I do when I stop operating the containment building?

    Science.gov (United States)

    2010-07-01

    ... unless 40 CFR 261.3(d) applies. The closure plan, closure activities, cost estimates for closure, and... the containment building? 267.1108 Section 267.1108 Protection of Environment ENVIRONMENTAL PROTECTION... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1108 What must I do when I...

  17. 40 CFR 267.1104 - How may I obtain a waiver from secondary containment requirements?

    Science.gov (United States)

    2010-07-01

    ... secondary containment requirements? 267.1104 Section 267.1104 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1104 How may I obtain a waiver from secondary containment requirements? Notwithstanding any other provision of this subpart,...

  18. 40 CFR 267.1107 - Can a containment building itself be considered secondary containment?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Can a containment building itself be considered secondary containment? 267.1107 Section 267.1107 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1107 Can a containment...

  19. 40 CFR 267.1101 - What design and operating standards must my containment building meet?

    Science.gov (United States)

    2010-07-01

    ... must my containment building meet? 267.1101 Section 267.1101 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1101 What design and operating standards must my containment building meet? Your containment building must comply with the design...

  20. Elastomer liners for geothermal tubulars Y267 EPDM Liner Program:

    Energy Technology Data Exchange (ETDEWEB)

    Hirasuna, A.R.; Davis, D.L.; Flickinger, J.E.; Stephens, C.A.

    1987-12-01

    The elastomer, Y267 EPDM, has been identified as a hydrothermally stable material which can operate at temperatures in excess of 320/sup 0/C. The goal of the Y267 Liner Program was to demonstrate the feasibility of using this material as a liner for mild steel tubulars to prevent or mitigate corrosion. If successful, the usage of EPDM lined pipe by the geothermal community may have a significant impact on operating costs and serve as a viable alternative to the use of alloyed tubulars. Tooling procedures were developed under this program to mold a 0.64 cm (0.25'') thick Y267 EPDM liner into a tubular test section 61 cm (2') in length and 19.1 cm (7.5'') in diameter (ID). A successful effort was made to identify a potential coupling agent to be used to bond the elastomer to the steel tubular wall. This agent was found to withstand the processing conditions associated with curing the elastomer at 288/sup 0/C and to retain a significant level of adhesive strength following hydrothermal testing in a synthetic brine at 260/sup 0/C for a period of 166 hours. Bonding tests were conducted on specimens of mild carbon steel and several alloys including Hastelloy C-276. An objective of the program was to field test the lined section of pipe mentioned above at a geothermal facility in the Imperial Valley. Though a test was conducted, problems encountered during the lining operation precluded an encouraging outcome. The results of the field demonstration were inconclusive. 6 refs., 13 figs., 13 tabs

  1. 40 CFR 267.17 - What are the requirements for managing ignitable, reactive, or incompatible wastes?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the requirements for managing ignitable, reactive, or incompatible wastes? 267.17 Section 267.17 Protection of Environment ENVIRONMENTAL... requirements for managing ignitable, reactive, or incompatible wastes? (a) You must take precautions to...

  2. 40 CFR 267.1102 - What other requirements must I meet to prevent releases?

    Science.gov (United States)

    2010-07-01

    ... prevent releases? 267.1102 Section 267.1102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... to prevent releases? You must use controls and practices to ensure containment of the hazardous waste... of the unit so that the height of any containment wall is not exceeded. (c) Take measures to...

  3. 40 CFR 267.16 - What training must my employees have?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What training must my employees have? 267.16 Section 267.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID... personnel must successfully complete a program of classroom instruction or on-the-job training that...

  4. 40 CFR 267.101 - What must I do to address corrective action for solid waste management units?

    Science.gov (United States)

    2010-07-01

    ... action for solid waste management units? 267.101 Section 267.101 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Releases from Solid Waste Management Units § 267.101 What must I do to address corrective action for solid waste management units? (a) You must...

  5. 40 CFR 267.1103 - What additional design and operating standards apply if liquids will be in my containment building?

    Science.gov (United States)

    2010-07-01

    ... standards apply if liquids will be in my containment building? 267.1103 Section 267.1103 Protection of... OPERATORS OF HAZARDOUS WASTE FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1103 What additional design and operating standards apply if liquids will be in my containment...

  6. 5 CFR 532.267 - Special wage schedules for aircraft, electronic, and optical instrument overhaul and repair...

    Science.gov (United States)

    2010-01-01

    ..., electronic, and optical instrument overhaul and repair positions in Puerto Rico. 532.267 Section 532.267... Prevailing Rate Determinations § 532.267 Special wage schedules for aircraft, electronic, and optical... duties involve the performance of work related to aircraft, electronic equipment, and optical...

  7. 40 CFR 267.198 - What are the general operating requirements for my tank systems?

    Science.gov (United States)

    2010-07-01

    ... system if they could cause the tank, its ancillary equipment, or the containment system to rupture, leak... comply with the requirements of § 267.200 if a leak or spill occurs in the tank system....

  8. 21 CFR 26.7 - Participation in the equivalence assessment and determination.

    Science.gov (United States)

    2010-04-01

    ... SERVICES GENERAL MUTUAL RECOGNITION OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE... EUROPEAN COMMUNITY Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.7... equivalence determination. Both parties will exercise good faith efforts to complete equivalence assessment...

  9. 40 CFR 267.56 - What are the required emergency procedures for the emergency coordinator?

    Science.gov (United States)

    2010-07-01

    ... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.56 What are..., and, if necessary, by chemical analysis. (2) Assess possible hazards to human health or...

  10. 26 CFR 1.401(a)(26)-7 - Testing methods.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Testing methods. 1.401(a)(26)-7 Section 1.401(a... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.401(a)(26)-7 Testing methods... the rules in § 1.401(a)(26)-5. (b) Simplified testing method. A plan is treated as satisfying...

  11. Phosphorylation of murine double minute clone 2 (MDM2) protein at serine-267 by protein kinase CK2 in vitro and in cultured cells

    DEFF Research Database (Denmark)

    Hjerrild, M; Milne, D; Dumaz, N; Hay, T; Issinger, O G; Meek, D

    ,6-dichlororibofuranosylbenzimidazole. Radiolabelling of cells expressing tagged recombinant wild-type MDM2 or a S267A (Ser(267)-->Ala) mutant, followed by phosphopeptide analysis, confirmed that Ser(267) is a cellular target for phosphorylation. Ser(267) mutants are still able to direct the degradation of p53, but in a slightly...

  12. Yeast Interacting Proteins Database: YGR239C, YMR267W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR239C PEX21 Peroxin required for targeting of peroxisomal matrix proteins contain...Bait ORF YGR239C Bait gene name PEX21 Bait description Peroxin required for targeting of peroxisomal matrix ...d by bait and prey 2 Literature sharing score 4 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,...is bait as prey (0) YMR267W PPA2 Mitochondrial inorganic pyrophosphatase, required for mitochondrial functio...s prey (0) Prey ORF YMR267W Prey gene name PPA2 Prey description Mitochondrial inorganic pyrophosphatase, required for mitochondri

  13. Atomic Mass and NuclearBinding Energy for Uup-267(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-267 (Ununpentium, atomic number Z = 115, mass number A = 267).

  14. 40 CFR 267.116 - What must I do with contaminated equipment, structure, and soils?

    Science.gov (United States)

    2010-07-01

    ... that waste following all applicable requirements of 40 CFR part 262. ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do with contaminated... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Closure § 267.116 What must I do with contaminated...

  15. 27 CFR 26.267 - Payment of tax by electronic fund transfer.

    Science.gov (United States)

    2010-04-01

    ... group of corporations, as defined in 26 U.S.C. 1563, and implementing regulations in 26 CFR 1.1563-1... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Procedure at Port of Entry From the Virgin Islands § 26.267 Payment of tax by...

  16. 40 CFR 267.54 - When must I amend the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false When must I amend the contingency plan... STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.54 When must I amend the contingency plan? You must review, and immediately amend the contingency plan, if necessary, whenever: (a) The...

  17. 40 CFR 267.52 - What must be in the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... CFR part 112, or some other emergency or contingency plan, you need only amend that plan to... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must be in the contingency plan... STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.52 What must be in the contingency plan?...

  18. Functional, genetic and chemical characterization of biosurfactants produced by plant growth-promoting Pseudomonas putida 267

    NARCIS (Netherlands)

    Kruijt, M.; Tran, H.; Raaijmakers, J.M.

    2009-01-01

    Aims: Plant growth-promoting Pseudomonas putida strain 267, originally isolated from the rhizosphere of black pepper, produces biosurfactants that cause lysis of zoospores of the oomycete pathogen Phytophthora capsici. The biosurfactants were characterized, the biosynthesis gene(s) partially identif

  19. 40 CFR 267.195 - What are the secondary containment requirements?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the secondary containment... UNDER A STANDARDIZED PERMIT Tank Systems § 267.195 What are the secondary containment requirements? To... secondary containment that meets the requirements of this section for all new and existing tank systems....

  20. 42 CFR 2.67 - Orders authorizing the use of undercover agents and informants to criminally investigate...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Orders authorizing the use of undercover agents and informants to criminally investigate employees or agents of a program. 2.67 Section 2.67 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS CONFIDENTIALITY OF ALCOHOL...

  1. 40 CFR 267.34 - When must personnel have access to communication equipment or an alarm system?

    Science.gov (United States)

    2010-07-01

    ... to an internal alarm or emergency communication device, either directly or through visual or voice... communication equipment or an alarm system? 267.34 Section 267.34 Protection of Environment ENVIRONMENTAL... have access to communication equipment or an alarm system? (a) Whenever hazardous waste is being...

  2. 40 CFR 267.196 - What are the required devices for secondary containment and what are their design, operating and...

    Science.gov (United States)

    2010-07-01

    ... secondary containment and what are their design, operating and installation requirements? 267.196 Section... Systems § 267.196 What are the required devices for secondary containment and what are their design, operating and installation requirements? (a) Secondary containment for tanks must include one or more of...

  3. 40 CFR 721.267 - N-[2-[(substituted dinitrophenyl)azo]diallylamino-4- substituted phenyl] acetamide (generic name).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false N- diallylamino-4- substituted phenyl] acetamide (generic name). 721.267 Section 721.267 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT SIGNIFICANT NEW USES OF CHEMICAL SUBSTANCES Significant New Uses for Specific Chemical Substances...

  4. Androgen receptor coregulator ARA267-α interacts with death receptor-6 revealed by the yeast two-hybrid

    Institute of Scientific and Technical Information of China (English)

    MAI Tiejun; WANG Xin; ZHANG Zhiwen; XIN Dianqi; NA Yanqun; GUO Yinglu

    2004-01-01

    ARA267-αis a newly identified androgen receptor coactivator.In order to further elucidate its precise role in cells,using the ARA267- α fragment containing four PHD and one SET conserved domains as bait we revealed an ARA267-α-PHD-SET-interacting protein,death receptor-6(DR6),in the yeast two-hybrid screening.DR6 is the member of TNF receptor family and has a death domain in its intracellular cytoplasmic portion(DR6cp)to mediate the cell apoptosis.The interaction between ARA267-α-PHD-SET and DR6cp was confirmed in vitro and in vivo.Our finding implied that androgen signaling pathway might cross talk with apoptosis signaling pathway through the interaction between ARA267-α and DR6.

  5. Functional characterization of the protein C A267T mutation: evidence for impaired secretion due to defective intracellular transport

    Directory of Open Access Journals (Sweden)

    Tjeldhorn Lena

    2010-09-01

    Full Text Available Abstract Background Activated protein C (PC is a serine protease that regulates blood coagulation by inactivating coagulation factors Va and VIIIa. PC deficiency is an autosomally inherited disorder associated with a high risk of recurrent venous thrombosis. The aim of the study was to explore the mechanisms responsible for severe PC deficiency in a patient with the protein C A267T mutation by in-vitro expression studies. Results Huh7 and CHO-K1 cells were transiently transfected with expression vectors containing wild-type (WT PC and mutated PC (A267T PC cDNAs. PC mRNA levels were assessed by qRT-PCR and the PC protein levels were measured by ELISA. The mRNA levels of WT PC and A267T PC were similar, while the intracellular protein level of A267T PC was moderately decreased compared to WT PC. The secretion of A267T PC into the medium was severely impaired. No differences in molecular weights were observed between WT and A267T PC before and after treatment with endo-β-N-acetylglucosaminidase. Proteasomal and lysosomal degradations were examined using lactacystin and bafilomycin, respectively, and revealed that A267T PC was slightly more susceptible for proteasomal degradation than WT PC. Intracellular co-localization analysis indicated that A267T PC was mainly located in the endoplasmic reticulum (ER, whereas WT PC was observed in both ER and Golgi. Conclusions In contrast to what has been reported for other PC mutants, intracellular degradation of A267T PC was not the main/dominant mechanism underlying the reduced intracellular and secretion levels of PC. Our results indicate that the A267T mutation most likely caused misfolding of PC, which might lead to increased retention of the mutated PC in ER.

  6. Serum albumin induces iNOS expression and NO production in RAW 267.4 macrophages

    OpenAIRE

    Poteser, Michael; Wakabayashi, Ichiro

    2004-01-01

    We investigated the effects of serum albumin on inducible nitric oxide synthase (iNOS) expression in RAW 267.4 macrophages. Crude fraction-V type albumin as well as bovine serum albumin filtrated for endotoxin induced concentration-dependent iNOS expression in macrophages. Accordingly, NO production (estimated by supernatant nitrite) was markedly (up to 10-fold) increased in the presence of albumin.Albumin-induced expression of iNOS protein was inhibited by cycloheximide and NO production was...

  7. Lack of positive allosteric modulation of mutated alpha(1)S267I glycine receptors by cannabinoids.

    Science.gov (United States)

    Foadi, Nilufar; Leuwer, Martin; Demir, Reyhan; Dengler, Reinhard; Buchholz, Vanessa; de la Roche, Jeanne; Karst, Matthias; Haeseler, Gertrud; Ahrens, Jörg

    2010-05-01

    Loss of inhibitory synaptic transmission within the dorsal horn of the spinal cord plays a key role in the development of chronic pain following inflammation or nerve injury. Inhibitory postsynaptic transmission in the adult spinal cord involves mainly glycine. Ajulemic acid and HU210 are non-psychotropic, synthetic cannabinoids. Cannabidiol is a non-psychotropic plant constituent of cannabis sativa. There are hints that non-cannabinoid receptor mechanisms of these cannabinoids might be mediated via glycine receptors. In this study, we investigated the impact of the amino acid residue serine at position 267 on the glycine-modulatory effects of ajulemic acid, cannabidiol and HU210. Mutated alpha(1)S267I glycine receptors transiently expressed in HEK293 cells were studied by utilising the whole-cell clamp technique. The mutation of the alpha(1) subunit TM2 serine residue to isoleucine abolished the co-activation and the direct activation of the glycine receptor by the investigated cannabinoids. The nature of the TM2 (267) residue of the glycine alpha(1) subunit is crucial for the glycine-modulatory effect of ajulemic acid, cannabidiol and HU210. An investigation of the impact of such mutations on the in vivo interaction of cannabinoids with glycine receptors should permit a better understanding of the molecular determinants of action of cannabinoids. PMID:20339834

  8. Report of 267 Cases of Scorpion Bite Referring to an Emergency Department during One Year

    OpenAIRE

    Mohammad Manouchehrifar; Shaghayegh Khosravi; Ali Khavanin*; Niloufar Derakhshandeh

    2013-01-01

    Scorpion bite is a common health problem in many parts of the world, including the Iran’s tropics. There are thousands of cases and a number of deaths due to scorpion bite every year in the country. The present study aims to provide further data regarding the details, complications and outcomes of scorpion bite cases referring to Razi Hospital, Ahwaz, from March 2011 to April 2012. A total of 267 patients (56.3% females) with a mean age of 35.2±15.8 years, were included in the study. The most...

  9. The Clinical Analysis on Biliary Operation Among 267 Old People%267例老年人胆道手术临床分析

    Institute of Scientific and Technical Information of China (English)

    罗国斌

    2014-01-01

      Objective:Purpose:Discussthesafetyofperformingoperationsofbiliarytractforoldpeopleinprimaryhospitals. Methods:Retrospective analyses 267 clinical data of performing operations of biliary tract for over65-year-oldpeopleinourtownclinic.Results:Ourgroupperforms69casesoflaparoscopiccholecystectomy,124casesofopencholecystectomy,56casesofcholedocholithotomy,18casesofcholedocholithotomyforasecondtime.Allthesurgeriesgowell.Thereare5casesofpostoperativewoundinfection,1caseofwounddehiscence,1caseofincision-al hernia and 5 cases of acute bronchitis. Conclusion:Foroldpeople,chronicdiseaseisnormal.Weshouldpayattentionto patients' perioperative treatment. Performing operations of biliary tract for old people in primary hospitals is safe.%目的:探讨基层医院实施老年人胆道手术的安全性。方法:回顾性分析267例65周岁以上老年人行胆道手术的临床资料。结果:实施腹腔镜胆囊切除术69例,开腹胆囊切除术124例,开腹胆囊切除+胆总管切开取石“T”管引流术56例,再次胆总管切开取石“T”管引流术18例,手术过程均顺利,术后并发切口感染5例,切口裂开1例,切口疝1例,急性支气管炎5例。结论:老年人并发慢性病较多,重视围手术期处理,在基层医院实施胆道手术是安全的。

  10. Mutation of androgen receptor N-terminal phosphorylation site Tyr-267 leads to inhibition of nuclear translocation and DNA binding.

    Directory of Open Access Journals (Sweden)

    Mehmet Karaca

    Full Text Available Reactivation of androgen receptor (AR may drive recurrent prostate cancer in castrate patients. Ack1 tyrosine kinase is overexpressed in prostate cancer and promotes castrate resistant xenograft tumor growth and enhances androgen target gene expression and AR recruitment to enhancers. Ack1 phosphorylates AR at Tyr-267 and possibly Tyr-363, both in the N-terminal transactivation domain. In this study, the role of these phosphorylation sites was investigated by characterizing the phosphorylation site mutants in the context of full length and truncated AR lacking the ligand-binding domain. Y267F and Y363F mutants showed decreased transactivation of reporters. Expression of wild type full length and truncated AR in LNCaP cells increased cell proliferation in androgen-depleted conditions and increased colony formation. However, the Y267F mutant of full length and truncated AR was defective in stimulating cell proliferation. The Y363F mutant was less severely affected than the Y267F mutant. The full length AR Y267F mutant was defective in nuclear translocation induced by androgen or Ack1 kinase. The truncated AR was constitutively localized to the nucleus. Chromatin immunoprecipitation analysis showed that it was recruited to the target enhancers without androgen. The truncated Y267F AR mutant did not exhibit constitutive nuclear localization and androgen enhancer binding activity. These results support the concept that phosphorylation of Tyr-267, and to a lesser extent Tyr-363, is required for AR nuclear translocation and recruitment and DNA binding and provide a rationale for development of novel approaches to inhibit AR activity.

  11. Conceptual design of the 26.7 MHz RF system for RHIC

    International Nuclear Information System (INIS)

    The 26.7 MHz (harmonic No. h=342) RF system will be used to capture the injected bunched beam from the AGS and accelerate it to a kinetic energy of up to 250 GeV for protons; 100 GeV/u for gold ions. All ions except protons cross transition, and are finally transferred to a storage RF system working at 196 MHz. Each RHIC ring will be provided with two single-ended capacitively loaded quarter-wave cavities; each of these can be dynamically tuned by 100 kHz to compensate for the change in speed of the beam, and can deliver at least 200 kV voltage. A 100 kW tetrode amplifier with local RF feedback is directly coupled to the cavity to minimize phase delay. Prototypes of cavity and amplifier have been built and first test results are presented

  12. 77 FR 2699 - Foreign-Trade Zone 267-Fargo, ND; Application for Temporary/Interim Manufacturing Authority, CNH...

    Science.gov (United States)

    2012-01-19

    ... Manufacturing Authority, CNH America, LLC (Agricultural and Construction Equipment Manufacturing); Fargo, ND An... Fargo Municipal Airport Authority, grantee of FTZ 267, requesting temporary/interim manufacturing (T/IM... 8429.51) (Board Order 1639, 74 FR 41373, 8/17/2009). Under T/IM procedures, CNH has...

  13. 40 CFR 267.1105 - What do I do if my containment building contains areas both with and without secondary containment?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What do I do if my containment building contains areas both with and without secondary containment? 267.1105 Section 267.1105 Protection... OWNERS AND OPERATORS OF HAZARDOUS WASTE FACILITIES OPERATING UNDER A STANDARDIZED PERMIT...

  14. C IV and C III] reverberation mapping of the luminous quasar PG 1247+267

    Energy Technology Data Exchange (ETDEWEB)

    Trevese, D.; Saturni, F. G. [Dipartimento di Fisica, Università di Roma La Sapienza, Piazzale Aldo Moro, 5, I-00185 Roma (Italy); Perna, M. [Dipartimento di Fisica e Astronomia, Università di Bologna, Viale Berti Pichat 6/2, I-40127 Bologna (Italy); Vagnetti, F. [Dipartimento di Fisica, Università di Roma Tor Vergata, Via della Ricerca Scientifica 1, I-00133 Roma (Italy); Dadina, M. [INAF-IASF Bologna, Via Gobetti 101, I-40129 Bologna (Italy)

    2014-11-10

    So far the masses of about 50 active galactic nuclei (AGNs) have been measured through the reverberation mapping technique (RM). Most measurements have been performed for objects of moderate luminosity and redshift, based on Hβ, which is also used to calibrate the scaling relation that allows single-epoch (SE) mass determination based on AGN luminosity and the width of different emission lines. Due to the complex structure and gas dynamics of the relevant emission region, the SE masses obtained from the C IV(1549 Å) line show a large spread around the mean values. Direct RM measures of C IV exist for only six AGNs of low luminosity and redshift, and only one luminous quasar. Since 2003, we have collected photometric and spectroscopic observations of PG1247+267, the most luminous quasar ever analyzed for RM. We provide light curves for the continuum and for C IV(1549 Å) and C III](1909 Å), and measures of the reverberation time lags based on the SPEAR method. The sizes of the line emission regions assume a ratio of R {sub C} {sub III]}/R {sub C} {sub IV} ∼ 2, similar to the case of Seyfert galaxies, indicating for the first time a similar ionization stratification in a luminous quasar and low-luminosity nuclei. Due to the relatively small size of the broad line region and the relatively narrow line widths, we estimate a small mass and an anomalously high Eddington ratio. We discuss the possibility that either the shape of the emission region or an amplification of the luminosity caused by gravitational lensing may be partly responsible for the result.

  15. C IV and C III] reverberation mapping of the luminous quasar PG 1247+267

    International Nuclear Information System (INIS)

    So far the masses of about 50 active galactic nuclei (AGNs) have been measured through the reverberation mapping technique (RM). Most measurements have been performed for objects of moderate luminosity and redshift, based on Hβ, which is also used to calibrate the scaling relation that allows single-epoch (SE) mass determination based on AGN luminosity and the width of different emission lines. Due to the complex structure and gas dynamics of the relevant emission region, the SE masses obtained from the C IV(1549 Å) line show a large spread around the mean values. Direct RM measures of C IV exist for only six AGNs of low luminosity and redshift, and only one luminous quasar. Since 2003, we have collected photometric and spectroscopic observations of PG1247+267, the most luminous quasar ever analyzed for RM. We provide light curves for the continuum and for C IV(1549 Å) and C III](1909 Å), and measures of the reverberation time lags based on the SPEAR method. The sizes of the line emission regions assume a ratio of R C III]/R C IV ∼ 2, similar to the case of Seyfert galaxies, indicating for the first time a similar ionization stratification in a luminous quasar and low-luminosity nuclei. Due to the relatively small size of the broad line region and the relatively narrow line widths, we estimate a small mass and an anomalously high Eddington ratio. We discuss the possibility that either the shape of the emission region or an amplification of the luminosity caused by gravitational lensing may be partly responsible for the result.

  16. 267 Spanish Exomes Reveal Population-Specific Differences in Disease-Related Genetic Variation.

    Science.gov (United States)

    Dopazo, Joaquín; Amadoz, Alicia; Bleda, Marta; Garcia-Alonso, Luz; Alemán, Alejandro; García-García, Francisco; Rodriguez, Juan A; Daub, Josephine T; Muntané, Gerard; Rueda, Antonio; Vela-Boza, Alicia; López-Domingo, Francisco J; Florido, Javier P; Arce, Pablo; Ruiz-Ferrer, Macarena; Méndez-Vidal, Cristina; Arnold, Todd E; Spleiss, Olivia; Alvarez-Tejado, Miguel; Navarro, Arcadi; Bhattacharya, Shomi S; Borrego, Salud; Santoyo-López, Javier; Antiñolo, Guillermo

    2016-05-01

    Recent results from large-scale genomic projects suggest that allele frequencies, which are highly relevant for medical purposes, differ considerably across different populations. The need for a detailed catalog of local variability motivated the whole-exome sequencing of 267 unrelated individuals, representative of the healthy Spanish population. Like in other studies, a considerable number of rare variants were found (almost one-third of the described variants). There were also relevant differences in allelic frequencies in polymorphic variants, including ∼10,000 polymorphisms private to the Spanish population. The allelic frequencies of variants conferring susceptibility to complex diseases (including cancer, schizophrenia, Alzheimer disease, type 2 diabetes, and other pathologies) were overall similar to those of other populations. However, the trend is the opposite for variants linked to Mendelian and rare diseases (including several retinal degenerative dystrophies and cardiomyopathies) that show marked frequency differences between populations. Interestingly, a correspondence between differences in allelic frequencies and disease prevalence was found, highlighting the relevance of frequency differences in disease risk. These differences are also observed in variants that disrupt known drug binding sites, suggesting an important role for local variability in population-specific drug resistances or adverse effects. We have made the Spanish population variant server web page that contains population frequency information for the complete list of 170,888 variant positions we found publicly available (http://spv.babelomics.org/), We show that it if fundamental to determine population-specific variant frequencies to distinguish real disease associations from population-specific polymorphisms. PMID:26764160

  17. NuSTAR reveals the extreme properties of the super-Eddington accreting SMBH in PG 1247+267

    CERN Document Server

    Lanzuisi, G; Comastri, A; Cappi, M; Dadina, M; Marinucci, A; Masini, A; Matt, G; Vagnetti, F; Vignali, C; Ballantyne, D R; Bauer, F E; Boggs, S E; Brandt, W N; Brusa, M; Christensen, F E; Craig, W W; Fabian, A C; Farrah, D; Hailey, C J; Harrison, F A; Luo, B; Piconcelli, E; Puccetti, S; Ricci, C; Saez, C; Stern, D; Walton, D J; Zhang, W W

    2016-01-01

    PG1247+267 is one of the most luminous known quasars at $z\\sim2$ and is a strongly super-Eddington accreting SMBH candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad band covered by the new NuSTAR and the archival XMM-Newton data. Several measurements are in agreement with the super-Eddington scenario for PG1247+267: the soft power law ($\\Gamma=2.3\\pm0.1$); the weak ionized Fe emission line and a hint of the presence of outflowing ionized gas surrounding the SMBH. The presence of an extreme reflection component is instead at odds with the high accretion rate proposed for this quasar. This can be explained with three different scenarios; all of them are in good agreement with the existing data, but imply very different conclusions: i) a variable primary power law observed in a low state, superimposed on a reflection component echoing a past, higher flux state; ii) a power law continuum obscured by an ionized, Comp...

  18. Improved hydrogen release from LiB0.33N0.67H2.67 with metal additives: Ni, Fe, and Zn

    International Nuclear Information System (INIS)

    We have examined the effect of adding small quantities of Fe, Ni, and Zn, or their dichlorides, on the dehydrogenation temperature of the new quaternary hydride material LiB0.33N0.67H2.67. NiCl2 proved to be an especially effective dehydrogenation promoter. The hydrogen release temperature, represented by the temperature T 1/2 at which the hydrogen release reaction is half completed, decreased by ΔT 1/2 = -104 oC for 5 wt% NiCl2 addition and by ΔT 1/2 = -112 oC for 11 wt% NiCl2 addition compared to that of additive-free LiB0.33N0.67H2.67. This represents a significant improvement over the maximum temperature reduction of ΔT 1/2 = -90 oC achieved previously with Pt/Vulcan carbon additive (Pt nanoparticles supported on a Vulcan carbon substrate). Transmission electron microscopy on LiB0.33N0.67H2.67 + 11 wt% NiCl2 revealed uniformly dispersed nanoparticles with diameters less than 8 nm within the LiB0.33N0.67H2.67 matrix, consistent with reduction of the NiCl2 to metallic Ni during synthesis by ball milling. Mass spectrometry of the evolved gas showed that the total amount of NH3 released concurrently during dehydrogenation of LiB0.33N0.67H2.67 + 5 wt% NiCl2 was reduced by an order of magnitude compared to the additive-free material, and by a factor of four compared to LiB0.33N0.67H2.67 + 5 wt% Pt/Vulcan carbon. In contrast to additive-free LiB0.33N0.67H2.67, which melts completely above 190 oC and releases hydrogen from the liquid state only above about 250 oC, hydrogen release from LiB0.33N0.67H2.67 + 5 wt% NiCl2 is accompanied by partial melting above 190 oC plus transformation to a new, hydrogen-poor solid intermediate phase. Addition of 5 wt% FeCl2 gave ΔT 1/2 = -36 oC, but Fe, Zn, and ZnCl2 additives did not produce significant improvement

  19. 多位点PCR技术用于四川267株分枝杆菌临床分离株的鉴定%Species identification of 267 Mycobacterium clinical isolates in Sichuan province by multi-locus PCR

    Institute of Scientific and Technical Information of China (English)

    邓建平; 董海燕; 李群; 赵秀芹; 连璐璐; 肖体权; 万康林

    2012-01-01

    目的 初步了解四川省肺结核患者分枝杆菌菌种类型.方法 收集267株分枝杆菌临床菌株,经PNB/TCH鉴别培养基进行培养鉴定后,采用聚合酶链反应(PCR)对16S rRNA、Rv0577、IS1561、Rv1510、Rv1970、Rv3877/8和Rv3120基因位点进行扩增,鉴定至种,再经PRA-rpoB、hsp65基因测序进行验证.结果 267株分枝杆菌临床分离株多位点PCR结果显示结核分枝杆菌262株,非洲分枝杆菌Ⅰ型3株,非结核分枝杆菌2株.PNB/TCH鉴别培养基培养鉴定结果为结核分枝杆菌复合群266株,非结核分枝杆菌1株.2株非结核分枝杆菌分别为鸟分枝杆菌(M.avium)和脓毒分枝杆菌(M.septicum).多位点PCR结果与rpoB-PRA、hsp65基因测序结果一致.结论 多位点PCR技术鉴定分枝杆菌菌种结果准确可靠,且具有简便和快速等优点,有较大的分子流行病学应用价值,且对于临床诊断和治疗都具有重要意义.%Objective To understand the species of Mycobacteria isolated from TB patients in Sichuan. Methods Multi-locus PCR was conducted to amplify 7 specific DNA fragments of 16S rRNA, Rv0577, /51561, Rvl510, /fvl970, Rv3877/8 and Sv3120 in the genome of 267 Mycobacterium strains which had been identified by PNB/TCH previously. Their species were verified by PRA-rpoB. identification and hsp65 sequencing. Results The multi-locus PCR results showed that 262 strains belonged to Mycobacterium tuberculosis complex (MTBC), 3 belonged to Mycobacterium africanum type I and 2 were non-tuberculosis mycobacterium (NTM) strains, and by PRA-rpoB identification and hsp65 sequencing, 2 NTM strains were Mycobacterium avium and Mycobacterium septicum respectively While PNB/ TCH result showed that 266 strains belonged to MTBC, 1 was NTM. The result of multi-locus PCR was consistent with that of rpoB-PRA identification and hsp65. sequencing Conclusion Multi-locus PCR is a rapid and effective method for the species identification of Mycobacterium and can be used in

  20. 267例乙型肝炎病毒前S1抗原检测的临床意义%Clinical Significance of Detecting the Serum PreS1 Antigen in 267 Patients with Heptatitis B Virus

    Institute of Scientific and Technical Information of China (English)

    李俊

    2008-01-01

    目的:传统乙肝血清标志物是目前我国用于乙肝检测与筛查的普及指标,但其在检测病毒复制等方面尚有不足.本研究分析了前S1抗原(PreS1)和乙型肝炎病毒(HBV)血清标志物之间的关系,探讨了乙型肝炎病毒前S1蛋白在临床上的应用价值.方法:对267例乙型肝炎表面抗原(HBsAg)阳性患者血清标本用酶联免疫吸附试验(ELISA)检测HBV血清标志物和PreS1抗原,同时采用聚合酶链反应(PCR)检测HBV-DNA.结果:267例乙型肝炎患者PreS1抗原和HBV-DNA的检出率分别为67.0%和76.0%;其中HBeAg(+)165例中,PreS1抗原阳性147例,HBV DNA阳性155例,阳性检出率分别为89.1%和93.9%.HBeAg(-)102例,Pre S1抗原阳性32例,HBV-DNA阳性48例,阳性检出率分别为31.4%和47.1%.HBV-DNA检出率稍高于PreS1 Ag的检出率,但两者的检出率差异无统计学意义(P>0.05).结论:前S1蛋白与HBV-DNA的一致性较好,在反映乙型肝炎病毒复制情况方面比很敏感,可作为临床上乙型肝炎病毒感染的诊断的一项理想的检测指标.

  1. NuSTAR reveals the extreme properties of the super-Eddington accreting supermassive black hole in PG 1247+267

    DEFF Research Database (Denmark)

    Lanzuisi, G.; Perna, M.; Comastri, A.;

    2016-01-01

    PG1247+267 is one of the most luminous known quasars at z similar to 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad...

  2. 267名精神卫生专业人员对重性精神病的病耻感认知%Attitude toward the stigma related to severe mental illness in 267 mental health professionals

    Institute of Scientific and Technical Information of China (English)

    易嘉龙; 刘津; 郭金华; 吴静; 吴霞民; 马弘

    2011-01-01

    @@ 精神病患者的病耻感是指因疾病受到的排斥和歧视的态度,其核心概念为刻板印象、偏见和歧视.目前我国相关的研究甚少,为数不多的研究多集中在调查公众对精神疾病的认知和态度上.在中国知网学术文献网络出版总库中以"病耻感"为关键词对1979年以来的文献进行检索,仅检索到29篇文章,其中无一篇针对精神卫生专业人员的研究.本文对来自全国30个省、自治区、直辖市的267名精神卫生专业人员进行了有关病耻感认知和临床工作中态度和行为的初步调查.

  3. A high-quality factor of 267 000 micromechanical silicon resonator utilizing TED-free torsional vibration mode

    International Nuclear Information System (INIS)

    In industrial applications of a micromechanical silicon resonator as a physical sensor, a high-quality factor Q and a low-temperature coefficient of Q (TCQ) are required for high sensitivity in a wide temperature range. Although the newly developed thin film encapsulation technique enables a beam to operate with low viscous damping in a vacuum cavity, the Q of a flexural vibration mode is limited by thermo-elastic damping (TED). We proposed a torsional beam resonator which features both a high Q and a low TCQ because theoretically the torsional vibration mode does not suffer from TED. From experiments, Q of 267 000 and TCQ of 1.4 for the 20 MHz torsional vibration mode were observed which were superior to those of the flexural mode. The pressure of the residual gas in the cavity of only 20 pl volume, which is one of the energy loss factors limiting the Q, was successfully estimated to be 1–14 Pa. Finally, the possibilities of improving the Q and the difference of the measured TCQ from a theoretical value were discussed. (paper)

  4. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN267 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2011-07-29 to 2011-08-09 (NODC Accession 0104366)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104366 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN267 in the Coastal...

  5. Isobaric (vapor + liquid) equilibria of the binary system maleic anhydride and diethyl phthalate at p = (2.67, 5.33, and 8.00) kPa

    International Nuclear Information System (INIS)

    Saturated vapor pressures of pure diethyl phthalate were measured with the ebulliometer. And isobaric (vapor + liquid) equilibrium data for the binary system (maleic anhydride + diethyl phthalate) at p = (2.67, 5.33, and 8.00) kPa were determined using the ebulliometric method. The parameters of the NRTL model for the binary system were obtained by calculating equilibrium compositions of the liquid and vapor phase with the experimental equilibrium temperatures, pressures and feed compositions. Moreover (vapor + liquid) equilibrium data for the binary system were predicted by use of the UNIFAC model. Predicted results were compared with those from the ebulliometric method, and showed good agreement

  6. Penicibilaenes A and B, sesquiterpenes with a tricyclo[6.3.1.0(1,5)]dodecane skeleton from the marine isolate of Penicillium bilaiae MA-267.

    Science.gov (United States)

    Meng, Ling-Hong; Li, Xiao-Ming; Liu, Yang; Wang, Bin-Gui

    2014-12-01

    Penicibilaenes A (1) and B (2), two sesquiterpenes possessing a tricyclo[6.3.1.0(1,5)]dodecane skeleton, were characterized from Penicillium bilaiae MA-267, a fungus obtained from the rhizospheric soil of the mangrove plant Lumnitzera racemosa. The lack of some key COSY and NOESY correlations made the structure elucidation of compound 1 difficult, which was solved by a X-ray crystallographic study. Compounds 1 and 2 exhibited selective activity against the plant pathogenic fungus Colletotrichum gloeosporioides (MIC = 1.0 and 0.125 μg/mL, respectively). PMID:25408229

  7. NuSTAR reveals the extreme properties of the super-Eddington accreting supermassive black hole in PG 1247+267

    Science.gov (United States)

    Lanzuisi, G.; Perna, M.; Comastri, A.; Cappi, M.; Dadina, M.; Marinucci, A.; Masini, A.; Matt, G.; Vagnetti, F.; Vignali, C.; Ballantyne, D. R.; Bauer, F. E.; Boggs, S. E.; Brandt, W. N.; Brusa, M.; Christensen, F. E.; Craig, W. W.; Fabian, A. C.; Farrah, D.; Hailey, C. J.; Harrison, F. A.; Luo, B.; Piconcelli, E.; Puccetti, S.; Ricci, C.; Saez, C.; Stern, D.; Walton, D. J.; Zhang, W. W.

    2016-05-01

    PG1247+267 is one of the most luminous known quasars at z ~ 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad band covered by the new NuSTAR and the archival XMM-Newton data. Several measurements are in agreement with the super-Eddington scenario for PG1247+267: the soft power law (Γ = 2.3 ± 0.1); the weak ionized Fe emission line; and a hint of the presence of outflowing ionized gas surrounding the SMBH. The presence of an extreme reflection component is instead at odds with the high accretion rate proposed for this quasar. This can be explained with three different scenarios; all of them are in good agreement with the existing data, but imply very different conclusions: i) a variable primary power law observed in a low state, superimposed on a reflection component echoing a past, higher flux state; ii) a power law continuum obscured by an ionized, Compton thick, partial covering absorber; and iii) a relativistic disk reflector in a lamp-post geometry, with low coronal height and high BH spin. The first model is able to explain the high reflection component in terms of variability. The second does not require any reflection to reproduce the hard emission, while a rather low high-energy cutoff of ~100 keV is detected for the first time in such a high redshift source. The third model require a face-on geometry, which may affect the SMBH mass and Eddington ratio measurements. Deeper X-ray broad-band data are required in order to distinguish between these possibilities.

  8. A non-peptide oxytocin receptor agonist, WAY-267,464, alleviates novelty-induced hypophagia in mice: insights into changes in c-Fos immunoreactivity.

    Science.gov (United States)

    Olszewski, Pawel K; Ulrich, Christine; Ling, Nicholas; Allen, Kerry; Levine, Allen S

    2014-09-01

    Anxiety caused by the novelty of food or of the environment where the food is presented leads to suppression of consumption (hyponeophagia) reflected by an increased latency to begin feeding and decreased food intake. Studies suggest that some anxiolytics, mainly benzodiazepines and SSRIs, resolve hyponeophagia. Though the neurohormone oxytocin (OT) affects both anxiety responsiveness and feeding-related homeostasis, the link between OT and hyponeophagia has not been established. The current experiments examined the effect of OT receptor stimulation on hyponeophagia in mice and associated changes in brain activity. We found that the OT receptor agonist, WAY-267,464, at 10 and 30 mg/kg b. wt. IP, reduced the latency to approach food and increased the amount of food eaten in hyponeophagia tests differing in animals' motivation to eat (hunger, reward) and the anxiogenic context of environmental novelty (illumination and type of the cage). This effect was abolished by the pretreatment with the OT receptor antagonist, L-368,899, at 10mg/kg b. wt. The antagonist also suppressed social transmission of preference for novel food. Mice subjected to novelty conditions causing hypophagia showed significant changes in c-Fos immunoreactivity in the hippocampus, lateral septum, cingulate and piriform cortex and in the bed nucleus of the stria terminalis, lateral division, posterolateral part (STLP). The pretreatment with WAY-267,464 restored c-Fos levels in the STLP to values detected in control animals subjected to non-anxiogenic conditions. We conclude that OT plays a role in shaping the magnitude of the novelty stress-provoked hypophagia and the activity of the relevant neural networks. PMID:25038444

  9. Nisin Z Production by Lactococcus lactis subsp. cremoris WA2-67 of Aquatic Origin as a Defense Mechanism to Protect Rainbow Trout (Oncorhynchus mykiss, Walbaum) Against Lactococcus garvieae.

    Science.gov (United States)

    Araújo, Carlos; Muñoz-Atienza, Estefanía; Pérez-Sánchez, Tania; Poeta, Patrícia; Igrejas, Gilberto; Hernández, Pablo E; Herranz, Carmen; Ruiz-Zarzuela, Imanol; Cintas, Luis M

    2015-12-01

    Probiotics represent an alternative to chemotherapy and vaccination to control fish diseases, including lactococcosis caused by Lactococcus garvieae. The aims of this study were (i) to determine the in vitro probiotic properties of three bacteriocinogenic Lactococcus lactis subsp. cremoris of aquatic origin, (ii) to evaluate in vivo the ability of L. cremoris WA2-67 to protect rainbow trout (Oncorhynchus mykiss, Walbaum) against infection by L. garvieae, and (iii) to demonstrate the role of nisin Z (NisZ) production as an anti-infective mechanism. The three L. cremoris strains survived in freshwater at 18 °C for 7 days, withstood exposure to pH 3.0 and 10 % (v/v) rainbow trout bile, and showed different cell surface hydrophobicity (37.93-58.52 %). The wild-type NisZ-producer L. cremoris WA2-67 and its non-bacteriocinogenic mutant L. cremoris WA2-67 ∆nisZ were administered orally (10(6) CFU/g) to rainbow trout for 21 days and, subsequently, fish were challenged with L. garvieae CLG4 by the cohabitation method. The fish fed with the bacteriocinogenic strain L. cremoris WA2-67 reduced significantly (p fish farming to prevent lactococcosis in rainbow trout. PMID:26307018

  10. Locus: 267 [ASTRA[Archive

    Lifescience Database Archive (English)

    Full Text Available Hs.153648 H. sapiens + S: gi|29824572|ref|NC_000001.4|NC_000001 NC_000001 Homo sapiens cDNA FLJ4 ... nteracting protein (liprin), alpha 2 (PPFIA2) cell communication ... | intracellular | molecular_function unknown Alt. ...

  11. Improved hydrogen release from LiB{sub 0.33}N{sub 0.67}H{sub 2.67} with metal additives: Ni, Fe, and Zn

    Energy Technology Data Exchange (ETDEWEB)

    Pinkerton, Frederick E. [Materials and Processes Laboratory, General Motors Research and Development Center, MC 480-106-224, 30500 Mound Road, Warren, MI 48090-9055 (United States)]. E-mail: frederick.e.pinkerton@gm.com; Meyer, Martin S. [Materials and Processes Laboratory, General Motors Research and Development Center, MC 480-106-224, 30500 Mound Road, Warren, MI 48090-9055 (United States); Meisner, Gregory P. [Materials and Processes Laboratory, General Motors Research and Development Center, MC 480-106-224, 30500 Mound Road, Warren, MI 48090-9055 (United States); Balogh, Michael P. [Chemical and Environmental Sciences Laboratory, General Motors Research and Development Center, MC 480-106-320, 30500 Mound Road, Warren, MI 48090-9055 (United States)

    2007-05-16

    We have examined the effect of adding small quantities of Fe, Ni, and Zn, or their dichlorides, on the dehydrogenation temperature of the new quaternary hydride material LiB{sub 0.33}N{sub 0.67}H{sub 2.67}. NiCl{sub 2} proved to be an especially effective dehydrogenation promoter. The hydrogen release temperature, represented by the temperature T {sub 1/2} at which the hydrogen release reaction is half completed, decreased by {delta}T {sub 1/2} = -104 {sup o}C for 5 wt% NiCl{sub 2} addition and by {delta}T {sub 1/2} = -112 {sup o}C for 11 wt% NiCl{sub 2} addition compared to that of additive-free LiB{sub 0.33}N{sub 0.67}H{sub 2.67}. This represents a significant improvement over the maximum temperature reduction of {delta}T {sub 1/2} = -90 {sup o}C achieved previously with Pt/Vulcan carbon additive (Pt nanoparticles supported on a Vulcan carbon substrate). Transmission electron microscopy on LiB{sub 0.33}N{sub 0.67}H{sub 2.67} + 11 wt% NiCl{sub 2} revealed uniformly dispersed nanoparticles with diameters less than 8 nm within the LiB{sub 0.33}N{sub 0.67}H{sub 2.67} matrix, consistent with reduction of the NiCl{sub 2} to metallic Ni during synthesis by ball milling. Mass spectrometry of the evolved gas showed that the total amount of NH{sub 3} released concurrently during dehydrogenation of LiB{sub 0.33}N{sub 0.67}H{sub 2.67} + 5 wt% NiCl{sub 2} was reduced by an order of magnitude compared to the additive-free material, and by a factor of four compared to LiB{sub 0.33}N{sub 0.67}H{sub 2.67} + 5 wt% Pt/Vulcan carbon. In contrast to additive-free LiB{sub 0.33}N{sub 0.67}H{sub 2.67}, which melts completely above 190 {sup o}C and releases hydrogen from the liquid state only above about 250 {sup o}C, hydrogen release from LiB{sub 0.33}N{sub 0.67}H{sub 2.67} + 5 wt% NiCl{sub 2} is accompanied by partial melting above 190 {sup o}C plus transformation to a new, hydrogen-poor solid intermediate phase. Addition of 5 wt% FeCl{sub 2} gave {delta}T {sub 1/2} = -36 {sup o}C, but

  12. Synthesis, radiosynthesis, and in vitro evaluation of [131I]-5-iodo-N-[2-(6,7-dimethoxy-3,4-dihydro-1H-isoquinoline-2-yl)-ethyl] -2-methoxy-benzamide as a potential tumor imaging agent

    International Nuclear Information System (INIS)

    This work reports the synthesis, radiolabeling and preliminary in vitro evaluation of [131I]-5-iodo-N-[2-(6,7-dimethoxy-3,4-dihydro-1H-isoquinoline-2-yl)-ethyl] -2-methoxy-benzamide. The tributylstannylprecursor was synthesized with a yield of 38%. Radiolabeling was performed using an electrophilic iododestannylation. Tracer yield was 94%, radiochemical purity was >95%. The tracer showed high uptake in MCF-7 breast cancer cell line and therefore will be evaluated further

  13. Clinical distribution and resistance analyses of acinetobacter baumanii%267株鲍曼不动杆菌感染临床分布与耐药性分析

    Institute of Scientific and Technical Information of China (English)

    曾雪峰; 陈锋; 王晓霞; 李凯; 李群

    2011-01-01

    Objective To investigate the clinical distribution and the drug resistance of acinetobacter baumanii in order to offer reference for the clinical therapeutics. Methods The distribution and the susceptibility results of Baumanii in our hospital from Jan. 2009to. Dec. 2009 were analyzed retrospectively. Results The majority of these resistant strains were isolated from sputum,and distributed in ICUs. The resistant rates of 267 strains to Cefoxitin, Aztreonam, Piperacillin, Piperacillin/tazobactam, Ticarcillin/Clavulanic Acid, Cefotaxime and Cefepime is 100%, 85.0%, 76.8%, 71.5%, 70.8%, 67.8%, 65.2% respectively. Conclusion The drug-resistance of Acinetobacter baumannii is severe in our hospital. and Imipenem or Cefeperazone/sulbactam was recommended.%目的 了解鲍曼不动杆菌的临床分布及其对常用抗生素的耐药状况,为临床使用抗生素治疗提供依据.方法 对我院2009年1月~2009年12月住院患者送检标本分离的287株鲍曼不动杆菌的分布及药敏结果进行回顾性分析.结果 267株鲍曼不动杆菌大多分离自痰液,主要来自于ICU病房;鲍曼不动杆菌对头孢西丁耐药率最高,为100 %,依次是氨曲南(85.0%)、哌拉西林(76.8%)、哌拉西林/三唑巴坦(71.5%)、替卡西林/克拉维酸(70.8%)、头孢噻肟(67.8 %)、头孢吡肟(65.2%)等.结论 我院鲍曼不动杆菌耐药情况严重,治疗首选碳青霉烯类抗生素,其次可选用头孢哌酮/舒巴坦.

  14. 7 CFR 1822.267 - Special conditions.

    Science.gov (United States)

    2010-01-01

    ... with the following: (1) The requirements of 7 CFR 3550.70 must be met and a conditional commitment... Board of Directors or similar governing body using a form entitled, “((Rural Housing Site) Loan to... be used if permitted by State law. (l) Conditional commitments for construction of homes on...

  15. 12 CFR 267.3 - Members.

    Science.gov (United States)

    2010-01-01

    ... persons to fill vacancies on the Council. (b) Resignation. Any member may resign at any time by giving notice to the Board. Any such resignation shall take effect upon its acceptance by the Board....

  16. 12 CFR 267.5 - Meetings.

    Science.gov (United States)

    2010-01-01

    ..., DC, in accordance with the provisions of 12 CFR part 261 Rules Regarding Availability of Information...) Disclose trade secrets and commercial or financial information obtained from a person and privileged or... arbitration involving the Board or the Council. (e) If the Board closes a meeting or any portion of a...

  17. Effect of (Ca0.8Sr0.2)0.6La0.267TiO3 on Phase, Microstructure, and Microwave Dielectric Properties of Mg0.95Zn0.05TiO3 Synthesized by Polymeric Precursor Method

    Science.gov (United States)

    Naeem, Abdul; Ullah, Asad; Mahmood, Tahira; Iqbal, Yaseen; Mahmood, Asad; Hamayun, Muhammad

    2016-08-01

    A number of compounds in the (1 - x)Mg0.95Zn0.05TiO3- x(Ca0.8Sr0.2)0.6 La0.267TiO3 ( x = 0 to 0.25) composition series have been obtained via a polymeric precursor route to investigate the effect of increasing (Ca0.8Sr0.2)0.6La0.267TiO3 proportion on the phase, microstructure, and microwave dielectric properties of the sintered ceramics. Composite powders having nanometric particles were obtained by calcining the precursors at 700°C. Refinement results revealed that these samples comprised a mixture of Mg0.95Zn0.05TiO3 and (Ca0.8Sr0.2)0.6La0.267TiO3 ceramics. A combination of optimum microwave dielectric properties, i.e., dielectric constant of 25.17, quality factor of 58,754 GHz, and temperature coefficient of resonant frequency of -5.8 ppm/°C, was achieved for the x = 0.2 composition sintered at 1200°C.

  18. Long-range ordering in the Bi 1-xAe xFeO 3-x/2 perovskites: Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75

    Science.gov (United States)

    Lepoittevin, C.; Malo, S.; Barrier, N.; Nguyen, N.; Van Tendeloo, G.; Hervieu, M.

    2008-10-01

    Two-ordered perovskites, Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75, have been stabilized and characterized by transmission electron microscopy, Mössbauer spectroscopy and X-ray powder diffraction techniques. They both exhibit orthorhombic superstructures, one with a≈ b≈2 ap and c≈3 ap (S.G.: Pb2 n or Pbmn) for the Sr-based compound and one with a≈ b≈2 ap and c≈8 ap (S.G.: B222, Bmm2, B2 mm or Bmmm) for the Ca-based one. The high-resolution transmission electron microscopy (HRTEM) images evidence the existence of one deficient [FeO x] ∞ layer, suggesting that Bi 1/3Sr 2/3FeO 2.67 and Bi 1/2Ca 1/2FeO 2.75 behave differently compared to their Ln-based homolog. The HAADF-STEM images allow to propose a model of cation ordering on the A sites of the perovskite. The Mössbauer analyses confirm the trivalent state of iron and its complex environment with three types of coordination. Both compounds exhibit a high value of resistivity and the inverse molar susceptibility versus temperature curves evidence a magnetic transition at about 730 K for the Bi 1/3Sr 2/3FeO 2.67 and a smooth reversible transition between 590 and 650 K for Bi 1/2Ca 1/2FeO 2.75.

  19. Long-range ordering in the Bi1-xAexFeO3-x/2 perovskites: Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75

    International Nuclear Information System (INIS)

    Two-ordered perovskites, Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75, have been stabilized and characterized by transmission electron microscopy, Moessbauer spectroscopy and X-ray powder diffraction techniques. They both exhibit orthorhombic superstructures, one with a∼b∼2ap and c∼3ap (S.G.: Pb2n or Pbmn) for the Sr-based compound and one with a∼b∼2ap and c∼8ap (S.G.: B222, Bmm2, B2mm or Bmmm) for the Ca-based one. The high-resolution transmission electron microscopy (HRTEM) images evidence the existence of one deficient [FeOx]∞ layer, suggesting that Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75 behave differently compared to their Ln-based homolog. The HAADF-STEM images allow to propose a model of cation ordering on the A sites of the perovskite. The Moessbauer analyses confirm the trivalent state of iron and its complex environment with three types of coordination. Both compounds exhibit a high value of resistivity and the inverse molar susceptibility versus temperature curves evidence a magnetic transition at about 730 K for the Bi1/3Sr2/3FeO2.67 and a smooth reversible transition between 590 and 650 K for Bi1/2Ca1/2FeO2.75. - Graphical abstract: Complex long-range ordering of Bi/Ae cations and oxygen/vacancies consisting of 12-fold and 32-fold enlargement of the perovskite unit cell is observed in Bi1/3Sr2/3FeO2.67 and Bi1/2Ca1/2FeO2.75, respectively

  20. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  1. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  2. Electrochemical hydrogen-storage properties of La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.}-5 composites

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Hongxia, E-mail: hhxhunan@126.com [Key Lab of New Processing Technology for Nonferrous Metals and Materials Ministry of Education, Guilin University of Technology, Guilin (China); Li, Guohui [Guangxi Scientific Experiment Center of Mining, Metallurgy and Environment, College of Chemistry and Bioengineering, Guilin University of Technology, Guilin (China); Zhuang, Shuxin [School of Material Science and engineering, Xiamen University of Technology, Xiamen (China)

    2013-07-15

    For improving the electrochemical properties of nonstoichiometric AB{sub 3} -type La{sub 0.7}8Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52} alloy as negative electrode of Ni-MH battery, its related composites La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-x wt.% M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.5} (x = 0, 10, 20, 30) were prepared. Analysis by X-ray diffractometry (XRD) revealed that the composites consist mainly of LaNi{sub 5} and La{sub 2}Ni{sub 7} phases. Despite the small decrease in the maximum discharge capacity, the cycle performance was significantly enhanced. Linear polarization (LP), anodic polarization (AP) and potential step discharge experiments revealed that the electrochemical kinetics increases first and then decreases with increasing x. (author)

  3. 40 CFR 267.143 - Financial assurance for closure.

    Science.gov (United States)

    2010-07-01

    ... surety bond instrument specified at 40 CFR 264.151(b), and the standby trust specified at 40 CFR 264.143... the surety bond instrument specified at 40 CFR 264.151(c), and the standby trust specified at 40 CFR... instrument specified in 40 CFR 264.151(d), and the standby trust specified in 40 CFR 264.143(d)(3)....

  4. 77 FR 267 - Marine Mammals; File No. 16621

    Science.gov (United States)

    2012-01-04

    ... National Oceanic and Atmospheric Administration RIN 0648-XA915 Marine Mammals; File No. 16621 AGENCY... Mammal Protection Act of 1972, as amended (MMPA; 16 U.S.C. 1361 et seq.), and the regulations governing the taking and importing of marine mammals (50 CFR part 216). The applicant requests a...

  5. 43 CFR 26.7 - Application format and instructions.

    Science.gov (United States)

    2010-10-01

    ...' State Grant Procedures Handbook. General instructions for completing the form by part numbers are: (a... State Grant Procedures Handbook for definitions of cost categories and for budget narrative instructions..., if residential project (types of facilities, age, condition, tents, cabins, dormitories, food...

  6. Dicty_cDB: VSD267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTAANAAAGTTTATTA AATTTTTTNATTATTTAANA sequence update 2001. 3.22 Translated Amino Acid sequence sgssk*mt*evnliefirffnylii*lnycclil...kkkktlvxxnnnk*nnxxxkkkkk kkkkkkkkkkkkkkxpxkk--- ---XRLLKXNXVGGQFXKVY*ifxlfx Frame B: sgssk*mt*evnliefirffnylii*lnycclil

  7. 39 CFR 267.5 - National Security Information.

    Science.gov (United States)

    2010-07-01

    ... appropriate provisions of these regulations are complied with; (ii) Chair a committee composed of the Manager... conduct an audit of the USPS national security information program; (iv) Process requests for sensitive... information. (b) Definitions. (1) In this section, National Security Information means information on...

  8. 1935 15' Quad #267 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  9. Dicty_cDB: SHC267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l*sr*ewsitl grsy*sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrket...nefsiigiwhn kwrski*yig*s*y*fsrdgrenastqgiprattattttatttkakr*rvvitkeetiin aik*ketc...rqrrf*nirdnhw*re--- ---vllh*l*vfglyqsl*kiqsfsfssv*fl*wcyqesfni*fleprdlmkpvrvvhhf g*kllifgelnklslvllvlifhhgekvplqslnflkle... discoideum cellulose synthase (dcsA) mRNA, complete cds. 1411 0.0 1 AC006097 |AC...ieces. 54 0.008 1 AC093323 |AC093323.3 Homo sapiens BAC clone RP11-539L10 from 4, complete sequence. 54 0.00

  10. Dicty_cDB: VSF267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cqsfh*klncqrsrstsycqtms**plalw**sinwfxc*splsfr*xmkkykt Translated Amino Acid sequ...AP EVLXGGSYDNAVDMWXIGVITYILLCGFPPFLCFISKLII*knfxr*l*fprtrmdscl* tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc*spl...BC074183 |pid:none) Xenopus laevis MGC82022 protein, m... 118 1e-38 (Q8IU85) RecName: Full=Calcium/cal...modulin-dependent protein kina... 120 2e-38 (Q8BW96) RecName: Full=Calcium/calmodulin-d...G0... 132 2e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 118 4e-39 BC074183_1(

  11. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  12. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  13. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  14. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  15. 267例小儿热性惊厥脑电图分析%EEG Analysis of 267 Children with Febrile Convulsion

    Institute of Scientific and Technical Information of China (English)

    苏斌

    1997-01-01

    @@ 热性惊厥是儿科常见病,多数病儿良性经过,没有后遗症,据报道2-4%的小儿有热性惊厥.在欧美的小儿5岁以下有2-5%至少有一次热性惊厥发生.在亚洲、日本发病率更高.我国发病率为3-6%,现将我院近几年的热性惊厥患儿的脑电图做如下分析.

  16. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Gammelsrud, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Solhaug, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Dendelé, B. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Sandberg, W.J. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Ivanova, L. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Kocbach Bølling, A. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Lagadic-Gossmann, D. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Refsnes, M.; Becher, R. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Eriksen, G. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Holme, J.A., E-mail: jorn.holme@fhi.no [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway)

    2012-05-15

    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  17. 40 CFR 267.194 - What installation requirements must I follow?

    Science.gov (United States)

    2010-07-01

    ... must support and protect ancillary equipment against physical damage and excessive stress due to settlement, vibration, expansion, or contraction. (b) You must provide the type and degree of corrosion... required in 40 CFR 270.11(d)....

  18. People and things. CERN Courier, Sep 1986, v. 26(7)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The next regular meeting of the Division of Particles and Fields of the American Physical Society will take place from 14-17 January 1987 in Salt Lake City, Utah, hosted by the Department of Physics of the University of Utah.; A meeting on Computing in High Energy Physics will be held from 2-6 February 1987 at Asilomar State Beach, Monterey, California, arranged by the Stanford Linear Accelerator Center (SLAC) and the Santa Cruz Institute for Particle Physics

  19. Corrigendum to "Impact and Cratering Rates onto Pluto" [Icarus 258 (2015) 267-288

    Science.gov (United States)

    Greenstreet, Sarah; Gladman, Brett; McKinnon, William B.

    2016-08-01

    The authors regret that an error was found in the code used to compute Charon primary crater densities by mistakenly using Pluto's diameter instead of Charon's diameter, causing the Charon cumulative crater density plots and R-plots (Figure 12) to have values that were too low by a factor of ≈12002/6002 ≈ 4. The corrected figure presented here implies younger surface ages (by roughly a factor of four) for Charon and should be used for interpretation of the New Horizons data.

  20. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    International Nuclear Information System (INIS)

    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  1. Yeast Interacting Proteins Database: YLR267W, YAL062W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ed by nitrogen and carbon sources Rows with this prey as prey (1) Rows with this ...alpha-ketoglutarate; rate of alpha-ketoglutarate utilization differs from Gdh1p; expression regulated by nitrogen and carbon sources

  2. SU-E-J-267: Change in Mean CT Intensity of Lung Tumors During Radiation Treatment

    International Nuclear Information System (INIS)

    Purpose: To evaluate CT intensity change of lung tumors during radiation therapy. Methods: Repeated 4D CT images were acquired on a CT simulator during the course of therapy for 27 lung cancer patients on IRB approved protocols. All subjects received definitive radiation treatment ± chemotherapy. CT scans were completed prior to treatment, and 2–7 times during the treatment course. Primary tumor was delineated by an experienced Radiation Oncologist. Contours were thresholded between −100 HU and 200 HU to remove airways and bone. Correlations between the change in the mean tumor intensity and initial tumor intensity, SUVmax, and tumor volume change rate were investigated. Reproducibility was assessed by evaluating the variation in mean intensity over all phases in 4DCT, for a subgroup of 19 subjects. Results: Reproducibility of tumor intensity between phases as characterized by the root mean square of standard deviation across 19 subjects was 1.8 HU. Subjects had a mean initial tumor intensity of 16.5 ± 11.6 HU and an overall reduction in HU by 10.3 ± 8.5 HU. Evaluation of the changes in tumor intensity during treatment showed a decrease of 0.3 ± 0.3 HU/day for all subjects, except three. No significant correlation was found between change in HU/day and initial HU intensity (p=0.53), initial PET SUVmax (p=0.69), or initial tumor volume (p=0.70). The rate of tumor volume change was weakly correlated (R2=0.05) with HU change (p=0.01). Conclusion: Most lung cancer subjects showed a marked trend of decreasing mean tumor CT intensity throughout radiotherapy, including early in the treatment course. Change in HU/day is not correlated with other potential early predictors for response, such as SUV and tumor volume change. This Result supports future studies to evaluate change in tumor intensity on CT as an early predictor of response

  3. 49 CFR 40.267 - What problems always cause an alcohol test to be cancelled?

    Science.gov (United States)

    2010-10-01

    ... the case of a screening test conducted on a saliva ASD or a breath tube ASD: (1) The STT or BAT reads... § 40.245(a)(8) for the saliva ASD and § 40.245(b)(8) for the breath tube ASD). (2) The saliva ASD does not activate (see § 40.245(a)(7); or (3) The device is used for a test after the expiration...

  4. Anabolic-Androgenic Steroids - doi:10.5020/18061230.2007.p267

    Directory of Open Access Journals (Sweden)

    Urival Magno Gomes Ferreira

    2012-01-01

    Full Text Available There are evidences of the increase in the consumption of anabolic steroids and the damages to health caused by their indiscriminate use, mainly among children and youngsters. The anabolic-androgenic steroids (AAS consist in testosterone and its derivatives. They are produced endogenously in the testicles and adrenal cortex and are responsible for the secondary sexual characteristics associated to masculinity. Although the results of the exogenous use of AAS are still controversial, they have been used for the increase of physical strength and muscle mass. These substances are directly related to different clinical conditions such as: bladder cancer, coronary disease, gynecomastia, hepatic disorders and cancer, and sterility. This study aimed at approaching relevant topics related to the drugs action mechanisms, ways of use and metabolism, and side effects, besides the importance of the prevention in the use of those drugs in most diverse age groups. The abusive use of anabolic-androgenic steroids consists in a problem that has gradually occurred, which has given rise to laws, rules and support groups turned to the prevention, education and restriction of their use.

  5. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  6. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  7. Korean red ginseng saponin fraction modulates radiation effects on LPS-induced NO production in RAW267.4 cells

    International Nuclear Information System (INIS)

    Korean Red Ginsengs are popular both as food and as a source of natural compounds of biopharmaceutical interest. Some Ginseng derived compounds such as saponin have been shown to be anti-inflammatory; this study explores the radio-protective properties of Korean red ginseng saponin fraction (RGSF). We sought to identify the molecular mechanism of action of RGSF by determining their effects on Irradiation (IR) and lipopolysaccharide (LPS)-mediated inflammatory responses in murine macrophage cells. In activated RAW264.7 cells, RGSF strongly down regulated irradiated and LPS-mediated inflammatory responses, including Nitric Oxide production, Interleukin-1beta release, and expression of pro-inflammatory cytokine genes. RGSF was found to exert its radio-protective effects by inhibiting a signaling cascade that activates nuclear kappa B, but not mitogen-activated protein kinases. In particular, RGSF strongly inhibited the radiation-induced hemeoxyganase-1 (HO-1) expression, implying that HO-1 may be a potential pharmacological target of saponin. Taken together, our data suggest that RGSF, a functional compound in Ginseng, can be developed an effective radioprotective agent. (author)

  8. Status report: stress corrosion cracking of Ni-base and Ti alloys milestone No.wp267M4

    International Nuclear Information System (INIS)

    Susceptibility to stress corrosion cracking (SCC) of two candidate alloys for the inner container of the multibarrier nuclear waste package was evaluated by using wedge-loaded, precracked, double-cantilever-beam (DCB) specimens and the slow-strain-rate (SSR) test technique. Materials tested included Alloy C-22 and Ti Gr-12. A deaerated 90 C acidic brine (pH ∼ 2.70) containing 5 weight percent NaCl was used as the test environment. Both DCB and SSR tensile specimens were machined from mill-annealed plate materials. No additional thermal treatments were given to these specimens prior to their being exposed to the test solution. The DCB testing was performed for periods ranging from one through eight months. The initial and final stress intensity factor (KI and Kf) values were calculated using a standard fracture-mechanics equation. Fractographic evaluation of the broken DCB specimens was performed by using scanning electron microscopy (SEM) to analyze the characteristics of failures

  9. KOHN, Eduardo. How forests think: toward an anthropology beyond the human. Berkeley: University of California Press, 2013. 267 p.

    OpenAIRE

    Iara Maria de Almeida Souza

    2015-01-01

    How forests think, o título do livro soa intrigante. É possível afirmar que florestas pensam? Depois das críticas à centralidade do humano, do pós-humanismo, de toda discussão acerca do lugar dos não humanos na composição do mundo comum, talvez alguns de nós já estejamos convencidos de que os não humanos compartilham com os humanos a qualidade de agentes. Claro, desde que a noção de agência seja redefinida, deixe de estar vinculada a intenções, motivos, atribuição de significado, estes sim co...

  10. Corrigendum to "Dynamics of water clusters in solution with LiCl" [Physica A 442 (2016) 261-267

    Science.gov (United States)

    Corsaro, Carmelo; Mallamace, Domenico; Cicero, Nicola; Vasi, Sebastiano; Dugo, Giacomo; Mallamace, Francesco

    2016-06-01

    The authors regret that in order to complete the references chapter of the article above, authors would like to mention that parts of this article were presented also in their article in the EEED 2015 Proceedings.

  11. INTEGRAL detects the recurrent transients XTE J1709-267 and XTE J1739-285 in outburst

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, C.; Chenevez, Jérôme; Pavan, L.;

    2012-01-01

    20-40 keV band. We estimate a rough flux of ~8 mCrab (5 sigma) for an effective ISGRI exposure time of 21 ks. A preliminary spectral fit to the JEM-X data is consistent with an absorbed disk blackbody model of temperature ~2.2 keV. The onset of this outburst was also detected by MAXI http://maxi.riken.jp/top/index.php...

  12. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  13. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A.

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  14. Unity in Diversity: A Global Consensus on Choosing the IMF’s Managing Director—Evidence from CGD’s Online Survey - Working Paper 267

    OpenAIRE

    David Wheeler

    2011-01-01

    On May 19, 2011, the Center for Global Development launched an online survey of the global development community on three issues: the selection process for the IMF’s managing director, criteria for rating the candidates, and actual ratings for 15 candidates who had been named by the international media. Between May 19 and June 23, CGD received 790 responses from people whose characteristics reflect the diversity of the international finance and development community. Survey participants repre...

  15. SU-E-J-267: Weekly Volumetric and Dosimetric Changes in Adaptive Conformal Radiotherapy of Non-Small-Cell-Lung Cancer Using 4D CT and Gating

    Energy Technology Data Exchange (ETDEWEB)

    Li, Z [the 6th People' s Hospital of Shanghai Jiaotong University, Shanghai, Shanghai (China); Cleveland Clinic, Cleveland, OH (United States); Shang, Q [Cleveland Clinic, Cleveland, OH (United States); Xiong, F; Zhang, X; Zhang, Q; Fu, S [the 6th People' s Hospital of Shanghai Jiaotong University, Shanghai, Shanghai (China)

    2014-06-01

    Purpose: This study was to evaluate the significance of weekly imageguided patient setup and to assess the volumetric and dosimetric changes in no-small-cell-lung cancer (NSCLC) patients treated with adaptive conformal radiotherapy (CRT). Methods: 9 NSCLC patients treated with 3D CRT underwent 4D CT-on-rail every five fractions. ITV was generated from three phases of the 4DCT (the end of exhalation, 25% before and after the end of exhalation). The margin of ITV to PTV is 5mm. 6 weekly CTs were acquired for each patient. The weekly CTs were fused with the planning CT by vertebrae. The couch shift was recorded for each weekly CT to evaluate the setup error. The gross tumor volumes (GTVs) were contoured on weekly CT images by a physician. Beams from the original plans were applied to weekly CTs to calculate the delivered doses. All patients underwent replanning after 20 fractions. Results: Among the total 54 CTs, the average setup error was 2.0± 1.7, 2.6± 2.1, 2.7± 2.2 mm in X, Y, and Z direction, respectively. The average volume of the primary GTV was reduced from 42.45 cc to 22.78 cc (47.04%) after 6 weeks. The maximal volume regression occurred between 15 and 20 fractions. Adaptive radiation therapy (ART) reduced the V20 and V5 of the lung by 33.5% and 16.89%, respectively. ART also reduced Dmean and D1/3 of the heart by 31.7% and 32.32%, respectively. Dmax of the spinal cord did not vary much during the treatment course. Conclusion: 5 mm margin is sufficient for 4D weekly CTguided radiotherapy in lung cancer. Tumor regression was observed in the majority of patients. ART significantly reduced the OARs dose. Our preliminary results indicated that an off-line ART approach is appropriate in clinical practice.

  16. Verena Dolle (editora), Múltiples identidades: Literatura judeo-latinoamericana de los siglos XX y XXI, Iberoamericana, Madrid/ Vervuert, Franckfurt am Main, 2012, 267 p.

    OpenAIRE

    Dinamarca, Hernán

    2012-01-01

    Recién publicado en Alemania, este libro nació de una colaboración entre el Instituto Ibero-Americano de Berlín y el Instituto de Romanística de la Universidad Justus Liebig de Giessen. Se trata de una compilación de 15 ensayos editados por la Profesora - Dra. Verena Dolle. Lo primero que llama la atención a un lector no especializado, como es mi caso, es el uso del concepto Múltiples Identidades. A priori tendemos a pensar que si se trata de literatura judeo-latinoamericana, simplemente esa ...

  17. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  18. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  19. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  20. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  1. 40 CFR 270.290 - What general types of information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... CFR 267.16. A brief description of how training will be designed to meet actual job tasks under 40 CFR... requirements of 40 CFR part 267. (c) A copy of the waste analysis plan required by 40 CFR 267.13(b). (d) A description of the security procedures and equipment required by 40 CFR 267.14. (e) A copy of the...

  2. Site characterization and validation - Tracer migration experiment in the validation drift, report 2, Part 2: breakthrough curves in the validation drift appendices 5-9

    International Nuclear Information System (INIS)

    Flowrate curves for the 53 sampling areas in the validation drift with measureable flowrates are given. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. The total flowrate for these three sampling areas is given in a separate plot. The flowrates are given in ml/h. The time is given in hours since April 27 00:00, 1990. Disturbances in flowrates are observed after 8500 hours due to opening of boreholes C1 and W1. Results from flowrate measurements after 8500 hours are therefore excluded. The tracer breakthrough curves for 38 sampling areas in the validation drift are given as concentration values versus time. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. This gives a total of 40 breakthrough curves for each tracer. (au)

  3. Report on the behalf of the Parliamentary Office for the Assessment of Scientific and Technological Choices on drones and safety of nuclear installations. Restricted report of the hearing of the 24 November 2014 at 2 p.m., report of the public hearing on the same day at 4.30 p.m., and presentation of conclusions on the 26 November 2014. Nr 2523, Nr 267

    International Nuclear Information System (INIS)

    The first part of this document partially reports discussions between different experts on the responses and threats related to the flyover of nuclear installations by drones. This hearing more particularly addressed the following topics: drones and national defence, the external protection of sensitive installations, and safety within facility perimeter. Hearing of experts is followed by a discussion involving these experts and members of Parliament. The second part reports hearings of experts on the issues of control and regulation related to this type of flyover. The following topics have been addressed: the various actors of the drone sector (manufacturers, operators, users, and regulation), the role distribution along actors for nuclear safety and security. A debate is also reported

  4. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  5. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  6. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  7. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  8. The Etiology of Genital Ulcer Disease among Patients Attending Sexually Transmitted Disease Clinics in Guangzhou, China

    Institute of Scientific and Technical Information of China (English)

    GU Jin(谷进); ZENG Zhirong(曾志荣); CHEN Rongzhang(陈荣章); ZHU Huilan(朱慧兰); QIU Xiaoshan(邱晓珊)

    2002-01-01

    Objectives: To investigate the etiology of genital ulcerdisease (GUD) among patients attending sexuallytransmitted disease (STD) clinics in Guangzhou, China.Methods: Between September 8, 1998, and August 9,2001, 267 patients with a genital ulcer were clinicallyassessed. Clinical etiology of GUD was dependent onphysical appearance and microbiologic examination,including the following: dark field microscopy and serologyfor Treponema pallidum (TP), swabs of genital ulcer forHerpes simplex virus (HSV), processed quantitativefluorescent polymerase chain reaction (QF-PCR) forsimultaneous detection of HSV, TP, Haemophilus ducreyi(HD), Human papillomavirus (HPV), and serology for HIVinfection.Results: Two hundred thirty men and thirty-sevenwomen with a median age of 33.4 (range 16-74 years) wereanalyzed. The etiology of GUD was syphilis (26.59%)(71/267), genital herpes (17.60%) (47/267), condylomataacuminata (4.87%) (13/267), candidiasis (3.37%) (9/267),bacterial infection (3.75%) (10/267), and multiple infection(6.74%) (18/267). The seroprevalence of HIV was 0.75%(2/267). No etiology was identified in 50.56% (135/267).Conclusion: The etiology of GUD among STD patients inour area was multifactorial with a predominance of syphilisand genital herpes. Based on this limited data obtained atSTD clinics, HIV infection was not common.

  9. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  10. Drug: D04148 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04148 Drug Fenfluramine hydrochloride (USAN); Pondimin (TN) C12H16F3N. HCl 267.1002 267.7183 D0 ... AND METABOLISM A08 ANTIOBESITY PREPARATIONS, EXCL. DIET ... PRODUCTS A08A ANTIOBESITY PREPARATIONS, EXCL. DIET ...

  11. Gravitating Disks Around Black Holes

    Czech Academy of Sciences Publication Activity Database

    Karas, Vladimír; Šubr, Ladislav

    Cambridge : Cambridge University Press, 2010 - (Peterson, B.), s. 332-332 ISBN 978-0-521-76502-2. - (IAU Symposium Proceedings Series. 267). [Symposium of the International Astronomical Union /267./. Rio de Janeiro (BR), 10.08.2009-14.08.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : accretion disks * gravitation * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  12. 76 FR 24089 - Credit Risk Retention

    Science.gov (United States)

    2011-04-29

    ..., DC 20410- 0500. Communications must refer to the following docket number [FR- 5504-P-01] and title of... Department of Housing and Urban Development 24 CFR Part 267 Credit Risk Retention; Proposed Rule #0;#0... Part 246 RIN 3235-AK96 DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT 24 CFR Part 267 RIN 2501-AD53...

  13. An Alternative Justification of the Axioms of Fuzzy Logics

    Czech Academy of Sciences Publication Activity Database

    Běhounek, Libor

    2007-01-01

    Roč. 13, č. 2 (2007), s. 267-267. ISSN 1079-8986. [Logic Colloquium 2006. 27.07.2006-02.08.2006, Nijmegen] Institutional research plan: CEZ:AV0Z10300504 Keywords : fuzzy logic * logical consequence * logical axioms

  14. Principles and recent applications of fluorescence solvent relaxation technique - drug delivery systems

    Czech Academy of Sciences Publication Activity Database

    Olžyńska, Agnieszka; Jurkiewicz, Piotr; Sýkora, Jan; Hutterer, R.; Hof, Martin

    Regensburg : Digital Print Group O. Schimek GmbH, 2007. s. 267-267. [Conference on Methods and Applications of Fluorescence /10./. 09.09.2007-12.09.2007, Salzburg] Institutional research plan: CEZ:AV0Z40400503 Keywords : fluorescence * TRES Subject RIV: CF - Physical ; Theoretical Chemistry

  15. 76 FR 63906 - Henry Gordy International, Inc., Provisional Acceptance of a Settlement Agreement and Order

    Science.gov (United States)

    2011-10-14

    ... CPSA, 15 U.S.C. 2051-2089, and the CSPA, Public Law 103-267, 108 Stat. 722. 3. Henry Gordy is a..., Public Law 103-267, 108 Stat. 722. Response of Henry Gordy 22. Henry Gordy denies all of staff's... COMMISSION Henry Gordy International, Inc., Provisional Acceptance of a Settlement Agreement and Order...

  16. 76 FR 60582 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-09-29

    ... (65 FR 19477-78). Docket: To read background documents or comments received, go to http://www...) 267-7626, or David Staples (202) 267-4058, Office of Rulemaking, Federal Aviation Administration, 800... Washington, DC, on September 23, 2011. Julie Ann Lynch, Acting Director, Office of Rulemaking. Petition...

  17. AcEST: DK951985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ntities = 72/86 (83%), Positives = 82/86 (95%) Frame = +1 Query: 88 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDV...KCQGCFSITTVFSHSQTVVLCGN 267 MVL NDIDLL+PPAE+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQTVV...+CGN Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN 60 Query: 268 CSAVLCQPTGGRARLTEGS...LSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN 267 MVL NDIDLLHPP E+EK+KHKLKRLVQSPNS+FMDVKCQGCF+I...TTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV

  18. Intergenerational Transmission of Internalizing Problems: Effects of Parental and Grandparental Major Depressive Disorder on Child Behavior

    Science.gov (United States)

    Pettit, Jeremy W.; Olino, Thomas M.; Roberts, Robert E.; Seeley, John R.; Lewinsohn, Peter M.

    2008-01-01

    Effects of lifetime histories of grandparental (G1) and parental (G2) major depressive disorder (MDD) on children's (G3) internalizing problems were investigated among 267 G3 children (ages 2-18 years) who received Child Behavior Checklist (CBCL) ratings and had diagnostic data available on 267 biological G2 parents and 527 biological G1…

  19. Chemical and Organoleptic Characterization of Pawpaw and Guava Leathers

    OpenAIRE

    O.A. Ashaye; S. O. Babalola; A.O. Babalola; J.O. Aina; S.B. Fasoyiro

    2005-01-01

    An investigation was carried out to evaluate the chemical and organoleptic properties of pawpaw and guava leathers. Guava leather was significantly higher in protein (2.67%) and fat (1.37%) than other samples. There was no significance difference in the crude fibre of pawpaw (2.4%) and guava (2.67%) leathers. This was also observed in the ash contents with pawpaw leather having (2.67%) and guava leather (2.87%). Guava leather is significantly higher in fruitiness smell and overall acceptabili...

  20. AcEST: BP920790 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_F05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000141_F05. BP920790 - Show ... = 8/84 (9%) Frame = -3 Query: 240 RAGVCNKYQEAFRALEKRI ----LRDDAISQEGAASSSTDHLE--STVLEADVRV-VVDS 82 +A + N ... 5%) Frame = -3 Query: 267 ELQTSLQLPRAGVCNKYQEAFRALEKRI LR-----DDAISQEGAASSSTDHLESTVLEAD 103 EL+ LQ + V +KY ... 5%) Frame = -3 Query: 267 ELQTSLQLPRAGVCNKYQEAFRALEKRI LR-----DDAISQEGAASSSTDHLESTVLEAD 103 EL+ LQ + V +KY ... 5%) Frame = -3 Query: 267 ELQTSLQLPRAGVCNKYQEAFRALEKRI LR-----DDAISQEGAASSSTDHLESTVLEAD 103 EL+ LQ + V +KY ...

  1. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  2. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  3. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  4. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  5. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  6. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  7. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  8. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  9. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  10. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  11. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  12. CHLOROPHYLL A and PHAEOPIGMENTS profile data collected in the North Atlantic Ocean on the ENDEAVOR cruises EN259, EN262 and others as part of the GB project from 1995-01-11 to 1995-06-16 (NODC Accession 0104395)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104395 includes profile and biological data collected aboard the ENDEAVOR during cruises EN259, EN262, EN264, EN266 and EN267II in the North...

  13. The language and style of Latin rubrics in medieval liturgical Easter drama

    Czech Academy of Sciences Publication Activity Database

    Vršecká-Kvízová, Kateřina

    -, č. 71 (2013), s. 267-280. ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : Easter drama * Medieval Latin * Latin rubrics Subject RIV: AI - Linguistics

  14. Štípaná industrie z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

    Czech Academy of Sciences Publication Activity Database

    Stolz, D.; Řídký, J.; Půlpán, M.; Burgert, Pavel

    2015-01-01

    Roč. 67, č. 2 (2015), s. 267-286. ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * chipped stone industry Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. 77 FR 21522 - Lake Tahoe Basin Management Unit and Tahoe National Forest, CA; Calpeco 625 and 650 Electrical...

    Science.gov (United States)

    2012-04-10

    ... Golf Course near SR 267; Kings Beach north of the Kings Beach Switching Station; Sawmill Flats accessed... federal, state, and local agencies, and individuals and organizations with the opportunity to learn...

  16. Soil and freshwater micro-algae as a food source for invertebrates in extreme environments

    Czech Academy of Sciences Publication Activity Database

    Lukešová, Alena; Frouz, Jan

    Dordrecht : Springer, 2007, s. 267-284. ISBN 978-1-4020-6111-0 Institutional research plan: CEZ:AV0Z60660521 Keywords : micro-algae * food source for invertebrates * extreme environments Subject RIV: EH - Ecology, Behaviour

  17. Occurrence and Species Distribution of Strictly Anaerobic Bacterium Pectinatus in Brewery Bottling Halls

    Czech Academy of Sciences Publication Activity Database

    Matoulková, D.; Kosař, K.; Slabý, M.; Sigler, Karel

    2012-01-01

    Roč. 70, č. 4 (2012), s. 262-267. ISSN 0361-0470 Institutional support: RVO:61388971 Keywords : Beer spoilage * Biofilm * Conveyor belt Subject RIV: EE - Microbiology, Virology Impact factor: 1.000, year: 2012

  18. Caloplaca allochroa (lichenized Ascomycetes), a new saxicolous lichen species from South Korea

    Czech Academy of Sciences Publication Activity Database

    Joshi, Y.; Vondrák, Jan; Vondráková, O.; Nguyen, T.T.; Hur, J.-S.

    2011-01-01

    Roč. 2011, č. 117 (2011), s. 261-267. ISSN 0093-4666 Institutional research plan: CEZ:AV0Z60050516 Keywords : anthraquinones * taxonomy * Teloschistaceae Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  19. Co víme o historii vápnitých slatinišť v Západních Karpatech

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, M.; Horsák, M.; Jamrichová, Eva

    2015-01-01

    Roč. 50, č. 2 (2015), s. 267-282. ISSN 1211-5258 Institutional support: RVO:67985939 Keywords : bryophytes * Caricion davallianae * macrofossils * palaeoecology * relicts * succession Subject RIV: EH - Ecology, Behaviour

  20. Butenolides from Plant-Derived Smoke: Natural Plant-Growth Regulators with Antagonistic Actions on Seed Germination

    Czech Academy of Sciences Publication Activity Database

    Light, M. E.; Burger, B. V.; Staerk, D.; Kohout, Ladislav; van Staden, J.

    2010-01-01

    Roč. 73, č. 2 (2010), s. 267-269. ISSN 0163-3864 Institutional research plan: CEZ:AV0Z40550506 Keywords : butenolides * karrikins * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 2.872, year: 2010

  1. Long-term follow-up of MCL patients treated with single-agent ibrutinib: updated safety and efficacy results

    OpenAIRE

    Wang, Michael L.; Blum, Kristie A.; Martin, Peter; Goy, Andre; Auer, Rebecca; Kahl, Brad S.; Jurczak, Wojciech; Advani, Ranjana H.; Romaguera, Jorge E.; Williams, Michael E.; Barrientos, Jacqueline C.; Chmielowska, Ewa; Radford, John; Stilgenbauer, Stephan; Dreyling, Martin

    2015-01-01

    Ibrutinib demonstrates durable responses and sustained single-agent activity in relapsed or refractory MCL at median 26.7-month follow-up.Ibrutinib shows a favorable benefit-risk profile over time, with a manageable safety profile.

  2. Simulation of IR and VCD spectra of peptides. Effect of approximation methods

    Czech Academy of Sciences Publication Activity Database

    Bouř, Petr; Keiderling, T. A.; Kim, J.

    Delavan : -, 2005. s. 267. [International Conference on Advanced Vibrational Spectroscopy /3./. 14.08.2005-19.08.2005, Delavan] Institutional research plan: CEZ:AV0Z40550506 Keywords : VCD * peptides Subject RIV: CF - Physical ; Theoretical Chemistry

  3. Postural Tachycardia Syndrome

    Science.gov (United States)

    ... Worldwide NINDS Clinical Trials Organizations Column1 Column2 National Dysautonomia Research Foundation P.O. Box 301 Red Wing, ... Tel: 651-327-0367 Fax: 651-267-0524 Dysautonomia Youth Network of America, Inc. 1301 Greengate Court ...

  4. Predictors of Late HIV Diagnosis among Adult People Living with HIV/AIDS Who Undertake an Initial CD4 T Cell Evaluation, Northern Ethiopia: A Case-Control Study

    OpenAIRE

    Beyene, Melkamu Bedimo; Beyene, Habtamu Bedimo

    2015-01-01

    Introduction Early HIV testing and timely initiation of ART is critical for the improved quality of life of PLWHIV. Having identified a higher rates of Late HIV diagnosis, this study was aimed to determine Determinants of late diagnosis of HIV among adult HIV patients in Bahir Dar, Northern Ethiopia. Methods A case control study was conducted between January 2010 to December 2011 at Bahir Dar Felege Hiwot Referral Hospital. The study subjects consisted of 267 cases and 267 controls. Cases wer...

  5. A Dual Infection Pseudorabies Virus Conditional Reporter Approach to Identify Projections to Collateralized Neurons in Complex Neural Circuits

    OpenAIRE

    J Patrick Card; Oren Kobiler; Ludmir, Ethan B.; Vedant Desai; Sved, Alan F.; Enquist, Lynn W.

    2011-01-01

    Replication and transneuronal transport of pseudorabies virus (PRV) are widely used to define the organization of neural circuits in rodent brain. Here we report a dual infection approach that highlights connections to neurons that collateralize within complex networks. The method combines Cre recombinase (Cre) expression from a PRV recombinant (PRV-267) and Cre-dependent reporter gene expression from a second infecting strain of PRV (PRV-263). PRV-267 expresses both Cre and a monomeric red f...

  6. 26 CFR 1.460-4 - Methods of accounting for long-term contracts.

    Science.gov (United States)

    2010-04-01

    ...(f) and 1502, including §§ 1.267(f)-1T, 1.267(f)-2T, and 1.1502-13(n) (as contained in the 26 CFR... adjusted basis in the retained property (but not below zero) by the fair market value of that consideration.... The contract specifies a target price of $1,000,000, a target cost of $600,000, and a target profit...

  7. AcEST: DK951667 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0012_A06 637 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_A06. 5' end seq ... NDC-DFDKAVEGCVSGAFWAAGQ 318 Query: 206 SCISVQRVYIHMDIY EVVKDALVEATSGLVKGDPLNEDTFIGPLIDESEAKRIEAWVEKA 385 + ... DANINKA--VESCMSGKF 267 Query: 191 YQSGQSCISVQRVYIHMDIY EVVKDALVEATSGLVKGDPLNEDTFIGPLIDESEAKRIEA 370 SGQ CI ... DS--DIKLAAKSAVKSKF 267 Query: 191 YQSGQSCISVQRVYIHMDIY EVVKDALVEATSGLVKGDPLNEDTFIGPLIDESEAKRIEA 370 +GQ CI ... DDA-DLDKAVEGALA 279 Query: 182 GAFYQSGQSCISVQRVYIHMDIY EVVKDALVEATSGLVKGDPLNEDTFIGPLIDESEAKR 361 F +GQ+C+ ...

  8. LASIK for Spherical Refractive Myopia: Effect of Topographic Astigmatism (Ocular Residual Astigmatism, ORA) on Refractive Outcome

    OpenAIRE

    Frings, Andreas; Richard, Gisbert; Steinberg, Johannes; Skevas, Christos; Druchkiv, Vasyl; Katz, Toam; Linke, Stephan J.

    2015-01-01

    Purpose In eyes with a preoperative plano refractive cylinder, it would appear that there is no rationale for astigmatic treatment. The aim of this retrospective, cross-sectional data analysis was to determine the amount of topographic astigmatism in refractive plano eyes that results in reduced efficacy after myopic laser in situ keratomileusis (LASIK). Methods This study included 267 eyes from 267 consecutive myopic patients with a refractive plano cylinder. Receiver operating characteristi...

  9. Drug: D01665 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01665 Drug Voglibose (JP16/USAN/INN); Basen (TN) C10H21NO7 267.1318 267.2762 D01665.gif Antidiabetic...se metabolism hsa04973(8972) Carbohydrate digestion and absorption map07051 Antidiabetics Therapeutic catego...ry of drugs in Japan [BR:br08301] 3 Agents affecting metabolism 39 Other agents affecting metabolism 396 Antidiabetic

  10. Three novel acetylation sites in the Foxp3 transcription factor regulate the suppressive activity of regulatory T cells

    OpenAIRE

    Kwon, Hye-Sook; Lim, Hyung W; Wu, Jessica; Schnoelzer, Martina; Verdin, Eric; Ott, Melanie

    2012-01-01

    The Foxp3 transcription factor is the master regulator of regulatory T cell (Treg) differentiation and function. Its activity is regulated by reversible acetylation. Using mass spectrometry of immunoprecipitated proteins, we identify three novel acetylation sites in murine Foxp3 (K31, K262, and K267) and the corresponding sites in human FoxP3 proteins. Newly raised modification-specific antibodies against acetylated K31 and K267 confirm acetylation of these residues in murine Tregs. Mutant Fo...

  11. Numerical Linear Algebra and Some Problems in Computational Statistics

    Czech Academy of Sciences Publication Activity Database

    Strakoš, Zdeněk

    Tokyo: Japanese Society of Computational Statistics, 2008 - (Mizuta, M.; Nakano, J.). s. 267-267 ISBN 978-4-9904445-0-1. [IASC 2008. 05.12.2008-08.12.2008, Yokohama] R&D Projects: GA AV ČR IAA100300802 Institutional research plan: CEZ:AV0Z10300504 Keywords : moments * ordinary least squares * total least squares * errors-in-variables modeling * core problem theory * orthogonal bidiagonalization * orthogonality Subject RIV: BB - Applied Statistics, Operational Research

  12. Chemical and physical composition of grain-type and food-type soybean for food processing Composição química e física de soja tipo grão e tipo alimento para o processamento de alimentos

    Directory of Open Access Journals (Sweden)

    Josemeyre Bonifácio da Silva

    2009-07-01

    Full Text Available The objective of this work was to evaluate the chemical and physical characteristics of grains of soybean (Glycine max cultivars for food processing. The soybean cultivars evaluated were: grain-type - BRS 133 and BRS 258; food-type - BRS 213 (null lipoxygenases, BRS 267 (vegetable-type and BRS 216 (small grain size. BRS 267 and BRS 216 cultivars showed higher protein content, indicating that they could promote superior nutritional value. BRS 213 cultivar showed the lowest lipoxygenase activity, and BRS 267, the lowest hexanal content. These characteristics can improve soyfood flavor. After cooking, BRS 267 cultivar grains presented a higher content of aglycones (more biologically active form of isoflavones and oleic acid, which makes it proper for functional foods and with better stability for processing, and also showed high content of fructose, glutamic acid and alanine, compounds related to the soybean mild flavor. Because of its large grain size, BRS 267 is suitable for tofu and edamame, while small-grain-sized BRS 216 is good for natto and for soybean sprouts production. BRS 216 and BRS 213 cultivars presented shorter cooking time, which may be effective for reducing processing costs.O objetivo deste trabalho foi avaliar as características químicas e físicas de grãos de cultivares de soja (Glycine max para o processamento de alimentos. As cultivares avaliadas foram: tipo grão - BRS 133 e BRS 258; tipo alimento - BRS 213 (desprovida de lipoxigenases, BRS 267 (tipo hortaliça e BRS 216 (tamanho de grão pequeno. As cultivares BRS 216 e BRS 267 apresentaram maior teor de proteínas e poderiam promover valor nutricional superior. A cultivar BRS 213 apresentou a menor atividade de lipoxigenases e a BRS 267, o menor teor de hexanal. Essas características podem melhorar o sabor dos alimentos. Com o cozimento, os grãos da cultivar BRS 267 apresentaram maior teor de agliconas (forma biologicamente mais ativa das isoflavonas e de ácido oleico

  13. Seroprevalence of hepatitis B e antigen (HBe antigen and B core antibodies (IgG anti-HBcore and IgM anti-HBcore among hepatitis B surface antigen positive blood donors at a Tertiary Centre in Nigeria

    Directory of Open Access Journals (Sweden)

    Akinbami Akinsegun A

    2012-03-01

    Full Text Available Abstract Background Hepatitis B virus (HBV is a common cause of liver disease throughout the world. HBV is transmitted through blood and other body fluids, including semen and saliva. Chronic replication of HBV virons is characterized by persistence circulation of HBsAg, HBeAg and HBV DNA; usually with anti-HBc and occasionally with anti-HBs. Aim: To determine the prevalence of HBeAg, IgG anti-HBcore and IgM anti-HBcore amongst HBsAg positive blood donors. These parameters are reflective of transmissibility and active hepatitis B infection. A cross sectional study was carried out at the blood donor clinics of Lagos State University Teaching Hospital Ikeja and Lagos University Teaching Hospital Idiaraba. A total of 267 donors were recruited to determine HBe antigen, IgG and IgM anti-HBcore antibodies amongst hepatitis BsAg positive donors. Five milliliters of blood was collected from those who tested positive to HBsAg screen during donation. The sera were subjected to enzyme linked immunosorbent assay (ELISA. Pearson chi-squared test was used for the analytical assessment. Findings A total number of 267 HBsAg positive blood donors were studied. A seroprevalence of 8.2% (22 of 267 HBeAg was obtained, 4 of 267 (1.5% were indeterminate while 241 (90.3% tested negative. Only 27 out of 267 donors (10.1% tested positive to IgM anti-HBcore, 234(87.6% tested negative, while 6(2.2% were indeterminate. A higher percentage of 60.7% (162 of 267 tested positive to IgG anti-HBcore, while 39.3% (105 of 267 tested negative. Conclusion There is a low seroprevalence rate of HBeAg-positive chronic hepatitis and relatively high IgG anti-HBcore and IgM anti-HBcore rates in South West Nigeria.

  14. Improved preparation of halopropyl bridged carboxylic ortho esters

    Directory of Open Access Journals (Sweden)

    Richard J. Petroski

    2008-10-01

    Full Text Available Bridged ortho esters of 3-halopropyl carboxylic acids were prepared by esterification of 3-methyl-3-hydroxymethyloxetane with 3-bromopropionyl chloride and pyridine in dry THF, followed by rearrangement with boron trifluoroetherate, to afford 1-(2-bromoethyl-4-methyl-2,6,7-trioxabicyclo[2,2,2]-octane. The 1-(2-iodoethyl-4-methyl-2,6,7-trioxabicyclo[2,2,2]-octane analogue could not be prepared directly by halogen exchange of 1-(2-bromoethyl-4-methyl-2,6,7-trioxabicyclo[2,2,2]-octane but could be prepared by halogen exchange of the (3-methyloxetan-3-ylmethyl 3-bromopropanoate with a mixture of sodium iodide and anhydrous sodium sulfate in acetone, followed by rearrangement with boron trifluoroetherate.

  15. Krustale Seismizität, Struktur und Rheologie der Oberplatte zwischen der Präkordillere und dem magmatischen Bogen in Nordchile (22°S-24°S)

    OpenAIRE

    Belmonte-Pool, Arturo

    2010-01-01

    (Type a title for your page here) At the beginning of 1994, the PISCO '94 experiment (Proyecto de Investigación Sismológica de la Cordillera Occidental), which is part of the so-called Collaborative Research Center 267 (SFB 267) "Deformation Processes in the Andes" (FU-Berlin, TU-Berlin, GFZ Potsdam, U. Católica del Norte and U. de Chile), was carried out in northern Chile. PISCO '94 focused on active and passive seismological investigations of the upper pl...

  16. AcEST: DK955554 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_G14 413 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_G14. 5' end seq ... FISDFSEEDY 446 Query: 181 DAIVSGWKSKLKRCEDGEQKWGLFMATK ... 264 + IV GW +KL+R GEQKWGLF+A K Sbjct: 447 NDIVGGWS ... FISDFSKEDY 462 Query: 181 DAIVSGWKSKLKRCEDGEQKWGLFMATK S 267 D IV GWKSKL+RC EQKWGLF+A K+ Sbjct: 463 DDIVGG ... FISDFSKEDY 461 Query: 181 DAIVSGWKSKLKRCEDGEQKWGLFMATK S 267 + I+ GWKSKL R GEQKWGLF+A ++ Sbjct: 462 EDIIGG ... FIDDFSEEDY 465 Query: 181 DAIVSGWKSKLKRCEDGEQKWGLFMATK ... 264 + IV GWK+KL R +GEQ+WGLF+A K Sbjct: 466 NDIVDGW ...

  17. Drug: D02562 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ate (USAN) USP drug classification [BR:br08302] Antiparkinson Agents Monoamine Ox...D02562 Drug Rasagiline mesylate (USAN); Azilect (TN) C12H13N. CH4SO3 267.0929 267.344 D02562.gif Antiparkins... cytochrome P450 hsa04726(4129) Serotonergic synapse hsa04728(4129) Dopaminergic synapse map07027 Antidepressants map07057 Antiparkin...sonian agents map07216 Catecholamine transferase inhibit...onian [DS:H00057] ATC code: N04BD02 monoamine oxidase B (MAO-B) inhibitor [HSA:4129

  18. Intergenerational Transmission of Internalizing Problems: Effects of Parental and Grandparental Major Depressive Disorder on Child Behavior

    OpenAIRE

    Pettit, Jeremy W.; Olino, Thomas M.; Roberts, Robert E.; John R. Seeley; Lewinsohn, Peter M.

    2008-01-01

    Effects of lifetime histories of grandparental (G1) and parental (G2) major depressive disorder (MDD) on children's (G3) internalizing problems were investigated among 267 G3 children (ages 2–18 years) who received Child Behavior Checklist (CBCL) ratings and had diagnostic data available on 267 biological G2 parents and 527 biological G1 grandparents. Results indicated that G1 MDD conferred risk for G2 MDD, but not for G3 CBCL scores. G2 MDD predicted higher G3 Internalizing and Anxious/Depre...

  19. Experiments with Superheavy Nuclei

    Science.gov (United States)

    Hofmann, S.

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α -α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  20. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO3, HReO4) ΔHads(ReO3) = -190 ± 10 kJ/mol; ΔSads(ReO3) = -179±30 J/mol K; ΔHads(HReO4) = -77 ± 5 kJ/mol; ΔSads(HReO4) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176Re, 152-155Er, 151-154Ho, 218Po, and 214Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  1. Experiments with superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author) 34 refs, 7 figs

  2. Chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Schaedel, M. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan). Advanced Science Research Center; GSI Helmholtz Center for Heavy Ion Research, Darmstadt (Germany)

    2012-07-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  3. New elements produced at GSI

    Science.gov (United States)

    Hofmann, Sigurd

    1998-12-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  4. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A. [Paul-Scherrer-Inst., Villigen (Switzerland); Gaeggeler, H.W. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Paul-Scherrer-Inst., Villigen (Switzerland)

    1999-07-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) {r_reversible} X(ads) (X = ReO{sub 3}, HReO{sub 4}) {delta}H{sub ads}(ReO{sub 3}) = -190 {+-} 10 kJ/mol; {delta}S{sub ads}(ReO{sub 3}) = -179{+-}30 J/mol K; {delta}H{sub ads}(HReO{sub 4}) = -77 {+-} 5 kJ/mol; {delta}S{sub ads}(HReO{sub 4}) = -187{+-}50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes {sup 169,170,174,176}Re, {sup 152-155}Er, {sup 151-154}Ho, {sup 218}Po, and {sup 214}Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  5. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, J.C.; Mizel, A.; Cote, M.; Cohen, M.L.; Louie, S.G. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States))

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (B[sub o]), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (B[sub o]). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated B[sub o] for Hs is comparable to that of diamond. [copyright] [ital 1999] [ital The American Physical Society

  6. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  7. Experiments with superheavy nuclei

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  8. Synthesis of heavy and superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. (Gesellschaft fur Schwerionenforshung (GSI), Darmstadt (Germany))

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-de-excitation channels. The isotopes were ambiguously identified by means of [alpha]-[alpha] correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on this results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reaction using [sup 208]Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use the neutron deficient projectile isotopes and use of actinide targets is discussed.

  9. New elements produced at GSI

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed

  10. Mass spectrometry is a powerful tool for identification of proteins associated with lipid rafts of Jurkat T-cell line

    Czech Academy of Sciences Publication Activity Database

    Pompach, Petr; Man, Petr; Novák, Petr; Havlíček, Vladimír; Fišerová, Anna; Bezouška, Karel

    2004-01-01

    Roč. 32, - (2004), s. 777-780. ISSN 0300-5127 Institutional research plan: CEZ:AV0Z5020903 Keywords : immune synapse * jurkat t- cell line * membrane Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004

  11. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 267-276. ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  12. Lipnická bible (Museum of the Bible, Oklahoma City, Green Collection MS 486)

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Lucie

    Praha : Scriptorium, 2015 - (Dragoun, M.; Doležalová, L.; Ebersonová, A.), s. 262-267 ISBN 978-80-88013-09-9 Institutional support: RVO:67985955 Keywords : medieval manuscripts * Bible * Lipnice * medieval history Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Active pharmaceutical ingredient (api) from an estuarine fungus, Microdochium nivale (Fr.)

    Digital Repository Service at National Institute of Oceanography (India)

    Bhosale, S.H.; Patil, K.B.; Parameswaran, P.S.; Jagtap, T.G.

    factor to the IL-2 enhacer. EMBO J., 9, 2529-2536 (1990). Rodriguez-Couto, S., E. Lopez and M.A. Sanroman: Utilisation of grape seed for laccase production in solid- state fermentation. J. Food Engineering, 74, 263-267 (2006). Rodriguez, M.A., G. Cabrera...

  14. Kinetics of the Exothermic Decomposition Reaction of s-Tripicryaminotrinitrobenzene

    Institute of Scientific and Technical Information of China (English)

    ZHAO Feng-qi; HU Rong-zu; GAO Hong-xu; LUO Yang; GAO Sheng-li; SONG Ji-rong; SHI Qi-zhen

    2007-01-01

    The kinetic parameters of the exothermic decomposition reaction of s-Tripicryaminotrinitrobenzene under linear temperature rise condition are studied by means of DSC. The results show that the empirical kinetic model function in difs-1, respectively. The critical temperature of thermal explosion of the compound is 267.36 ℃.

  15. Anion exchange nanofiber materials activated by daylight with a dual antibacterial effect

    Czech Academy of Sciences Publication Activity Database

    Plištil, L.; Henke, P.; Kubát, Pavel; Mosinger, Jiří

    2014-01-01

    Roč. 13, č. 9 (2014), s. 1321-1329. ISSN 1474-905X R&D Projects: GA ČR GA13-12496S Institutional support: RVO:61388955 ; RVO:61388980 Keywords : SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES * POLYSTYRENE Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.267, year: 2014

  16. Slow-neutron-induced charged-particle emission-channeling-measurements with Medipix detectors

    Czech Academy of Sciences Publication Activity Database

    Koster, U.; Granja, C.; Jakubek, J.; Uher, J.; Vacík, Jiří

    2011-01-01

    Roč. 633, č. 1 (2011), S267-S269. ISSN 0168-9002. [11th International Workshop on Radiation Imaging Detector s. Praha, 28.06.2009-02.07.2009] Institutional research plan: CEZ:AV0Z10480505 Keywords : Emission channeling * Neutron induced reaction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.207, year: 2011

  17. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.

    2015-01-01

    Roč. 60, č. 4 (2015), 259-267. ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.405, year: 2014

  18. Hispanic Acculturation in a Predominately Black High School: Application of an Adapted Model

    Science.gov (United States)

    Hughes, Carolyn; Hollander, Matthew J.; Martinez, Amber W.

    2009-01-01

    The authors applied an adaptation of prior models of acculturation to all 16 Hispanic students attending a predominately Black, high-poverty, urban high school (n = 1,267 students) identified by No Child Left Behind standards as failing. No published study to date has investigated Hispanic acculturation within such a setting. Findings reveal that…

  19. When Friends Disappoint: Boys' and Girls' Responses to Transgressions of Friendship Expectations

    Science.gov (United States)

    MacEvoy, Julie Paquette; Asher, Steven R.

    2012-01-01

    In this study, the prevailing view that girls are pervasively more skilled in their friendships than boys was challenged by examining whether girls respond more negatively than boys when a friend violates core friendship expectations. Fourth- and fifth-grade children (n = 267) responded to vignettes depicting transgressions involving a friend's…

  20. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva

    2006-01-01

    Roč. 563, č. 1 (2006), s. 263-267. ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  1. Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

    Czech Academy of Sciences Publication Activity Database

    Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

    2001-01-01

    Roč. 105, č. 2 (2001), s. 257-267. ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

  2. Positive Behavior Support as Character Education: A Non-Experimental, Explanatory, Cross-Sectional Study

    Science.gov (United States)

    O'Connell, Erin B.

    2012-01-01

    This study examined the impact of Positive Behavior Support (PBS) on office discipline referrals (Category 1), suspensions (Category 2), and absence of infractions (Category 3) in an urban public elementary school in New Jersey. A sample of 267 second, third, fourth, and fifth grade students provided the data for the research. A chi-square…

  3. Thermodynamic modeling of La2O3-SrO-Mn2O3-Cr2O3 for solid oxide fuel cell applications

    DEFF Research Database (Denmark)

    Povoden-Karadeniz, E.; Chen, Ming; Ivas, Toni;

    2012-01-01

    The thermodynamic La–Sr–Mn–Cr–O oxide database is obtained as an extension of thermodynamic descriptions of oxide subsystems using the calculation of phase diagrams approach. Concepts of the thermodynamic modeling of solid oxide phases are discussed. Gibbs energy functions of SrCrO4, Sr2.67Cr2O8,...

  4. Gender, Language, and Social Influence: A Test of Expectation States, Role Congruity, and Self-Categorization Theories

    Science.gov (United States)

    Reid, Scott A.; Palomares, Nicholas A.; Anderson, Grace L.; Bondad-Brown, Beverly

    2009-01-01

    This study compares self-categorization, expectation states, and role congruity theories' explanations for female influence. Male and female participants (N = 267) listened to a recording of a female speaker who used either tentative or assertive language under conditions that led participants to categorize her as a woman or as college-educated.…

  5. Correlation Investigation as to the Mental Health of the Prison Guard in Xi'an Police Station

    Institute of Scientific and Technical Information of China (English)

    Feng Xue

    2005-01-01

    Based on the symptom check list 90,EPQ scale and the simplified coping style questionaire,the author made a relative study on psychological health,personality character and coping style of 267 prison guard of police bureau in Xi'an city .The study shows this:   ①The mental health,personality character and coping style could be effected by many factors,such as gender,age,educational background,income,origin,satisfactory degree of working enviroment and some others.The mental health,personality character and coping style could effect each other.②The psychological health state of 267 prison guard is much worse than that of domestic common people.③The personality character of 267 prison guard shows much higher hostility and lower nervous than that of domestic common people.④The coping style of 267 prison guard often take positive coping styles.⑤Psychological health,personality character and coping style of prison guard are closely related.

  6. Influence of UV and Ozonised Water Treatment on Trans-resveratrol Content in Berry Skins and Juices of Franc and Green Veltliner Grapes

    Czech Academy of Sciences Publication Activity Database

    Landfeld, A.; Tříska, Jan; Balík, J.; Strohalm, J.; Novotná, P.; Vrchotová, Naděžda; Totušek, J.; Lefnerová, D.; Híc, P.; Tománková, E.; Halama, R.; Houška, M.

    2015-01-01

    Roč. 33, č. 3 (2015), s. 267-276. ISSN 1212-1800 R&D Projects: GA MZe QI91B094 Institutional support: RVO:67179843 Keywords : grape juices * stilbens content * UV irradiation * ozonisation Subject RIV: GM - Food Processing Impact factor: 0.675, year: 2014

  7. A highly diverse spectrum of naphthoquinone derivatives produced by the endophytic fungus Biatriospora sp CCF 4378

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav

    2015-01-01

    Roč. 60, č. 3 (2015), s. 259-267. ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.000, year: 2014

  8. Exploring the Link between Corporal Punishment and Children's Cruelty to Animals.

    Science.gov (United States)

    Flynn, Clifton P.

    1999-01-01

    Study of college undergraduates (N=267) examined the relationship between corporal punishment inflicted by parents and perpetration of animal abuse. Analyses showed that the association between fathers' corporal punishment and sons' childhood animal cruelty persisted after controlling for child abuse, father-to-mother violence, and father's…

  9. EMPIRICAL ESTIMATES IN STOCHASTIC PROGRAMS WITH PROBABILITY AND SECOND ORDER STOCHASTIC DOMINANCE CONSTRAINTS

    Czech Academy of Sciences Publication Activity Database

    Omelchenko, Vadym; Kaňková, Vlasta

    2015-01-01

    Roč. 84, č. 2 (2015), s. 267-281. ISSN 0862-9544 R&D Projects: GA ČR GA13-14445S Institutional support: RVO:67985556 Keywords : Stochastic programming problems * empirical estimates * light and heavy tailed distributions * quantiles Subject RIV: BB - Applied Statistics, Operational Research http://library.utia.cas.cz/separaty/2015/E/omelchenko-0454495.pdf

  10. 75 FR 42474 - The Future of Aviation Advisory Committee (FAAC) Subcommittee on Labor and World-Class Workforce...

    Science.gov (United States)

    2010-07-21

    ..., Center for Organizational Excellence, Assistant Administrator for Human Resources, Federal Aviation Administration, 800 Independence Avenue, SW., Washington, DC 20591; (202) 267-3456, extension 7472; or Regis P..., engineering and math (STEM) skills in the industry; (2) the creation of a culture of dignity and respect...

  11. 75 FR 60856 - The Future of Aviation Advisory Committee (FAAC) Subcommittee on Labor and World-Class Workforce...

    Science.gov (United States)

    2010-10-01

    ... Strategic Performance and Organizational Success, Office of the Assistant Administrator for Human Resources, Federal Aviation Administration, 800 Independence Avenue, SW., Washington, DC 20591; (202) 267-3456... the industry; (2) the creation of a culture of dignity and respect in workplace; and (3) the effect...

  12. Does Completing an Enriched Writing Course Improve Writing Self-Efficacy of Talented Secondary Students?

    Science.gov (United States)

    Frank Webb, Anne; Vandiver, Beverly J.; Jeung, Stevie

    2016-01-01

    This study examined whether writing self-efficacy would change and have an effect on final course grade in 267 talented middle and high school students in the course of taking enriched 6-week writing classes. Confidence in writing increased across time within three courses, whereas approach to writing did not. Differences were found between…

  13. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo

    2009-01-01

    Roč. 135, 3-4 (2009), s. 267-271. ISSN 0378-1135 Grant ostatní: 6th Framework Programme EC(XE) GOCE-2003-010284 EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  14. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 300, 1-2 (2007), s. 259-267. ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  15. Tolerance to acute ischemia in adult male and female spontaneously hypertensive rats

    Czech Academy of Sciences Publication Activity Database

    Bešík, J.; Szárszoi, Ondrej; Kuneš, Jaroslav; Netuka, I.; Malý, J.; Kolář, František; Pirk, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 56, č. 3 (2007), s. 267-274. ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510; GA MZd ND7607 Institutional research plan: CEZ:AV0Z50110509 Keywords : cardiac tolerance * ischemia injury * gender differences Subject RIV: ED - Physiology Impact factor: 1.505, year: 2007

  16. System of Antioxidant Protection of Corn Roots in Case of Adaptation to Combined Action of Herbicides and Soil Drought

    Directory of Open Access Journals (Sweden)

    G. S. Rossihina

    2005-09-01

    Full Text Available Reaction of antioxidant enzymes in the maize root (Kadr 267 MVhybrid to the combined action of herbicides and soil drought was studied. These conditions activated superoxide dismutase (SOD and peroxidase and coused oscillation in the catalase enzymatic activity.

  17. 78 FR 11790 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Catcher Vessels Using Trawl...

    Science.gov (United States)

    2013-02-20

    ... GOA (77 FR 15194, March 14, 2012) and inseason adjustment to the final 2013 harvest specifications for Pacific cod (78 FR 267, January 3, 2013). In accordance with Sec. 679.20(d)(1)(i), the Administrator... of Alaska (GOA). This action is necessary to prevent exceeding the A season allowance of the...

  18. CERN: Digital image analysis in the world's largest research center for particle physics

    CERN Multimedia

    2005-01-01

    Those interested in researching into the smallest building blocks that matter is made up of need the largest instruments. CERN, near Geneva, Switzerland is where the most powerful circular accelerator in the world is being built: the Large Hadron Collider (LHC) for proton collisions. It has a circumference of 26.7 km (4 pages)

  19. Heart failure

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2009170 Curcumin attenuates left ventricular dysfunction and remodeling in rabbits with chronic heart failure. TANG Yanhong(唐艳红),et al.Dept Cardiol,Renmin Hosp,Wuhan Univ,Wuhan 430060.Chin J Cardiol,2009;37(3):262-267.

  20. The Porosity of 433 Eros

    Science.gov (United States)

    Britt, D. T.; Yeomans, Donald K.; Consolmagno, G. J.

    2001-01-01

    Data from the NEAR mission show the bulk density of 433 Eros is 2.67 g/cm 3 . Given an L or LL composition, the bulk porosity of Eros is in the range of 25-29% and the macroporosity is 14-18%. This is consistent with a fractured, but coherent asteroid. Additional information is contained in the original extended abstract.

  1. Data získaná z komparativních politologických šetření

    Czech Academy of Sciences Publication Activity Database

    Lyons, Pat

    Praha : SLON, 2012 - (Krejčí, J.; Leontiyeva, Y.), s. 244-267 ISBN 978-80-7419-111-4; ISBN 978-80-7330-204-7 R&D Projects : GA MŠk LA09010 Institutional support: RVO:68378025 Keywords : political attitudes * voting behaviour * comparative survey research Subject RIV: AO - Sociology, Demography

  2. Volné radikály v lidských vlasech

    Czech Academy of Sciences Publication Activity Database

    Stopka, Pavel; Křížová, Jana; Navrátilová, E.

    2002-01-01

    Roč. 10, č. 4 (2002), s. 262-267. ISSN 1210-7921 R&D Projects: GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z4032918 Keywords : human hair * melanin * EPR spectroscopy Subject RIV: CA - Inorganic Chemistry

  3. Soil development on loess overlying Cretaceous sediments and Devonian limestones

    Czech Academy of Sciences Publication Activity Database

    Žigová, Anna; Šťastný, Martin

    2015-01-01

    Roč. 12, č. 3 (2015), s. 267-278. ISSN 1214-9705 Institutional support: RVO:67985831 Keywords : loess * Cretaceous and Devonian rocks * mineral composition * soil development * Luvic Chernozem * Albic Luvisol Subject RIV: DF - Soil Science Impact factor: 0.389, year: 2014

  4. Argillization of topaz-bearing granites in the Hub stock, Horní Slavkov-Krásno SN-W ore district (Bohemian Massif, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Šťastný, Martin; René, Miloš

    2014-01-01

    Roč. 11, č. 3 (2014), s. 255-267. ISSN 1214-9705 R&D Projects: GA ČR GA205/09/0540 Institutional support: RVO:67985831 ; RVO:67985891 Keywords : Bohemian Massif * Saxothuringian Zone * topaz granite * argillization * clay minerals * dickite * tosudite Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.389, year: 2014

  5. An Assessment of Publication Productivity in Career Development and Transition for Exceptional Individuals: 1978-2012

    Science.gov (United States)

    Unger, Darlene D.; Rumrill, Phillip D., Jr.

    2013-01-01

    This literature review examined publication patterns in the journal of "Career Development and Transition for Exceptional Individuals" across 35 years of publication. Overall, 732 contributors affiliated with 267 organizations were identified in our analysis of 436 articles. Frequency counts identified the most productive scholars in…

  6. Strontium substitution for Barium in superconductors Hg1-yVyBa2-xSrxCam-+CumO2m+2+d(m=1 , 2)

    Czech Academy of Sciences Publication Activity Database

    Knížek, Karel; Pollert, Emil; Malo, S.; Michel, C.; Hervieu, M.; Maignan, A.; Raveau, B.

    Delphi : Narosa Publishing House, 1998 - (Bose, S.), s. 267-271 ISBN 81-7319-155-7. [High Temperature Superconductivity - Ten Years after its Discovery (IN), 00.12.1996-00.12.1996] R&D Projects: GA ČR GA203/96/0448 Grant ostatní: CNRS(FR) 280

  7. Monitoring for Equality? Asylum Seekers and Refugees' Retention and Achievement in English for Speakers of Other Languages (ESOL)

    Science.gov (United States)

    Phillimore, Jenny

    2011-01-01

    Interest in the integration of refugees has grown with the increase in numbers of asylum seekers dispersed across the UK. The ability to communicate effectively in English is seen as the key priority in facilitating integration, while a lack of English language is seen as one of the major barriers to refugee employment. Some 267 million British…

  8. Discovery of a transient U-band dropout in a Lyman break survey : A tidally disrupted star at z=3.3?

    NARCIS (Netherlands)

    Stern, D; van Dokkum, PG; Nugent, P; Sand, DJ; Ellis, RS; Sullivan, M; Bloom, JS; Frail, DA; Kneib, JP; Koopmans, LVE; Treu, T

    2004-01-01

    We report the discovery of a transient source in the central regions of galaxy cluster A267. The object, which we call "PALS-1,'' was found in a survey aimed at identifying highly magnified Lyman break galaxies in the fields of intervening rich clusters. At discovery, the source had U(n)>24.7 (2 sig

  9. A periodic basis system of the smooth approximation space

    Czech Academy of Sciences Publication Activity Database

    Segeth, Karel

    2015-01-01

    Roč. 267, 15 September (2015), s. 436-444. ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : smooth approximation * data approximation * data interpolation * Fourier transform Subject RIV: BA - General Mathematics Impact factor: 1.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S0096300315001526

  10. Tectonic phase separation applied to the Sudetic Marginal Fault Zone (NE part of the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Nováková, Lucie

    2015-01-01

    Roč. 12, č. 2 (2015), s. 251-267. ISSN 1672-6316 R&D Projects: GA ČR GA205/09/1244 Institutional support: RVO:67985891 Keywords : Sudetic Marginal Fault Zone * paleostress reconstruction * active tectonics * frequency analysis Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.963, year: 2014

  11. Role of clay microstructure in expandable buffer clay

    Czech Academy of Sciences Publication Activity Database

    Pusch, R.; Přikryl, R.; Weishauptová, Zuzana; Xiaodong, L.; Knutsson, S.

    2012-01-01

    Roč. 1, č. 6 (2012), s. 267-292. ISSN 2232-1179 R&D Projects: GA ČR GA205/08/0676 Institutional research plan: CEZ:AV0Z30460519 Keywords : cementation * expandable clay * hydraulic conductivity Subject RIV: DL - Nuclear Waste, Radioactive Pollution ; Quality http://pure.ltu.se/portal/files/39920921/332.pdf

  12. Evaluation of Pediatric Patients with Orbital and Preseptal Cellulitis

    Directory of Open Access Journals (Sweden)

    Eren Cagan

    2015-06-01

    Conclusion: Preseptal cellulitis is more frequently observed than orbital cellulitis. The most important predisposing factor for orbital cellulitis is sinusitis. Patients with preseptal cellulitis suspected clinically may be diagnosed with orbital cellulitis radiologically. As a result radiological imaging of preseptal cellulitis patients should be considered. [Cukurova Med J 2015; 40(2.000: 267-274

  13. Towards the proof of the cosmic censorship hypothesis in cosmological space-times

    International Nuclear Information System (INIS)

    A theorem supporting the view that the cosmic censorship hypothesis proved recently by Krolak [A. Krolak, Gen. Relativ. Gravit. 15, 99 (1983); J. Class. Quantum Grav. 3, 267 (1986)] for asymptotically flat space-times, is true in general, is generalized so that it is applicable to cosmological situations

  14. 47 CFR 90.476 - Interconnection of fixed stations and certain mobile stations.

    Science.gov (United States)

    2010-10-01

    ...) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Transmitter Control Interconnected....483 and may be interconnected with the facilities of common carriers. (b) Mobile stations used to....35(c)(42), and 90.267 are not subject to the provisions of § 90.477(d)(3) and may be...

  15. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408. ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sums * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.551, year: 2014 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  16. Hydrodesulfurization Activities of NiMo Catalysts Supported on Mechanochemically Prepared Al‐Ce Mixed Oxides.

    Czech Academy of Sciences Publication Activity Database

    Jirátová, Květa; Spojakina, A.; Kaluža, Luděk; Palcheva, R.; Balabánová, Jana; Tyuliev, G.

    2016-01-01

    Roč. 37, č. 2 (2016), s. 258-267. ISSN 0253-9837 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : nickel * molybdenum * alumina Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.964, year: 2014

  17. Heterologous Expression in Budding Yeast as a Tool for Studying the Plant Cell Morphogenesis Machinery

    Czech Academy of Sciences Publication Activity Database

    Cvrčková, F.; Hála, Michal

    Vol. 1080. New York : Humana Press, 2014 - (Žárský, V.; Cvrčková, F.), s. 267-282 ISBN 978-1-62703-643-6. - (Methods in Molecular Biology) Institutional support: RVO:61389030 Keywords : Saccharomyces cerevisiae * Heterologous gene expression * Inducible expression system Subject RIV: EB - Genetics ; Molecular Biology

  18. Prevalence of Familial Hypercholesterolemia in Adolescents: Potential Value of Universal Screening?

    Science.gov (United States)

    Pang, Jing; Martin, Andrew C; Mori, Trevor A; Beilin, Lawrence J; Watts, Gerald F

    2016-03-01

    Familial hypercholesterolemia (FH) significantly increases the risk of coronary heart disease. Most individuals are unaware they have the condition. In the Western Australian Pregnancy Cohort (Raine) Study, 1 in 267 adolescents were found to have FH. Universal cholesterol screening in childhood may offer the best strategy for diagnosing FH. PMID:26690851

  19. Criteria for the diagnosis of corticobasal degeneration

    OpenAIRE

    Armstrong, Melissa J.; Litvan, Irene; Lang, Anthony E; Bak, Thomas H.; Bhatia, Kailash P.; Borroni, Barbara; Boxer, Adam L.; Dickson, Dennis W.; Grossman, Murray; Hallett, Mark; Josephs, Keith A.; Kertesz, Andrew; Lee, Suzee E; Miller, Bruce L.; Reich, Stephen G.

    2013-01-01

    Current criteria for the clinical diagnosis of pathologically confirmed corticobasal degeneration (CBD) no longer reflect the expanding understanding of this disease and its clinicopathologic correlations. An international consortium of behavioral neurology, neuropsychology, and movement disorders specialists developed new criteria based on consensus and a systematic literature review. Clinical diagnoses (early or late) were identified for 267 nonoverlapping pathologically confirmed CBD cases...

  20. Viscerální bolest

    Czech Academy of Sciences Publication Activity Database

    Paleček, Jiří; Vondráčková, D.; Navrátil, L.

    Praha : Tigis, 2006 - (Rokyta, R.; Kršiak, M.; Kozák, J.), s. 267-277 ISBN 80-903750-0-6 R&D Projects: GA MŠk(CZ) LC554; GA ČR(CZ) GA305/06/1115 Institutional research plan: CEZ:AV0Z50110509 Keywords : visceral pain * hyperalgesia * IBS Subject RIV: ED - Physiology

  1. 75 FR 80790 - Proposed Information Collection; Comment Request; Survey of Income and Program Participation...

    Science.gov (United States)

    2010-12-23

    ... Burden Hours: 133,953.\\1\\ \\1\\ (88,267 x .5 hr x 3 waves + 3,100 x .167 hr x 3 waves). Estimated Total... become a matter of public record. Dated: December 20, 2010. Glenna Mickelson, Management Analyst, Office... the proposed collection of information is necessary for the proper performance of the functions of...

  2. 75 FR 3200 - Proposed Information Collection; Comment Request; Survey of Income and Program Participation...

    Science.gov (United States)

    2010-01-20

    ...\\ \\1\\ Error! Main Document Only. (88,267 x .5 hr x 3 waves + 3,100 x .167 hr x 3 waves). Estimated... also will become a matter of public record. Dated: January 13, 2010. Glenna Mickelson, Management...) Whether the proposed collection of information is necessary for the proper performance of the functions...

  3. Model of the influence of energetic disorder on inter-chain charge carrier mobility in poly[2-methoxy-5-(2´-ethylhexyloxy)-p-phenylene vinylene

    Czech Academy of Sciences Publication Activity Database

    Toman, Petr; Nešpůrek, Stanislav; Weiter, M.; Vala, M.; Sworakowski, J.; Bartkowiak, W.; Menšík, Miroslav

    2009-01-01

    Roč. 20, č. 3 (2009), s. 263-267. ISSN 1042-7147 Institutional research plan: CEZ:AV0Z40500505 Keywords : charge transport * conducting polymers * photochromism Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.532, year: 2009

  4. Comparative Effectiveness of Medication versus Cognitive-Behavioral Therapy in a Randomized Controlled Trial of Low-Income Young Minority Women with Depression

    Science.gov (United States)

    Siddique, Juned; Chung, Joyce Y.; Brown, C. Hendricks; Miranda, Jeanne

    2012-01-01

    Objective: To examine whether there are latent trajectory classes in response to treatment and whether they moderate the effects of medication versus psychotherapy. Method: Data come from a 1-year randomized controlled trial of 267 low-income, young (M = 29 years), minority (44% Black, 50% Latina, 6% White) women with current major depression…

  5. Knowledge and Beliefs about Developmental Dyslexia in Pre-Service and In-Service Spanish-Speaking Teachers

    Science.gov (United States)

    Soriano-Ferrer, Manuel; Echegaray-Bengoa, Joyce; Joshi, R. Malathesa

    2016-01-01

    The present study investigated knowledge, misconceptions, and lack of information about dyslexia among pre-service (PST) and in-service (IST) Spanish-speaking teachers in Spain and Peru. Two hundred and forty-six pre-service teachers and 267 in-service teachers completed the Knowledge and Beliefs about Developmental Dyslexia Scale (KBDDS).…

  6. Effect of tandospirone, a serotonin-1A receptor partial agonist, on information processing and locomotion in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Horáček, J.; Sumiyoshi, T.

    2010-01-01

    Roč. 212, č. 2 (2010), s. 267-276. ISSN 0033-3158 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : Tandospirone * Schizophrenia * NMDA receptor Subject RIV: FH - Neurology Impact factor: 3.817, year: 2010

  7. An evaluation of flora from coastal sand dunes of India: Rationale for conservation and management

    Digital Repository Service at National Institute of Oceanography (India)

    Rodrigues, R.S.; Mascarenhas, A.; Jagtap, T.G.

    are found to be common to the west and east coasts. The west coast showed a greater diversity than the east coast, accounting for 267 and 163 species respectively. Fabaceae members dominated the flora and 62% of dune species exhibited an herbaceous habit...

  8. Monogeneans of fresh fishes from cenotes (sinkholes) of the Yucatan Peninsula, Mexico

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, E. F.; Scholz, Tomáš; Vivas-Rodriguez, C. M.; Vargas-Vázquez, J.

    1999-01-01

    Roč. 46, - (1999), s. 267-273. ISSN 0015-5683 R&D Projects: GA AV ČR KSK2022601 Grant ostatní: MX(XC) CONABIO Mexico PO 99 Subject RIV: FP - Other Medical Disciplines Impact factor: 0.796, year: 1999

  9. 78 FR 73850 - Pacific Fishery Management Council; Public Meetings and Hearings

    Science.gov (United States)

    2013-12-09

    ...: ``Review of 2013 Ocean Salmon Fisheries, Stock Assessment and Fishery Evaluation Document for the Pacific... Technical Team (STT) will meet at the Pacific Council office in a public work session to draft ``Review of... Drive, Coos Bay, OR 97420, telephone: (541) 267-4141. March 25, 2014: Hilton Sonoma Wine Country,...

  10. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.

    2011-01-01

    Roč. 18, č. 2 (2011), s. 267-271. ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 http://hrcak.srce.hr/search/?q=Using+waterjet+in+reverse+logistic+operations+in+discarded+munitions+processing

  11. "Exercise Dependence"--A Problem or Natural Result of High Activity?

    Science.gov (United States)

    Phelan, Suzanne; Bond, Dale S.; Lang, Wei; Jordan, Dustin; Wing, Rena R.

    2011-01-01

    Objectives: To compare physical activity (PA) and exercise dependence (ED) in 267 weight-loss maintainers (WLM) and 213 normal-weight (NW) controls. Methods: PA and ED assessed via accelerometery and the Exercise Dependence Questionnaire. Results: WLM had higher PA levels and ED scores than those of NW (P less than 0.0001). WLM status (P = 0.006)…

  12. 76 FR 34010 - Credit Risk Retention

    Science.gov (United States)

    2011-06-10

    ..., 2011, at 76 FR 24090, is extended. Comments on the Credit Risk NPR must be received on or before August... 76 FR 24090. The Credit Risk NPR would specify credit risk retention requirements for securitizers of...-AA43 DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT 24 CFR Part 267 RIN 2501-AD53 Credit Risk...

  13. Selected topics related to the transport and superconductivity in boron-doped diamond

    Czech Academy of Sciences Publication Activity Database

    Mareš, Jiří J.; Hubík, Pavel; Krištofik, Jozef; Nesládek, Miloš

    2008-01-01

    Roč. 9, č. 4 (2008), 044101/1-044101/6. ISSN 1468-6996 R&D Projects: GA AV ČR IAA1010404; GA ČR(CZ) GA202/06/0040 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystalline diamond * temperature Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.267, year: 2008

  14. Regulation of Isoprenoid Pheromone Biosynthesis in Bumblebee Males

    Czech Academy of Sciences Publication Activity Database

    Prchalová, Darina; Buček, Aleš; Brabcová, Jana; Žáček, Petr; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2016-01-01

    Roč. 17, č. 3 (2016), s. 260-267. ISSN 1439-4227 R&D Projects: GA MŠk LO1302; GA ČR GA15-06569S Institutional support: RVO:61388963 Keywords : biosynthesis * Bombus spp. * gene expression * isoprenoids * pheromones * transcriptional regulation Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2014

  15. Complete genome sequence and comparative genomic analysis of an emerging human pathogen, serotype V Streptococcus agalactiae

    NARCIS (Netherlands)

    Tettelin, H; Masignani, [No Value; Cieslewicz, MJ; Eisen, JA; Peterson, S; Paulsen, IT; Nelson, KE; Margarit, [No Value; Read, TD; Madoff, LC; Beanan, MJ; Brinkac, LM; Daugherty, SC; DeBoy, RT; Durkin, AS; Kolonay, JF; Madupu, R; Lewis, MR; Radune, D; Fedorova, NB; Scanlan, D; Khouri, H; Mulligan, S; Carty, HA; Cline, RT; Van Aken, SE; Gill, J; Scarselli, M; Mora, M; Iacobini, ET; Brettoni, C; Galli, G; Mariani, M; Vegni, F; Maione, D; Rinaudo, D; Rappuoli, R; Telford, JL; Kasper, DL; Grandi, G; Fraser, CM

    2002-01-01

    The 2,160,267 bp genome sequence of Streptococcus agalactiae, the leading cause of bacterial sepsis, pneumonia, and meningitis in neonates in the U.S. and Europe, is predicted to encode 2,175 genes. Genome comparisons among S. agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, and the oth

  16. 75 FR 53680 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Science.gov (United States)

    2010-09-01

    ... creates a substantial risk of injury to the public. In the Federal Register of May 18, 2010 (75 FR 27734... things, included the ``Children's Bicycle Helmet Safety Act of 1994'' Public Law 103-267, 108 Stat. 726... products under the Consumer Product Safety Act (74 FR 45428). The Commission uses the information...

  17. Domain Modeling: NP_065184.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_065184.2 chr1 Solution structure of the tandem four zf-C2H2 domain repeats of mu...rine GLI-Kruppel family member HKR3 c2dlqa_ chr1/NP_065184.2/NP_065184.2_holo_267-376.pdb psi-blast 274A,276

  18. Domain Modeling: NP_066574.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066574.2 chr2 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr2/NP_066574.2.../NP_066574.2_holo_254-335.pdb blast 255K,259C,261E,262C,263G,264K,265A,266F,267F,268D

  19. Geophysical Characteristic of Epikarst: Case Studies from Zagros Mts. (Iran) and the Koněprusy Region

    Czech Academy of Sciences Publication Activity Database

    Bosák, Pavel; Beneš, V.

    2003-01-01

    Roč. 32, č. 2 (2003), s. 255-267. ISSN 0583-6050 Institutional research plan: CEZ:AV0Z3013912 Keywords : epikarst * refraction seismic * Zagros Mts. and Koněprusy Devonian Subject RIV: DB - Geology ; Mineralogy http://carsologica.zrc-sazu.si/downloads/322/bosak.pdf

  20. The Effects of Social Capital Levels in Elementary Schools on Organizational Information Sharing

    Science.gov (United States)

    Ekinci, Abdurrahman

    2012-01-01

    This study aims to assess the effects of social capital levels at elementary schools on organizational information sharing as reported by teachers. Participants were 267 teachers selected randomly from 16 elementary schools; schools also selected randomly among 42 elementary schools located in the city center of Batman. The data were analyzed by…

  1. 40 CFR 63.150 - Emissions averaging provisions.

    Science.gov (United States)

    2010-07-01

    ..., appendix A. Mj=Molecular weight of organic HAP j, gram per gram-mole. n=Number of organic HAP's. (A) The..., kilopascals. M = Weighted average molecular weight of organic HAP's transferred at the transfer rack during... transfer rack i to calculate the weighted average rack molecular weight: ER22AP94.267 where: Mj =......

  2. Experiment list: SRX1338947 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ription=Progenitor cells from which all blood cells derive. 38987751,98.2,6.0,267 GSM1909031: Resistant line ChIP input...tion=Resistant || strain=C57BL/6 || chip antibody=none (input) http://dbarchive.b

  3. An improvement of dimension-free Sobolev imbeddings in r spaces

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, A.; Krbec, Miroslav; Schmeisser, H.-J.

    2014-01-01

    Roč. 267, č. 1 (2014), s. 243-261. ISSN 0022-1236 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : imbedding theorem * small Lebesgue space * rearrangement-invariant Banach Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022123614001724

  4. Degradation of polycyclic aromatic hydrocarbons by hydrogen peroxide catalyzed by heterogeneous polymeric metal chelates

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr; Cajthaml, Tomáš; Merhautová, Věra; Gabriel, Jiří; Nerud, František; Stopka, P.; Hrubý, Martin; Beneš, Milan J.

    2005-01-01

    Roč. 59, - (2005), s. 267-274. ISSN 0926-3373 R&D Projects: GA AV ČR IBS5020306; GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z7090911 Keywords : degradation * polycyclic aromatic hydrocarbon * hydrogen peroxide Subject RIV: EE - Microbiology, Virology Impact factor: 3.809, year: 2005

  5. Silicon nanocrystals in silica – Novel active waveguides for nanophotonics

    Czech Academy of Sciences Publication Activity Database

    Janda, P.; Valenta, J.; Ostatnický, T.; Skopalová, Eva; Pelant, Ivan; Elliman, R. G.; Tomasiunas, R.

    2006-01-01

    Roč. 121, - (2006), s. 267-273. ISSN 0022-2313 R&D Projects: GA AV ČR IAA1010316; GA ČR GP202/01/D030 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystal * waveguide * silicon * photonics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.441, year: 2006

  6. On p dependent boundedness of singular integral operators

    Czech Academy of Sciences Publication Activity Database

    Honzík, Petr

    2011-01-01

    Roč. 267, 3-4 (2011), s. 931-937. ISSN 0025-5874 Institutional research plan: CEZ:AV0Z10190503 Keywords : singular integral operators Subject RIV: BA - General Math ematics Impact factor: 0.749, year: 2011 http://www.springerlink.com/content/k507g30163351250/

  7. Salient Beliefs of Pre-Service Primary School Teachers Underlying an Attitude "Liking or Disliking Physics"

    Science.gov (United States)

    Kapucu, S.

    2014-01-01

    The aim of this study was to determine the salient beliefs of pre-service primary school teachers (PPSTs) about why they like or dislike physics and to explore whether these beliefs predict their teaching beliefs about physics. A total of 267 PPSTs (Male = 137, Female = 130) participated in the study. Qualitative data analyses were used and the…

  8. The Health of University Athletes: Attitudes, Behaviors, and Stressors.

    Science.gov (United States)

    Selby, Rosemary; And Others

    1990-01-01

    This study surveyed 267 university athletes to identify sources of stress for student athletes and sex differences among athletes with respect to health-related behaviors and attitudes. Specific recommendations based on the findings are made for health professionals who work with college athletes. (IAH)

  9. High-fluence implantation of iron into polyimide

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Hnatowicz, Vladimír; Peřina, Vratislav; Popok, V. N.; Khaibullin, R. I.; Bazarov, V. V.; Odzhaev, V. B.

    158/159, - (2002), s. 395-398. ISSN 0257-8972 R&D Projects: GA ČR GA203/99/1626; GA ČR GA102/01/1324 Keywords : polyimide * ion implantation * iron * Rutherford backscattering spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2002

  10. Doubly-doped BaY.sub.2./sub.F.sub.8./sub.:Er,Nd VUV scintillator

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Nikl, Martin; Fukuda, K.; Kawaguchi, N.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Babin, V.

    2010-01-01

    Roč. 45, 3-6 (2010), s. 265-267. ISSN 1350-4487 Grant ostatní: AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : energy transfer * luminescence * rare-earth fluorides * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.019, year: 2010

  11. Oikonyma jako prostředek pro poznání historického vývoje češtiny (aneb k výzkumu náslovného ou-)

    Czech Academy of Sciences Publication Activity Database

    Šimečková, Marta

    Bratislava : Veda, 2015 - (Valentová, I.), s. 267-271 ISBN 978-80-224-1426-5. [Slovenská onomastická konferencia /19./. Bratislava (SK), 28.04.2014-30.04.2014] R&D Projects: GA ČR GAP406/11/1786 Keywords : linguistics * onomastics * oikonyms * diachronic phonology * diphthongization * Czech Subject RIV: AI - Linguistics

  12. Preliminary estimation of bryophyte biomass and carbon pool from three contrasting different vegetation types

    Czech Academy of Sciences Publication Activity Database

    Singh, M.K.; Juhász, A.; Csintalan, Z.; Kaligaric, M.; Marek, Michal V.; Urban, Otmar; Tuba, Z.

    2005-01-01

    Roč. 33, č. 1 (2005), s. 267-270. ISSN 0133-3720 Grant ostatní: EU(CZ) HPRI-CT-2002-00197 Institutional research plan: CEZ:AV0Z60870520 Keywords : bryophyte * carbon pool * rain forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.320, year: 2005

  13. Evolutionary stability of optimal foraging: Partial preferences in the diet and patch models

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil

    2010-01-01

    Roč. 267, č. 4 (2010), s. 486-494. ISSN 0022-5193 Grant ostatní: The University of Tennessee(US) EF-0832858 Institutional research plan: CEZ:AV0Z50070508 Keywords : evolutionarily stable strategy * game theory * ideal free distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.371, year: 2010

  14. Percolation effect, thermodynamic properties of AgI and interface phases in AgI-Al.sub.2./sub.O.sub.3./sub. composites

    Czech Academy of Sciences Publication Activity Database

    Uvarov, N. F.; Vaněk, Přemysl; Savinov, Maxim; Železný, Vladimír; Studnička, Václav; Petzelt, Jan

    2000-01-01

    Roč. 127, - (2000), s. 253-267. ISSN 0167-2738 R&D Projects: GA ČR GA202/98/1282; GA ČR GA202/96/0425 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.529, year: 2000

  15. Crystal growth and luminescence properties of Li.sub.2./sub.B.sub.4./sub.O.sub.7./sub. single crystals doped with Ce, In, Ni, Cu and Ti ions

    Czech Academy of Sciences Publication Activity Database

    Senguttuvan, N.; Ishii, M.; Shimoyama, M.; Kobayashi, M.; Tsutsui, N.; Nikl, Martin; Dušek, Michal; Shimizu, H. M.; Oku, T.; Adachi, T.; Sakai, K.; Suzuki, J.

    2002-01-01

    Roč. 486, - (2002), s. 264-267. ISSN 0168-9002 R&D Projects: GA MŠk ME 462 Institutional research plan: CEZ:AV0Z1010914 Keywords : lithium tetraborate * crystal growth * neutron detection * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.167, year: 2002

  16. Rodina a životní úroveň v ČR

    Czech Academy of Sciences Publication Activity Database

    Červenka, Jan

    Praha : Sociologický ústav AV ČR, 2006 - (Hamplová, D.; Šalamounová, P.; Šamanová, G.), s. 267-279 ISBN 80-7330-082-6 Institutional research plan: CEZ:AV0Z70280505 Keywords : family * living standard * Czech Republic Subject RIV: AO - Sociology, Demography

  17. 78 FR 7280 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Vessels Using Pot Gear in the...

    Science.gov (United States)

    2013-02-01

    ... established by the final 2012 and 2013 harvest specifications for groundfish of the GOA (77 FR 15194, March 14, 2012) and inseason adjustment to the final 2013 harvest specifications for Pacific cod (78 FR 267... Economic Zone Off Alaska; Pacific Cod by Vessels Using Pot Gear in the Western Regulatory Area of the...

  18. 78 FR 10102 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Cod by Vessels Using Pot Gear in the...

    Science.gov (United States)

    2013-02-13

    ... established by the final 2012 and 2013 harvest specifications for groundfish of the GOA (77 FR 15194, March 14, 2012) and inseason adjustment to the final 2013 harvest specifications for Pacific cod (78 FR 267... Economic Zone Off Alaska; Pacific Cod by Vessels Using Pot Gear in the Central Regulatory Area of the...

  19. Methylated trivalent arsenicals are potent inhibitors of glucose stimulated insulin secretion by murine pancreatic islets

    Czech Academy of Sciences Publication Activity Database

    Doulliet, Ch.; Currier, J. M.; Saunders, J.; Bodnar, W. M.; Matoušek, Tomáš; Stýblo, M.

    2013-01-01

    Roč. 267, č. 1 (2013), s. 11-15. ISSN 0041-008X R&D Projects: GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : arsenic speciation * tissue * hydride generation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.630, year: 2013

  20. A Study of the Interpersonal Value Orientations of Extension Homemakers in Robeson County, North Carolina.

    Science.gov (United States)

    Briley, Mollye Hughes

    This study investigated interpersonal value orientations (Support, Conformity, Independence, Benevolence, Leadership, and Recognition) of 267 Extension homemakers in Robeson County, North Carolina, and the relationship of these orientations to age, educational level, income, years in club work, family size, and ethnic group. Data were obtained…

  1. Search for weakly decaying (Lambda n)over-bar and Lambda Lambda exotic bound states in central Pb-Pb collisions at root S-NN=2.76 TeV

    Czech Academy of Sciences Publication Activity Database

    Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Brož, M.; Čepila, J.; Contreras, J. G.; Eyyubova, G.; Ferencei, Jozef; Křelina, M.; Křížek, Filip; Kučera, Vít; Kushpil, Svetlana; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Schulc, M.; Špaček, M.; Šumbera, Michal; Vajzer, Michal; Vaňát, Tomáš; Závada, Petr

    2016-01-01

    Roč. 752, JAN (2016), s. 267-277. ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13031 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * matter Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 6.131, year: 2014

  2. 77 FR 36341 - Control of Air Pollution From Aircraft and Aircraft Engines; Emission Standards and Test Procedures

    Science.gov (United States)

    2012-06-18

    ...EPA is adopting several new aircraft engine emission standards for oxides of nitrogen (NOX), compliance flexibilities, and other regulatory requirements for aircraft turbofan or turbojet engines with rated thrusts greater than 26.7 kilonewtons (kN). We also are adopting certain other requirements for gas turbine engines that are subject to exhaust emission standards as follows.......

  3. 78 FR 24201 - Graco, Inc.; Analysis of Agreement Containing Consent Order To Aid Public Comment

    Science.gov (United States)

    2013-04-24

    ... and imminent public harm.'' 64 FR 46,267, 46,268 (1999). This is an appropriate case in which to issue... purchase and inventory thresholds, loyalty discounts that might be viewed as de facto exclusive... the willingness of distributors to purchase fast-set equipment from Gama/PMC, for fear that...

  4. Psychiatric Disorder

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    2005514 Comparison of cognitive function and P300potentials in first-episode schizophrenia treated withrisperidone and clozapine.WANG Changhong(王长虹),et al.Dept Psychiat,Mental Health Instit,2nd Xian-gya Hosp,Centr South Univ,Changsha 410011.Chin JNerv Ment Dis 2005;31(4):267-271.

  5. Conjugacy Class Sizes and Solvability of Finite Groups

    Indian Academy of Sciences (India)

    Qinhui Jiang; Changguo Shao

    2013-05-01

    Let be a finite group and * be the set of primary, biprimary and triprimary elements of . We prove that if the conjugacy class sizes of * are {1,,,} with positive coprime integers and ,then is solvable. This extends a recent result of Kong (Manatsh. Math. 168(2)(2012) 267–271).

  6. Recommendations of the International Medical Informatics Association (IMIA) on Education in Health and Medical Informatics

    Czech Academy of Sciences Publication Activity Database

    Arokiasamy, J.; Ball, M.; Barnett, D.; Bearman, M.; Bemmel van, J.; Douglas, J.; Fisher, P.; Garrie, R.; Gatewood, L.; Goossen, W.; Grant, A.; Hales, J.; Hasman, A.; Haux, R.; Hovenga, E.; Johns, M.; Knaup, P.; Leven, F. J.; Lorenzi, N.; Murray, P.; Neame, R.; Protti, D.; Power, M.; Richard, J.; Schuster, E.; Swinkels, W.; Yang, J.; Zelmer, L.; Zvárová, Jana

    2001-01-01

    Roč. 40, č. 5 (2001), s. 267-277. ISSN 0026-1270 Institutional research plan: AV0Z1030915 Keywords : health informatics * medical informatics * education * recommendations * International Medical Informatics Association * IMIA Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.254, year: 2001

  7. American and Chinese Children's Evaluations of Personal Domain Events and Resistance to Parental Authority

    Science.gov (United States)

    Smetana, Judith G.; Wong, Mun; Ball, Courtney; Yau, Jenny

    2014-01-01

    A total of 267 five-, seven-, and ten-year-olds (M = 7.62), 147 in Hong Kong and 120 in the United States, evaluated hypothetical personal (and moral) events described as either essential or peripheral to actors' identity. Except for young Chinese in the peripheral condition, straightforward personal events were overwhelmingly evaluated as…

  8. Increased Exposure to Alcohol and Cannabis Education and Changes in Use Patterns.

    Science.gov (United States)

    Smart, Reginald G.

    1989-01-01

    Used data from Ontario Alcohol and Drug Use Among Students survey (N=4,267) to determine how reported alcohol and cannabis (marijuana) use changed with increased exposure to drug education. Concluded drug education had stronger influence on younger students and lighter drinkers but little impact on heavy drinkers. Found decrease in cannabis use…

  9. Variaţii privind trimiterile preliminare la Curtea de Justiţie provenite din statele membre – Sunt factorii structurali (parte a) explicaţiei?

    DEFF Research Database (Denmark)

    Broberg, Morten; Fenger, Niels

    2013-01-01

    The preliminary reference procedure in Article 267 of the Treaty on the Functioning of the European Union (TFEU), which enables national courts to request the Court of Justice to provide a ruling on the interpretation or validity of an EU legal act, is widely considered to be the jewel in the crown...

  10. Jaderná energetika v roce 2014

    Czech Academy of Sciences Publication Activity Database

    Wagner, Vladimír

    2014-01-01

    Roč. 65, č. 5 (2014), s. 261-267. ISSN 0375-8842 Institutional support: RVO:61389005 Keywords : nuclear energy * fast breeder reactors * reactor of III+ generation * Fukushima I * Germany Energiewende Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  11. Fabric transpositions in granite plutons - an insight from non-scaled analogue modelling

    Czech Academy of Sciences Publication Activity Database

    Kratinová, Zuzana; Machek, Matěj; Kusbach, V.

    2010-01-01

    Roč. 75, č. 1 (2010), s. 267-277. ISSN 0016-7622 R&D Projects: GA AV ČR KJB300120702 Institutional research plan: CEZ:AV0Z30120515 Keywords : analogue modelling * magmatic fabrics * granite intrusions * rheology * AMS Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.396, year: 2010

  12. Generation and basic characterization of glutamate carboxypeptidase II knock-out mice

    Czech Academy of Sciences Publication Activity Database

    Vorlová, Barbora; Kašpárek, Petr; Šácha, Pavel; Sedláček, Radislav; Konvalinka, Jan

    2016-01-01

    Roč. 25, č. 2 (2016), s. 267. ISSN 0962-8819. [Transgenic Technology Meeting (TT2016) /13./. 20.03.2016-23.03.2016, Praha] Institutional support: RVO:61388963 ; RVO:68378050 Keywords : GCPII * PSMA * FolhI * knock-out mice Subject RIV: CE - Biochemistry

  13. The Estimation of the Joint Angles of Upper Limb During Walking Using Fuzzy Logic Systems and Relation Maps

    Czech Academy of Sciences Publication Activity Database

    Škoda, D.; Kutílek, P.; Socha, V.; Schlenker, J.; Štefek, A.; Kalina, Jan

    Budapest: IEEE Hungary Section, 2015, s. 267-272. ISBN 978-1-4799-8220-2. [SAMI 2015. International Symposium on Applied Machine Intelligence and Informatics /13./. Herl'any (SK), 22.01.2015-24.01.2015] Institutional support: RVO:67985807 Keywords : fuzzy logic * upper extremities * human gait * rhythmical movement * joint ahgles * relation maps Subject RIV: FI - Traumatology, Orthopedics

  14. The Impact of Pubertal Timing and Parental Control on Adolescent Problem Behaviors

    Science.gov (United States)

    Arim, Rubab G.; Shapka, Jennifer D.

    2008-01-01

    This study examined the relationship among pubertal timing, parental control, and problem behaviors. There were 267 participants, whose ages ranged from 9 to 16 years. Both maternal and paternal psychological control predicted problem behaviors over and above the effects of behavioral control. For boys, early maturation and high levels of paternal…

  15. 近期外文文献题录

    Institute of Scientific and Technical Information of China (English)

    喻萍; 严而清

    2004-01-01

    Experimental study of enriched froen diet on digestive enzymes and growth of jnvenile cuttlefish Sepia officinalis L.(Mollusca Cephalopoda),[刊,英]/PerrinA,Le Bihan E,Koueta N,//Journal of Experimental Marine Biology and Ecology,—2004,311(16)—267∽285.

  16. Analysis of a Mycoplasma hominis membrane protein, P120

    DEFF Research Database (Denmark)

    Christiansen, Gunna; Mathiesen, SL; Nyvold, Charlotte Guldborg;

    1994-01-01

    The monoclonal antibody mAb 26.7D generated against a clinical isolate of Mycoplasma hominis 7488 was shown to react with a surface-exposed epitope on a 120-kDa protein (P120). The gene encoding the protein was cloned and sequenced, and the transcriptional start point was determined by primer...

  17. Laboratoř experimentální analýzy napětí (LEAN) V ÚT AV ČR - její současný stav, možnosti i perspektivy

    Czech Academy of Sciences Publication Activity Database

    Trnka, Jan

    Praha : Ústav termomechaniky AV ČR, 2003 - (Dobiáš, I.), s. 267-272 ISBN 80-85918-81-1. [Colloquium dynamics of machines. Praha (CZ), 09.02.1999-10.02.1999] Institutional research plan: CEZ:AV0Z2076919 Keywords : dynamic photoelasticity * highspeed cinematography * optical topography Subject RIV: BH - Optics, Masers, Lasers

  18. Complete genome sequence of an emerging melon necrotic spot virus isolate infecting greenhouse cucumber in North America

    Science.gov (United States)

    The complete genome (4,267 nt) of an Melon necrotic spot virus (MNSV) isolate (ABCA13-01) infecting greenhouse cucumber in Canada was determined through deep sequencing of small RNAs. Its genome sequence was most closely related to MNSV-N (97%), but lacking a 55-nt insertion at the 3’UTR for resista...

  19. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

    Czech Academy of Sciences Publication Activity Database

    Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta

    2004-01-01

    Roč. 69, č. 4 (2004), s. 267-272. ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak-point pressure Subject RIV: FK - Gynaecology, Childbirth

  20. LGBT Adult Immigrants in the United States

    OpenAIRE

    Gates, Gary J.

    2013-01-01

    There are approximately 267,000 LGBT-identified individuals among the adult undocumented immigrant population and an estimated 637,000 LGBT-identified individuals among the adult documented immigrant population. The report finds that approximately 71 percent of undocumented LGBT adults are Hispanic and 15 percent of undocumented LGBT adults are Asian or Pacific Islander.

  1. Risk assessment and management strategies at local level

    Czech Academy of Sciences Publication Activity Database

    Yates, T.; Drdácký, Miloš; Pospíšil, Stanislav; Grontoft, T.

    Boston: Springer, 2009 - (Watt, J.; Tidblad, J.; Kucera, V.; Hamilton, R.), s. 215-267 ISBN 978-0-387-84892-1 Institutional research plan: CEZ:AV0Z20710524 Keywords : cultural heritage * pollution * building damage * protection Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. Zaniklá kaple olomouckých dominikánek

    Czech Academy of Sciences Publication Activity Database

    Mezihoráková, Klára

    Praha: Artefactum, 2015 - (Chlíbec, J.; Opačić, Z.), s. 267-278 ISBN 978-80-86890-75-3 Institutional support: RVO:68378033 Keywords : Dominican nuns * chapel * Olomouc * medieval architecture Subject RIV: AL - Art, Architecture , Cultural Heritage

  3. Sociolinguistic Bibliography of European Countries for 2008: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr

    2010-01-01

    Roč. 24, č. 1 (2010), s. 267-272. ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistic s * bibliography * Czech Republic Subject RIV: AI - Linguistics

  4. Comparative analysis of thermal stability of two different nc-TiC/a-C:H coatings

    Czech Academy of Sciences Publication Activity Database

    Zábranský, L.; Buršíková, V.; Daniel, L.; Souček, P.; Vašina, P.; Dugáček, J.; Sťahel, P.; Caha, O.; Buršík, Jiří; Peřina, Vratislav

    2015-01-01

    Roč. 267, APR (2015), s. 32-39. ISSN 0257-8972 R&D Projects: GA MŠk(CZ) LM2011019 Institutional support: RVO:68081723 ; RVO:61389005 Keywords : nanocomposite * thermal annealing * hardness Subject RIV: BM - Solid Matter Physics ; Magnetism; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 1.998, year: 2014

  5. Guiding and amplification of light due to silicon nanocrystals embedded in waveguides

    Czech Academy of Sciences Publication Activity Database

    Ostatnický, T.; Rejman, M.; Valenta, J.; Herynková, Kateřina; Pelant, Ivan

    Vol. kap 10. Hackensack: Pan Stanford Publishing, 2008 - (Khriachtchev, L.), s. 267-296 ISBN 9789814241137 R&D Projects: GA AV ČR IAA1010316; GA MŠk LC510; GA ČR GA202/07/0818 Institutional research plan: CEZ:AV0Z10100521 Keywords : silicon nanocrystals * photoluminescence * spectral filtering Subject RIV: BM - Solid Matter Physics ; Magnetism

  6. Ochrana soukromí

    Czech Academy of Sciences Publication Activity Database

    Matejka, Ján

    Plzeň: Aleš Čeněk, s.r.o, 2005 - (Klíma, K.), s. 267-276 ISBN 80-86898-15-6 R&D Projects: GA AV ČR(CZ) KJB7068402 Keywords : Charter of fundamental rights and freedoms * lagal system Subject RIV: AG - Legal Sciences

  7. 40 CFR 262.41 - Biennial report.

    Science.gov (United States)

    2010-07-01

    ... generator who ships any hazardous waste off-site to a treatment, storage or disposal facility within the... disposal facility within the United States; (5) A description, EPA hazardous waste number (from 40 CFR part... the provisions of 40 CFR parts 270, 264, 265, 266, and 267. Reporting for exports of hazardous...

  8. Shedding consistency of strongyle-type eggs in dutch boarding horses

    NARCIS (Netherlands)

    Dopfer, D.D.V.; Kerssens, C.M.; Meijer, Y.G.M.; Boersema, J.H.; Eysker, M.

    2004-01-01

    Faeces of 484 horses were sampled twice with an interval of 6 weeks while anthelmintic therapy was halted. Faecal eggs counts revealed that 267 (55.2%) horses had consistently low numbers of eggs per gram faeces (EPG) (EPG <100 or = 100), 155 (32.0%) horses had consistently high EPGs (EPG > 10

  9. Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2013-01-01

    Roč. 61, č. 3 (2013), s. 257-267. ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx

  10. Body Image, Self-Esteem, and Health-Related Behaviors among Male and Female First Year College Students

    Science.gov (United States)

    Lowery, Sarah E.; Kurpius, Sharon E. Robinson; Befort, Christie; Blanks, Elva Hull; Sollenberger, Sonja; Nicpon, Megan Foley; Huser, Laura

    2005-01-01

    This study examined the relationships among self-esteem, body image, and health-related behaviors of 267 female and 156 male first-year college students. Data were collected in 23 classrooms. Instruments included a demographic sheet, the Objectified Body Consciousness Scale, the Weight and Appearance Visual Analogue Scales, the Contour Drawing…

  11. A Community-based Survey of the Awareness and Acceptability of Oral Rehydration Therapy (ORT) as a Treatment for Acute Diarrhoea in Children.

    Science.gov (United States)

    Ekanem, E. E.; Benebo, N. S.

    1988-01-01

    A total of 267 Nigerian mothers with children under the age of five years were investigated regarding the degree of their awareness and acceptance of oral rehydration therapy in the treatment of childhood diarrhea. Results indicate that only 39 percent of the mothers had heard of ORT in treating diarrhea. (RJC)

  12. En el umbral del lenguaje

    OpenAIRE

    Carlos Barreiro Ortiz

    2014-01-01

    La lengua umbra. Descubrimiento - Endolingüística- Arqueolingüística. Guillermo Rendón G. Ministerio de Cultura, Programa Nacional de Concertación Cultural, Universidad de Caldas, Instituto Bókkota de Altos Estudios, Asociación para el Fomento de la Calidad Artística, Manizales, 2011, 267 págs., il.

  13. Burnout, Self-Efficacy, and Successful Intelligence among Chinese Prospective and In-Service School Teachers in Hong Kong

    Science.gov (United States)

    Chan, David W.

    2007-01-01

    This study assessed the three components of burnout (emotional exhaustion, depersonalisation, and reduced personal accomplishment), perceived self-efficacy, and the three triarchic abilities (analytical, synthetic, and practical) of successful intelligence in a sample of 267 Chinese prospective and in-service teachers in Hong Kong. The aim was to…

  14. Possible Suppression of Magnetorotational Instability by Rapid Radial Flow

    Czech Academy of Sciences Publication Activity Database

    Abramowicz, M. A.; Horák, Jiří; Kluzniak, W.

    2013-01-01

    Roč. 63, č. 2 (2013), s. 267-273. ISSN 0001-5237 R&D Projects: GA ČR(CZ) GAP209/11/2004 Institutional support: RVO:67985815 Keywords : accretion disks * magnetohydrodynamics * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.955, year: 2013

  15. Interpersonal Trust Consistency and the Quality of Peer Relationships during Childhood

    Science.gov (United States)

    Rotenberg, Ken J.; Boulton, Michael

    2013-01-01

    Five hundred five children (267 female) enrolled in school years 5 and 6 in the UK (M = 9 years and 9 months) completed measures of trust beliefs in peers, best friendships, ascriptions of trustworthiness, and trustworthiness toward peers. Children's social disengagement, peer preference, and peer victimization were assessed by sociometric…

  16. Decline of brown trout () in Switzerland - How to assess potential causes in a multi-factorial cause-effect relationship

    OpenAIRE

    Burkhardt-Holm, Patricia

    2008-01-01

    Decline of brown trout (Salmo trutta) in Switzerland - How to assess potential causes in a multi-factorial cause-effect relationship correspondence: Corresponding author. (Burkhardt-Holm, Patricia) (Burkhardt-Holm, Patricia) Institute Man-Society-Environment, Department of Environmental Sciences, University of Basel - Vesalgasse 1--> , CH-4051 Basel--> , Tel. +41 ? 61 ? 267 04 02--> - SWITZERL...

  17. Search for fullerenes in geological carbonaceous samples altered by experimental lightning

    Czech Academy of Sciences Publication Activity Database

    Frank, O.; Jehlička, J.; Hamplová, Věra

    2003-01-01

    Roč. 11, č. 3 (2003), s. 257-267. ISSN 1536-383X Institutional research plan: CEZ:AV0Z1010914 Keywords : fullerens * geological samples * lightning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.433, year: 2003

  18. Transient expression of fusion gene coding for the HPV-16 epitopes fused to the sequence of potyvirus coat protein using different means of inoculation of Nicotiana benthamiana and Brassica rapa, cv. Rapa plants

    Czech Academy of Sciences Publication Activity Database

    Hoffmeisterová, Hana; Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Kmoníčková, Jitka; Velemínský, Jiří

    2008-01-01

    Roč. 94, č. 3 (2008), s. 261-267. ISSN 0167-6857 R&D Projects: GA ČR GA521/06/0973 Institutional research plan: CEZ:AV0Z50380511 Keywords : Edible vaccine * epitope expression * E7 oncogen Subject RIV: EE - Microbiology, Virology Impact factor: 1.017, year: 2008

  19. Protective cytokinin action switches to damaging during senescence of detached wheat leaves in continuous light

    Czech Academy of Sciences Publication Activity Database

    Vlčková, A.; Špundová, M.; Kotabová, E.; Novotný, R.; Doležal, Karel; Nauš, J.

    2006-01-01

    Roč. 126, č. 2 (2006), s. 257-267. ISSN 0031-9317 R&D Projects: GA AV ČR IBS4055304 Grant ostatní: FRVŠ MŠk FRVŠ 3190/2005 Institutional research plan: CEZ:AV0Z50380511 Keywords : senescence * cytokinin * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 2.169, year: 2006

  20. Medical Management of the Transplant Patient: Long-term Follow-up

    OpenAIRE

    Massin, Edward K.

    1987-01-01

    Of the 165 patients who have undergone cardiac transplantation at the Texas Heart Institute since 1982,* 159 long-term survivors have been followed up for an average of 1 year. Here I report on post-transplant complications in both the short and long terms, giving figures and treatment protocols where applicable. (Texas Heart Institute Journal 1987; 14: 262-267)

  1. High-Throughput Retina-Array for Screening 93 Genes Involved in Inherited Retinal Dystrophy

    OpenAIRE

    Song, Jin; Smaoui, Nizar; Ayyagari, Radha; Stiles, David; Benhamed, Sonia; MacDonald, Ian M.; Daiger, Stephen P.; Tumminia, Santa J.; Hejtmancik, Fielding; Wang, Xinjing

    2011-01-01

    To facilitate mutation screening in patients, a custom resequencing chip has been developed to detect sequence alterations of 267,550 bases of both sense and antisense sequences in 1,470 exons spanning 93 genes involved in inherited retinal dystrophy.

  2. SMBH Luminosity in the Starburst Environment

    Czech Academy of Sciences Publication Activity Database

    Silich, S.; Tenorio-Tagle, G.; Hueyotl-Zahuantitla, F.; Palouš, Jan; Wünsch, Richard

    Cambridge : Cambridge University Press, 2010 - (Peterson, B.). s. 336-336 ISBN 978-0-521-76502-2. [Symposium of the International Astronomical Union /267./. 10.08.2009-14.08.2009, Rio de Janeiro] Institutional research plan: CEZ:AV0Z10030501 Keywords : Seyfert, galaxies * starburst, accretion * hydrodynamics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  3. Some unique activities of the smallest reactor : UTR-KINKI

    International Nuclear Information System (INIS)

    In the UTR-KINKI, school teaches trainings are being done, besides utilizations for research and student experiments. In this paper, some details of the school teachers training course are presented. 267 teachers have attended the training since 1987, the beginning of the program. Drastic impacts by the training were recognized in impressions of the attended teachers about nuclear energy. (author)

  4. Fungal community on decomposing leaf litter undergoes rapid successional changes

    Czech Academy of Sciences Publication Activity Database

    Voříšková, Jana; Baldrian, Petr

    2013-01-01

    Roč. 7, č. 3 (2013), s. 477-486. ISSN 1751-7362 R&D Projects: GA MŠk(CZ) ME10152; GA MŠk LD12050; GA ČR GAP504/12/0709 Institutional support: RVO:61388971 Keywords : fungi * litter decomposition * cellulose Subject RIV: EE - Microbiology, Virology Impact factor: 9.267, year: 2013

  5. Common fixed points for family of mappings

    OpenAIRE

    Whitfield, J.H.M.; Singh, K. L.; Anderson, D. E.

    1984-01-01

    The main aim of the present paper is to prove the existence of common fixed points for mappings which are not necessarily continuous. Our results, which are primarly motivated by investigation of Husain and Sehgal (Bull. Austral. Math. Soc. 13 (1975), 261-267), generalize the results of Husain and Sehgal, Sehgal, Kannan, Reich, Hardy and Rogers, and others.

  6. Synthesis and gas permeability of block copolymers composed of poly(styrene-co-acrylonitrile) and polystyrene blocks

    Czech Academy of Sciences Publication Activity Database

    Lokaj, Jan; Brožová, Libuše; Holler, Petr; Pientka, Zbyněk

    2002-01-01

    Roč. 67, č. 2 (2002), s. 267-278. ISSN 0010-0765 R&D Projects: GA ČR GA203/99/0572 Institutional research plan: CEZ:AV0Z4050913 Keywords : azeotropic styrene- acrylonitrile copolymers * block copolymers * nitroxide-mediated copolymerization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.848, year: 2002

  7. ENVIRONMENTAL TECHNOLOGY VERIFICATION, TEST REPORT OF CONTROL OF BIOAEROSOLS IN HVAC SYSTEMS, FILTRATION GROUP, AEROSTAR "C-SERIES" POLYESTER PANEL FILTER

    Science.gov (United States)

    The Environmental Technology Verification report discusses the technology and performance of the AeroStar "C-Series" Polyester Panel Filter air filter for dust and bioaerosol filtration manufactured by Filtration Group. The pressure drop across the filter was 126 Pa clean and 267...

  8. Fission product interactions with nitrogen donor ligands used for spent nuclear fuel treatment

    Czech Academy of Sciences Publication Activity Database

    Aneheim, E.; Grüner, Bohumír; Ekberg, C.; Foreman, M.R.S.J.; Hájková, Zuzana; Löfström-Engdahl, E.; Drew, M. G. B.; Hudson, M.J.

    2013-01-01

    Roč. 50, č. 1 (2013), s. 154-163. ISSN 0277-5387 R&D Projects: GA MŠk(CZ) 7G08073 Grant ostatní: ACSEPT(XE) FP7-CP-2007-211 267 Institutional support: RVO:61388980 Keywords : BTBP * palladium * complexation * water solubility Subject RIV: CA - Inorganic Chemistry Impact factor: 2.047, year: 2013

  9. Radiolysis of C5-BTBP in cyclohexanone irradiated in the absence and presence of an aqueous phase

    Czech Academy of Sciences Publication Activity Database

    Fermvik, A.; Aneheim, E.; Grüner, Bohumír; Hájková, Zuzana; Kvíčalová, Magdalena; Ekberg, C.

    2012-01-01

    Roč. 100, č. 4 (2012), s. 273-282. ISSN 0033-8230 Grant ostatní: ACSEPT(XE) FP7-CP-2007-211 267 Institutional research plan: CEZ:AV0Z40320502 Keywords : radiolysis * degradation product * solvent extraction * partitioning * BTBP Subject RIV: CA - Inorganic Chemistry Impact factor: 1.373, year: 2012

  10. Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size

    Czech Academy of Sciences Publication Activity Database

    Martínková, Natália; Moravec, J.

    2012-01-01

    Roč. 61, 3-4 (2012), s. 254-267. ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  11. Znečištění ovzduší oxidem dusným a vliv průmyslových procesů na jeho emise

    Czech Academy of Sciences Publication Activity Database

    Borovec, K.; Danihelka, P.; Kula, Petr; Ochodek, T.

    1998-01-01

    Roč. 3, č. 3 (1998), s. 267-272. ISSN 1335-1788. [Vývojové trendy v baníctve a energetike z pohľadu perspektívnej aplikácie "Clean coal technology II ". Košice, 18.11.1998-20.11.1998] Subject RIV: DI - Air Pollution ; Quality

  12. Environmental distribution of coral-associated relatives of apicomplexan parasites

    Czech Academy of Sciences Publication Activity Database

    Janouškovec, J.; Horák, Aleš; Barott, K. L.; Rohwer, F. L.; Keeling, P. J.

    2013-01-01

    Roč. 7, č. 2 (2013), s. 444-447. ISSN 1751-7362 Institutional support: RVO:60077344 Keywords : apicomplexan-related lineages * Chromera * coral symbionts * coral reef ecosystem Subject RIV: EH - Ecology, Behaviour Impact factor: 9.267, year: 2013

  13. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Gretarsdottir, Solveig; Baas, Annette F; Thorleifsson, Gudmar;

    2010-01-01

    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to as...

  14. Legal and Quasi-legal Thresholds of the Accession of the Czech Republic to the EC

    Czech Academy of Sciences Publication Activity Database

    Balaš, Vladimír

    The Hague : T. M. C. Asser Instituut, 2001 - (Kellermann, A.), s. 267-277 [The Constitutional Impact of Enlargement at EU and National Level. The Hague (NL), 20.09.2000-23.09.2000] Institutional research plan: CEZ:AV0Z7068917 Keywords : International Law * European Law * Municipal Law Subject RIV: AG - Legal Sciences

  15. AcEST: DK950076 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = 72/86 (83%), Positives = 82/86 (95%) Frame = +3 Query: 87 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDV...KCQGCFSITTVFSHSQTVVLCGN 266 MVL NDIDLL+PPAE+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQTVV+CGN Sbj...ct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN 60 Query: 267 CSAVLCQPTGGRARLTEGSSFRKKGD ...HPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN 266 MVL NDIDLLHPP E+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQ...TVV+CGN Sbjct: 1 MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN 60

  16. Peer Deviancy Training and Peer Coercion: Dual Processes Associated with Early-Onset Conduct Problems

    Science.gov (United States)

    Snyder, James; Schrepferman, Lynn; McEachern, Amber; Barner, Stacy; Johnson, Kassy; Provines, Jessica

    2008-01-01

    The prospective relationships of conduct problems and peer coercion and deviancy training during kindergarten (mean age = 5.3 years) to overt and covert conduct problems in third-fourth grade were examined in a sample of 267 boys and girls. Coercion and deviancy training were distinct peer processes. Both were associated with earlier child conduct…

  17. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.

    2014-01-01

    Roč. 6, č. 3 (2014), s. 259-267. ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  18. Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

    Czech Academy of Sciences Publication Activity Database

    Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.

    2015-01-01

    Roč. 473, 1 January (2015), s. 267-273. ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.056, year: 2014

  19. 1.4 million cubic metres of achievement

    International Nuclear Information System (INIS)

    After five years of civil engineering work, the accent at CERN's 26.7 kilometre LEP electron-positron collider is now on installation. The first 2.8 kilometre section is now virtually complete and awaits the first positron test beam this summer, while the preparations for the four big detectors enter their final phase. (orig./HSI).

  20. Distribuce uranu a thoria v širším okolí Temelína

    Czech Academy of Sciences Publication Activity Database

    René, Miloš

    2002-01-01

    Roč. 10, - (2002), s. 264-267. ISSN 1211-0329 R&D Projects: GA MŠk ME 555 Institutional research plan: CEZ:AV0Z3046908 Keywords : paragneiss * granitoids * Moldanubian Zone Subject RIV: DB - Geology ; Mineralogy

  1. Provenance of Neoproterozoic to upper Cretaceous sedimentary rocks, eastern Greenland: Implications for recognizing the sources of sediments in the Norwegian Sea

    Czech Academy of Sciences Publication Activity Database

    Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.

    2011-01-01

    Roč. 238, 3/4 (2011), s. 254-267. ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011

  2. A Heftier Price Tag

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    With its economy revving up,China is paying a larger share of the UN budget Starting from this year, China’s share of the UN budget is increased to 2.67 percent, or more than $40 million annually, for the next three years, up considerably from the previous 2.05 percent.

  3. Elevated Antisaccade Error Rate as an Intermediate Phenotype for Psychosis Across Diagnostic Categories

    OpenAIRE

    Reilly, James L.; Frankovich, Kyle; Hill, Scot; Gershon, Elliot S.; Keefe, Richard S.E.; Keshavan, Matcheri S.; Pearlson, Godfrey D.; Tamminga, Carol A.; John A. Sweeney

    2013-01-01

    Background: Elevated antisaccade error rate, reflecting problems with inhibitory behavioral control, is a promising intermediate phenotype for schizophrenia. Here, we consider whether it marks liability across psychotic disorders via common or different neurophysiological mechanisms and whether it represents a neurocognitive risk indicator apart from the generalized cognitive deficit. Methods: Schizophrenia (n = 267), schizoaffective (n = 150), and psychotic bipolar (n = 202) probands, their ...

  4. AcEST: DK958477 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B, mitochondrial OS=Xenopus tropicalis GN=ccdc90b PE=2 SV=2 Length = 267 Score = ...Coiled-coil domain-containing protein 90A, mitochondrial OS=Xenopus tropicalis GN=ccdc90a PE=2 SV=1 Length =

  5. Music Instruction and the Reading Achievement of Middle School Students

    Science.gov (United States)

    Huber, Juanita J.

    2010-01-01

    Comparative analysis examined responses on a descriptive questionnaire from 267 students in grades 6, 7, and 8. The study compared duration of and participation in music instruction, types of musical instruments learned, and experience in musical ensembles to scores from the state English language arts assessment. Analysis of results included…

  6. Raphidascaris (Ichthyascaris) arii sp n. (Nematoda: Anisakidae), a new ascaridoid nematode from marine catfishes in the Gulf of Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.

    2011-01-01

    Roč. 48, č. 4 (2011), 262-267. ISSN 0440-6605 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Raphidascaris * Ichthyascaris * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  7. Dicty_cDB: VSJ377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available brucei sheared genomic DNA clone 174b06, forward sequence. 38 0.003 2 AL484750 |AL484750.1 T. brucei sheare...d genomic DNA clone 267h11, forward sequence. 38 0.003 2 AL480325 |AL480325.1 T. brucei sheared genomic DNA

  8. Student Physical Education Teachers' Well-Being: Contribution of Basic Psychological Needs

    Science.gov (United States)

    Ciyin, Gülten; Erturan-Ilker, Gökçe

    2014-01-01

    This study adopted Self-Determination Theory tenets and aimed to explore whether student physical education (PE) teachers' satisfaction of the three basic psychological needs independently predicts well-being. 267 Turkish student PE teachers were recruited for the study. Two stepwise multiple regression analysis was performed in which each outcome…

  9. Infrared spectra of weak hydrogen bonds and indirect damping. On the deep connection between the quantum model and the semi-classical one of Robertson and Yarwood

    International Nuclear Information System (INIS)

    The classical approximation of the quantum model dealing with the IR spectra of weak hydrogen bond involving indirect damping [B. Boulil, O. Henri-Rousseau, P. Blaise, Chem. Phys. 126 (1988) 263] is obtained. It transforms, via a crude approximation concerning the interpretation of stochastic averages, into the classical Robertson-Yarwood (RY) model [G. Robertson, J. Yarwood, Chem. Phys. 32 (1978) 267

  10. Experimental research on the intensity distribution of KrF laser beam with large diameter and high energy

    International Nuclear Information System (INIS)

    The array calorimeter detector was used to measure the uniformity of intensity distribution and output energy for large diameter (φ267 mm) and high energy (400 J) KrF laser beam. With a decrease of the diode voltage, the distribution becomes worse to have a saddle pattern. The optimum operation voltage of diode are of 580 to 600 kV

  11. 78 FR 63017 - Exhaust Emissions Standards for New Aircraft Gas Turbine Engines and Identification Plate for...

    Science.gov (United States)

    2013-10-23

    ... engines with rated thrusts greater than 26.7 kilonewtons (kN) (76 FR 45012). The EPA also proposed...). The final rule adopting these proposals was published on June 18, 2012 (77 FR 36342), and was... (77 FR 76842) adopting the EPA's new emissions standards in part 34. Although the EPA's NPRM...

  12. 77 FR 76842 - Exhaust Emissions Standards for New Aircraft Gas Turbine Engines and Identification Plate for...

    Science.gov (United States)

    2012-12-31

    ... turbojet engines with rated thrusts greater than 26.7 kilonewtons (kN) (76 FR 45012, July 27, 2011). The final rule adopting these proposals was published in the Federal Register on June 18, 2012 (77 FR 36342... the Department of Transportation (DOT) (44 FR 1134; February 26, 1979) provide that, to the...

  13. 75 FR 35700 - Revisions to Forms, Statements, and Reporting Requirements for Natural Gas Pipelines

    Science.gov (United States)

    2010-06-23

    ... for Natural Gas Pipelines June 17, 2010. AGENCY: Federal Energy Regulatory Commission, DOE. ACTION... Natural Gas Pipelines, Order No. 710, FERC Stats. & Regs. ] 31,267 (2008), order on reh' g and... revised its financial forms, statements, and reports for natural gas companies, contained in FERC Form...

  14. Attachment and Early Maltreatment.

    Science.gov (United States)

    Egeland, Byron; Sroufe, L. Alan

    1981-01-01

    Attachment outcomes of 31 maltreatment cases (involving extreme neglect or abuse), selected from a total poverty sample of 267 high-risk mothers and their children, were compared to those of a subsample of 33 cases with a history of excellent care. Attachment was assessed when infants were 12 and 18 months old. (Author/MP)

  15. Photosynthetic assimilation of sun versus shade Norway spruce [Picea abies (L.) Karst] needles under the long/term impact of elevated CO2 concentration

    Czech Academy of Sciences Publication Activity Database

    Marek, Michal V.

    2002-01-01

    Roč. 40, č. 2 (2002), s. 259-267. ISSN 0300-3604 R&D Projects: GA MŠk(CZ) OC E21.001 Keywords : carboxylation efficiency and rate * stand density * dark respiration * dense/sparse parts * electron transport rate * quantum yield of assimilation * sun/shade Subject RIV: EH - Ecology, Behaviour Impact factor: 0.773, year: 2002

  16. Two new species of Philometra (Nematoda: Philometridae) from needlefishes (Belonidae) in Iraq, with a key to Philometra spp. parasitic in the host’s subcutaneous tissue, fins and musculature

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2005-01-01

    Roč. 52, č. 3 (2005), s. 267-273. ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005

  17. Zámecké dispozice Antonia Porty

    Czech Academy of Sciences Publication Activity Database

    Krummholz, Martin

    Praha : Artefactum, 2012 - (Mádl, M.), s. 267-273 ISBN 978-80-86890-41-8 R&D Projects: GA ČR GA408/09/0949 Institutional support: RVO:68378033 Keywords : Antonio Porta * chateau * palace * layout * ground plan * Vysoký Chlumec * Sedlčany * Roudnice nad Labem Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Krize – impuls k rozvoji obchodu s Blízkým a Středním východem

    Czech Academy of Sciences Publication Activity Database

    Jůnová Macková, Adéla

    Ostrava: Ostravská univerzita, 2015 - (Kubů, E.; Soukup, J.; Šouša, J.), s. 267-279 ISBN 978-80-7464-774-1 Institutional support: RVO:67985921 Keywords : Czechoslovak export, 1918–1938 * Near East * history Subject RIV: AB - History

  19. Optimisation of Lab-Scale Continuous Alcohol-Free Beer Production

    Czech Academy of Sciences Publication Activity Database

    Lehnert, R.; Novák, Pavel; Macieira, F.; Kuřec, M.; Teixeira, J.A.; Brányik, T.

    2009-01-01

    Roč. 27, č. 4 (2009), s. 267-275. ISSN 1212-1800 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol-free beer * continuous reactor * immobilised yeast Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.602, year: 2009

  20. Targeted Metabolomics for Homocysteine-Related Metabolites in Primary Hepatocytes

    Czech Academy of Sciences Publication Activity Database

    Selicharová, Irena; Kořínek, M.

    New York: Humana Press, 2015 - (Vinken, M.; Rogiers, V.), s. 267-277. (Methods in Molecular Biology . 1250). ISBN 978-1-4939-2073-0 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : cell culture * homocysteine * intracellular metabolites Subject RIV: CE - Biochemistry

  1. The Role of Psychosocial Variables in Understanding the Achievement and Retention of Transfer Students at an Ethnically Diverse Urban University

    Science.gov (United States)

    Dennis, Jessica M.; Calvillo, Evelyn; Gonzalez, Alfredo

    2008-01-01

    A study of 1,130 transfer students (757 female, 373 male; 479 Latino/Hispanic, 267 Asian or Asian American, 125 European American, 73 African American, 58 Middle Eastern, and 66 "other") at a 4-year public university indicates that psychosocial variables are important in relation to the success of students who are diverse by many factors. Cluster…

  2. Chaos Synthesis by Evolutionary Algorithms

    Czech Academy of Sciences Publication Activity Database

    Zelinka, I.; Chen, G.; Čelikovský, Sergej

    Berlin : Springer-Verlag, 2010 - (Zelinka, I.; Čelikovský, S.; Richter, H.; Chen, G.), s. 345-382 ISBN 978-3-642-10706-1. - (Studies in Computational Intelligence. 267) Institutional research plan: CEZ:AV0Z10750506 Keywords : chaos synthesis * evolutionary algorithms * self organizingmigrating * evolutionary computing Subject RIV: BC - Control Systems Theory

  3. Ploštice (Heteroptera) Chráněné krajinné oblasti Kokořínsko

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Kment, P.

    2006-01-01

    Roč. 27, - (2006), s. 267-294. ISSN 0231-5807 Institutional research pla n: CEZ:AV0Z60930519 Keywords : Heteroptera * faunistics * nature conservation Subject RIV: EG - Zoology http://www.prahaastrednicechy.ochranaprirody.cz/res/data/131/017605.pdf

  4. Development of a parallel computation technique for RELAP5

    International Nuclear Information System (INIS)

    Process Level Parallel Computation method has been developed based on cell grouping and matrix decomposition technique in a multiprocessing environment under UNIX operating system. Assessments has been made for various ideal cases and plant calculations. The PLPC method showed speed-up ratio of 3.41 for ideal case and 2.67 for plant calculation. (Author)

  5. Interaction of extrinsic chemical factors affecting photodegradation of dissolved organic matter in aquatic ecosystems

    Czech Academy of Sciences Publication Activity Database

    Porcal, Petr; Dillon, P. J.; Molot, L. A.

    2014-01-01

    Roč. 13, č. 5 (2014), s. 799-812. ISSN 1474-905X R&D Projects: GA ČR(CZ) GAP503/12/0781 Institutional support: RVO:60077344 Keywords : photodegradation * dissolved organic matter * calcium * nitrate * iron * pH Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.267, year: 2014

  6. Epilepsy

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2009243 Multicenter randomized,double-blind,placebo-controlled trial of zonisamide as add-on therapy in patients with refractor partial seizures.YU Peimin(虞培敏),et al.Dept Neurol,Huashan Hosp,Fudan Univ,Shanghai 200040.Chin J Neurol,2009;4294):263-267.

  7. Gene copy number variation across the hybrid zone of the house mouse (Mus musculus)

    Czech Academy of Sciences Publication Activity Database

    Yanchukov, Alexey; Baird, Stuart J. E.; Hiadlovská, Zuzana; Pezer, Z.; Macholán, M.; Piálek, Jaroslav

    Brno: Ústav biologie obratlovců AV ČR, 2015 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 266-267 ISBN 978-80-87189-18-4. [Zoologické dny. 12.02.2015-13.02.2015, Brno] Institutional support: RVO:68081766 Keywords : house mouse * hybrid zone Subject RIV: EG - Zoology

  8. Comparative Study of the Spherical Downward Continuation

    Czech Academy of Sciences Publication Activity Database

    Sebera, Josef; Pitoňák, M.; Hamáčková, E.; Novák, P.

    2015-01-01

    Roč. 36, č. 2 (2015), s. 253-267. ISSN 0169-3298 Grant ostatní: GA MŠk(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985815 Keywords : limited airborne gravity * potential-field data * horizontal plane Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.447, year: 2014

  9. Use of osteoplastic material to guide bone tissue regeneration deffect.

    Science.gov (United States)

    Machavariani, A; Mazmishvili, K; Grdzelidze, T; Menabde, G; Amiranashvili, I

    2011-12-01

    The goal of research was study of restoration processes in jaw-teeth bone defects by application of osteoplastic materials in the experiment. The experiment was performed over 32 white (6-12 month old) rats; the animals were divided into 2 groups; 16 animals were enrolled in the first group; the section was performed in the edge of lower jaw; the lower jaw body was revealed. Under the effect of the dental drilling machine and the # 1 cooling mean by the fissure bohrium (distilled water) the defect of the dimension of 2x2 mm was created; the defect was washed by 0/9% saline to remove the bone sawdust; the wound was sutured tightly, in layers. The second group of the experiment was staffed with 16 animals (main group); the similar bone defect of the size 2 x 2mm was created on the rat's jaw's body. After washing of modeled defect we inserted osteopathic materials PORESORB-TCP crystals with the size of 0,6-1.0 mm the wound was sutured tightly, in layers. After the 3-rd, 15-th, 30-th and 90-th days from the date of operation there was performed X-ray and morphological examination over the animals in the control as well as the main group. The analysis of the examination performed over the experimental materials showed that in the control group in samples taken at 90th day the defects were not completely restored. In the test group in samples taken at 90th day reparative regeneration is confirmed. This is stimulated by the factor that within the main group's animals the defect regeneration process is supported with the osteoplastic material PORESORB-TCP. PMID:22306506

  10. Chemical characterization of element 112.

    Science.gov (United States)

    Eichler, R; Aksenov, N V; Belozerov, A V; Bozhikov, G A; Chepigin, V I; Dmitriev, S N; Dressler, R; Gäggeler, H W; Gorshkov, V A; Haenssler, F; Itkis, M G; Laube, A; Lebedev, V Ya; Malyshev, O N; Oganessian, Yu Ts; Petrushkin, O V; Piguet, D; Rasmussen, P; Shishkin, S V; Shutov, A V; Svirikhin, A I; Tereshatov, E E; Vostokin, G K; Wegrzecki, M; Yeremin, A V

    2007-05-01

    The heaviest elements to have been chemically characterized are seaborgium (element 106), bohrium (element 107) and hassium (element 108). All three behave according to their respective positions in groups 6, 7 and 8 of the periodic table, which arranges elements according to their outermost electrons and hence their chemical properties. However, the chemical characterization results are not trivial: relativistic effects on the electronic structure of the heaviest elements can strongly influence chemical properties. The next heavy element targeted for chemical characterization is element 112; its closed-shell electronic structure with a filled outer s orbital suggests that it may be particularly susceptible to strong deviations from the chemical property trends expected within group 12. Indeed, first experiments concluded that element 112 does not behave like its lighter homologue mercury. However, the production and identification methods used cast doubt on the validity of this result. Here we report a more reliable chemical characterization of element 112, involving the production of two atoms of (283)112 through the alpha decay of the short-lived (287)114 (which itself forms in the nuclear fusion reaction of 48Ca with 242Pu) and the adsorption of the two atoms on a gold surface. By directly comparing the adsorption characteristics of (283)112 to that of mercury and the noble gas radon, we find that element 112 is very volatile and, unlike radon, reveals a metallic interaction with the gold surface. These adsorption characteristics establish element 112 as a typical element of group 12, and its successful production unambiguously establishes the approach to the island of stability of superheavy elements through 48Ca-induced nuclear fusion reactions with actinides. PMID:17476264

  11. Synthesis of the heaviest nuclei in cold fusion reactions

    Science.gov (United States)

    Münzenberg, G.; Morita, K.

    2015-12-01

    Cold fusion of heavy ions paved the way to superheavy elements. It was proposed by Yu.Ts. Oganessian more than forty years ago in 1974 [1,2]. First experiments were carried out at JINR Dubna, starting with the reaction 40Ar + 208Pb → 248Fm* where several hundreds to thousand atoms were produced on one day. The large production rate indicating an enhancement of the fusion cross section, especially for the evaporation of two or three neutrons, proved the concept of cold-fusion with the use of the doubly magic nucleus 208Pb as a target. The Dubna experiments were extended to the transactinide region beyond rutherfordium. The breakthrough came with the separation in-flight. Two different approaches were used: kinematic separation with the velocity filter SHIP [3] at GSI Darmstadt, and with the gasfilled separator GARIS [4,5] at RIKEN. With SHIP the concept of cold fusion of massive nuclear systems was convincingly confirmed by the observation of the one-neutron evaporation channel in the production of 247Rf in an irradiation of 208Pb with 50Ti [6] in 1981 which opened the way to the transactinide region. At SHIP the elements bohrium (107) to copernicium (112) were discovered [7]. A new closed shell region around hassium was found. The RIKEN experiments started in 2002. They confirmed the GSI results and in addition improved the data on structure and production of elements hassium to copernicium significantly. The heaviest element ever created in a cold fusion reaction, Z = 113, was observed at GARIS [8,9].

  12. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  13. MicroSISAK for the chemistry of the heaviest elements; MikroSISAK fuer die Chemie der schwersten Elemente

    Energy Technology Data Exchange (ETDEWEB)

    Hild, Daniel

    2012-05-18

    This thesis describes experiments with an apparatus called MicroSISAK which is able to perform liquid-liquid-extraction on a microliter-scale. Two immiscible liquids are mixed in a microstructured mixer unit and separated again via a Teflon membrane. In the first experiments, different extraction systems were explored for elements of the groups 4 and 7 of the periodic table. Their results were compared with those from batch experiments. The initial achieved extraction yields were insufficient for the envisaged experiments, for which reason different modifications were arranged to obtain improvements. With the aid of a heating element, which was connected to the MicroSISAK apparatus, one was able to rise the temperature for the extraction inside. This led to the expected increasing of the extraction yield. Furthermore the MikroSISAK apparatus was modified by the Institut fuer Mikrotechnik Mainz, which had developed and constructed this apparatus. The contact time of the two phases between the mixer and the separation unit was extended. This also led to an increased yield. Now the performance appeared to be sufficient to connect the apparatus to the TRIGAreactor Mainz to perform online-experiments. Fission products (technetium) produced in a nuclear reaction were guided to the MicroSISAK apparatus to separate them and to detect their decay in a γ-ray detector. Apart from the successful separations, the experiments also proved the functionality of a new degasser system and that an adequate detection system can be coupled to MicroSISAK. With this, the prerequisites for the vision of an application of MicroSISAK are realised: The investigation of the chemical properties of short-lived superheavy elements (SHE) at a heavy-ion accelerator. It is obvious to plan such an experiment for the heavy homolog of technetium, element 107, bohrium.

  14. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  15. New elements - approaching Z = 114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1998-06-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z = 107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavierelements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  16. Chemical characterization of element 112

    Science.gov (United States)

    Eichler, R.; Aksenov, N. V.; Belozerov, A. V.; Bozhikov, G. A.; Chepigin, V. I.; Dmitriev, S. N.; Dressler, R.; Gäggeler, H. W.; Gorshkov, V. A.; Haenssler, F.; Itkis, M. G.; Laube, A.; Lebedev, V. Ya.; Malyshev, O. N.; Oganessian, Yu. Ts.; Petrushkin, O. V.; Piguet, D.; Rasmussen, P.; Shishkin, S. V.; Shutov, A. V.; Svirikhin, A. I.; Tereshatov, E. E.; Vostokin, G. K.; Wegrzecki, M.; Yeremin, A. V.

    2007-05-01

    The heaviest elements to have been chemically characterized are seaborgium (element 106), bohrium (element 107) and hassium (element 108). All three behave according to their respective positions in groups 6, 7 and 8 of the periodic table, which arranges elements according to their outermost electrons and hence their chemical properties. However, the chemical characterization results are not trivial: relativistic effects on the electronic structure of the heaviest elements can strongly influence chemical properties. The next heavy element targeted for chemical characterization is element 112; its closed-shell electronic structure with a filled outer s orbital suggests that it may be particularly susceptible to strong deviations from the chemical property trends expected within group 12. Indeed, first experiments concluded that element 112 does not behave like its lighter homologue mercury. However, the production and identification methods used cast doubt on the validity of this result. Here we report a more reliable chemical characterization of element 112, involving the production of two atoms of 283112 through the alpha decay of the short-lived 287114 (which itself forms in the nuclear fusion reaction of 48Ca with 242Pu) and the adsorption of the two atoms on a gold surface. By directly comparing the adsorption characteristics of 283112 to that of mercury and the noble gas radon, we find that element 112 is very volatile and, unlike radon, reveals a metallic interaction with the gold surface. These adsorption characteristics establish element 112 as a typical element of group 12, and its successful production unambiguously establishes the approach to the island of stability of superheavy elements through 48Ca-induced nuclear fusion reactions with actinides.

  17. MicroSISAK for the chemistry of the heaviest elements

    International Nuclear Information System (INIS)

    This thesis describes experiments with an apparatus called MicroSISAK which is able to perform liquid-liquid-extraction on a microliter-scale. Two immiscible liquids are mixed in a microstructured mixer unit and separated again via a Teflon membrane. In the first experiments, different extraction systems were explored for elements of the groups 4 and 7 of the periodic table. Their results were compared with those from batch experiments. The initial achieved extraction yields were insufficient for the envisaged experiments, for which reason different modifications were arranged to obtain improvements. With the aid of a heating element, which was connected to the MicroSISAK apparatus, one was able to rise the temperature for the extraction inside. This led to the expected increasing of the extraction yield. Furthermore the MikroSISAK apparatus was modified by the Institut fuer Mikrotechnik Mainz, which had developed and constructed this apparatus. The contact time of the two phases between the mixer and the separation unit was extended. This also led to an increased yield. Now the performance appeared to be sufficient to connect the apparatus to the TRIGAreactor Mainz to perform online-experiments. Fission products (technetium) produced in a nuclear reaction were guided to the MicroSISAK apparatus to separate them and to detect their decay in a γ-ray detector. Apart from the successful separations, the experiments also proved the functionality of a new degasser system and that an adequate detection system can be coupled to MicroSISAK. With this, the prerequisites for the vision of an application of MicroSISAK are realised: The investigation of the chemical properties of short-lived superheavy elements (SHE) at a heavy-ion accelerator. It is obvious to plan such an experiment for the heavy homolog of technetium, element 107, bohrium.

  18. New elements - approaching Z = 114

    International Nuclear Information System (INIS)

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z = 107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  19. New elements - approaching ?

    Science.gov (United States)

    Hofmann, S.

    1998-06-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements 0034-4885/61/6/002/img2 were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of 0034-4885/61/6/002/img3 correlations. Alpha decay, not fission, is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small 0034-4885/61/6/002/img4-, 0034-4885/61/6/002/img5- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical superheavy elements (SHEs) could be achieved by fusion reactions using 0034-4885/61/6/002/img6 targets. Systematic studies of the reaction cross sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHEs using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  20. An experimental paradigm opening the world of superheavy elements

    Science.gov (United States)

    Armbruster, P.; Münzenberg, Gottfried

    2012-07-01

    The history of the discovery of the six elements Z = 107 ∓ 112, bohrium, hassium, meitnerium, darmstadtium, roentgenium, and copernicium goes back to the early 1960s. An experimental method to separate and identify rare nuclear reaction products, the recoil separation, was developed and optimised for beams of fission products at European research reactors. Chemical elements beyond the then first transactinides ( Z = 104), which owe their stability to the internal structure of atomic nuclei, were predicted theoretically. A big brother of the shell-stabilised nucleus 208Pb, a spherical magic nucleus at Z = 114∓126 and N = 184, might reach lifetimes long enough to be detected. In the seventies, hunting superheavy elements (SHE) was on the agenda of nuclear chemistry. Could the Periodic Table of Elements be extended to Z = 120, and is the order of electrons in the atom still following the laws established for lighter elements? In Germany, the heavy ion accelerator (UNILAC) was built by Christoph Schmelzer and his team at GSI, Darmstadt. SHE and UNILAC met the recoil separators in 1968, and SHIP (Separator for Heavy Ion reaction Products) was ready together with the first UNILAC-beams in 1976. Recoil separation is orders of magnitude more sensitive, selective, and faster than earlier methods used to synthesise elements up to seaborgium, Z = 106. The experimental paradigm we introduced opened the world of SHEs. At SHIP we discovered and investigated the elements Z = 107∓112 in the years 1980-2000. Our laboratory was the world champion during this time. Today our experimental method is used worldwide in the search for SHEs, but the leadership went to the Russian laboratory JINR in Dubna, which extended the Periodic Table by 6 more elements to Z = 118, the candidate for the next rare gas.

  1. Steam Oxidation at High Pressure

    Energy Technology Data Exchange (ETDEWEB)

    Holcomb, Gordon R. [NETL; Carney, Casey [URS

    2013-07-19

    A first high pressure test was completed: 293 hr at 267 bar and 670{degrees}C; A parallel 1 bar test was done for comparison; Mass gains were higher for all alloys at 267 bar than at 1 bar; Longer term exposures, over a range of temperatures and pressures, are planned to provide information as to the commercial implications of pressure effects; The planned tests are at a higher combination of temperatures and pressures than in the existing literature. A comparison was made with longer-term literature data: The short term exposures are largely consistent with the longer-term corrosion literature; Ferritic steels--no consistent pressure effect; Austenitic steels--fine grain alloys less able to maintain protective chromia scale as pressure increases; Ni-base alloys--more mass gains above 105 bar than below. Not based on many data points.

  2. Task 1 Steam Oxidation (NETL-US)

    Energy Technology Data Exchange (ETDEWEB)

    Holcomb, Gordon R. [NETL; Carney, Casey [URS

    2013-08-28

    A first high pressure test was completed: 293 hr at 267 bar and 670{degrees}C; A parallel 1 bar test was done for comparison; Mass gains were higher for all alloys at 267 bar than at 1 bar; Longer term exposures, over a range of temperatures and pressures, are planned to provide information as to the commercial implications of pressure effects; The planned tests are at a higher combination of temperatures and pressures than in the existing literature. A comparison was made with longer-term literature data: The short term exposures are largely consistent with the longer-term corrosion literature; Ferritic steels--no consistent pressure effect; Austenitic steels--fine grain alloys less able to maintain protective chromia scale as pressure increases; Ni-base alloys--more mass gains above 105 bar than below. Not based on many data points.

  3. Utilization of Gene Mapping and Candidate Gene Mutation Screening for Diagnosing Clinically Equivocal Conditions:A Norrie Disease Case Study

    Institute of Scientific and Technical Information of China (English)

    Vasiliki Chini; Danai Stambouli; Florina Mihaela Nedelea; George Alexandru Filipescu; Diana Mina; Marios Kambouris; Hatem El-Shanti

    2014-01-01

    Prenatal diagnosis was requested for an undiagnosed eye disease showing X-linked inheritance in a family. No medical records existed for the affected family members..Mapping of the X chromosome and candidate gene mutation screening i-dentified a c.C267A[p.F89L] mutation in NPD previously de-scribed as possibly causing Norrie disease..The detection of the c.C267A[p.F89L] variant in another unrelated family con-firms the pathogenic nature of the mutation for the Norrie dis-ease phenotype. Gene mapping, haplotype analysis, and can-didate gene screening have been previously utilized in research applications but were applied here in a diagnostic setting due to the scarcity of available clinical information..The clinical diagnosis and mutation identification were critical for provid-ing proper genetic counseling and prenatal diagnosis for this family.

  4. Effect of in-situ TiC particulate on the wear resistance of spray-deposited 7075 Al matrix composite

    International Nuclear Information System (INIS)

    TiC reinforced 7075 Al matrix composites have been fabricated by a melt in-situ reaction spray deposition. The microstructures of spray-deposited alloys were studied using scanning electron microscopy (SEM) and X-ray diffraction (XRD). The dry sliding wear behavior of the alloys was investigated using a pin-on-disc machine under four loads, namely 8.9, 17.8, 26.7 and 35.6 N. It has been found that the wear behavior of the alloys was dependent on the TiC content in the microstructure and the applied load. At a lower load (8.9 N), with increasing TiC content, the wear rate of the alloy was decreased. At a higher loads (26.7, 35.6 N), a spray-deposited 7075 Al alloy exhibited superior wear resistance to the 7075/TiC composites

  5. Storage and Transportation of a Variety of TRIGA Spent Fuels

    International Nuclear Information System (INIS)

    The foreign Research Reactor Program objective is to support the U.S. nuclear weapons non- proliferation strategy by working to recover enriched Uranium exported from the U.S. as part of the 1950's 'Atoms for Peace' program. The 1996 DOE FRR Spent Fuel EIS and ROD identified approximately 1 MTHM of TRIGA SNF available for shipment to the INL (through 2019), and 24 reactors in 19 countries eligible to participate. So far, 12 shipments have been completed since 1996, 1,267 spent fuel assemblies - including 267 pins - from 8 countries have been shipped to U.S. The last shipment arrived at INL summer of 2008. All assemblies are safely stored in dry storage at the INL's Irradiated Fuel Storage Facility

  6. AcEST: DK944175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 51|FADA_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli... 30 9.0 sp|Q9ERQ6|CSPG5_RAT Chondroit...L PRA Sbjct: 213 ETTVEALATLRPAFDPVNGMVTAGTSSALSDGAAAMLVMSESRAHELGLKPRA 265 >sp|Q9ERQ6|CSPG5_RAT Chondroit...e... 34 5.4 tr|B3NTX0|B3NTX0_DROER GG18628 OS=Drosophila erecta GN=GG18628 P... 34 5.4 tr|B4Q0W1|B4Q0W1_DROYA GE16281 OS=Dro...GTAGGGACGATTGCATC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit..._id Q14586 Definition sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens Align length 78 Score (bit

  7. Installation and test results of a high-power, CW klystrode amplifier at Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    The Chalk River Laboratory (CRL) 1.25 MeV, 267 MHz CW radio frequency quadrupole (RFQ) project has been moved to Los Alamos AOT Division as a collaborative effort between Los Alamos and Chalk River Laboratories. The RF part of this project includes two 267 MHz, 0.25 MW, CW klystrode transmitters. The klystrode is a relatively new type of RF source that combines the input structure from a conventional gridded tube and the output structure of a klystron. It is widely used within the UHF television band at reduced power (60 kW at peak of sync). However, this is the first application of a high power klystrode for a particle accelerator. This paper will describe the experimental configuration at Los Alamos, provide block diagrams of the klystrode transmitter, discuss the attributes of the klystrode which make it a desirable candidate for high efficiency CW accelerators, and present relevant test results

  8. β-ray irradiation effects in RbBr: Eu crystals

    International Nuclear Information System (INIS)

    Defects induced by β-ray irradiation in RbBr: Eu2+ crystals doped with a high concentration of Eu2+ ions are studied by means of optical absorption (OA), thermoluminescence (TL), and optically stimulated TL (OSTL). The fading, dose, and optical bleaching effects on the TL glow curves of room temperature irradiated samples has been analyzed. OA indicates that irradiation of samples at room temperature induce the formation of F but not Fz centers. The TL glow curves show peaks at 267, 303, and 403 K. The 267 K glow peak disappear in less than 1 s under blue light or infrared radiation photo bleaching. A high sensitivity to the ionizing radiation has been observed. These results confirm that this material is an efficient phosphor. (Author)

  9. AcEST: DK952006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0012_O22 203 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_O22. 5' end seq ... 54%), Positives = 24/31 (77%) Frame = +1 Query: 37 MIS RITSYNPMTKSFLLS*RFALTLNKLLSR 129 MIS ... +T+Y M+KSF+L F ... A+TL +LLS+ Sbjct: 267 MIS YVTTYLGMSKSFILDCLFAVTLIQLLSQ 297 >tr|Q62DQ2|Q62DQ2_ ... 54%), Positives = 24/31 (77%) Frame = +1 Query: 37 MIS RITSYNPMTKSFLLS*RFALTLNKLLSR 129 MIS ... +T+Y M+KSF+L F ... A+TL +LLS+ Sbjct: 267 MIS YVTTYLGMSKSFILDCLFAVTLIQLLSQ 297 >tr|Q3JJ70|Q3JJ70_ ...

  10. Detection of polychlorinated biphenyls in transformer oils in Vietnam by multiphoton ionization mass spectrometry using a far-ultraviolet femtosecond laser as an ionization source.

    Science.gov (United States)

    Vu, Thi Thuy Duong; Vu, Duong; Nghiem, Thi Ha Lien; Imasaka, Tomoko; Tang, Yuanyuan; Shibuta, Shinpei; Hamachi, Akifumi; Do, Quang Hoa; Imasaka, Totaro

    2016-03-01

    Polychlorinated biphenyls (PCBs) in transformer and food oils were measured using gas chromatography combined with multiphoton ionization mass spectroscopy. An ultrashort laser pulse emitting in the far-ultraviolet region was utilized for efficient ionization of the analytes. Numerous signal peaks were clearly observed for a standard sample mixture of PCBs when the third and fourth harmonic emissions (267 and 200nm) of a femtosecond Ti:sapphire laser (800nm) were employed. The signal intensities were found to be greater when measured at 200nm compared with those measured at 267nm, providing lower detection limits especially for highly chlorinated PCBs at shorter wavelengths. After simple pretreatment using disposable columns, PCB congeners were measured and found to be present in the transformer oils used in Vietnam. PMID:26717841

  11. Mechanical Characteristics and Microstructure on Friction Stir Welded Joints with 6061-T6 Aluminium Alloy

    International Nuclear Information System (INIS)

    This paper shows mechanical properties and behaviors of macro- and micro-structures on friction stir welded specimen with 6061-T6 aluminum alloy plate. It apparently results in defect-free weld zone jointed at welding conditions like the traverse speed of 267mm/min, tool rotation speed of 2500rpm, pin inserted depth of 4.5mm and tilting angle of 2 .deg. with tool dimensions such as tool pin diameter of 5mm, shoulder diameter of 15mm and pin length of 4.5mm. The tensile stress σT=228MPa and the yield point σY=141MPa are obtained at the condition of traverse speed of 267mm/min and tool rotation speed of 2500rpm. With the constant rotation speed, the higher traverse speed become, the higher tensile stress and yielding point become. Vickers hardness for welding zone profile were also presented

  12. Gclust Server: 86949 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 86949 CME_CME050C Cluster Sequences Related Sequences(267) 431 similar to nuclear L...IM interactor-interacting factor 1 1.00e-22 14.29 0.0 0.0 0.0 0.0 0.0 Show 86949 Cluster ID 86949 Sequence I...D CME_CME050C Link to cluster sequences Cluster Sequences Link to related sequences Related Sequences(267) S...teracting factor Number of Sequences 1 Homologs 1 Clustering threshold 1.00e-22 Plants and algae (7species) ...es not appearing in this cluster ATH: 0 OSA: 0 PoTR: 0 PPT: 0 CRE: 0 OTAU: 0 GTH: 0 PFA: 0 PTR: 0 TPS: 0 Ter

  13. Estimation of uranium in some edible and commercial plants

    International Nuclear Information System (INIS)

    The trace contents of uranium have been estimated in some edible and commercial plants by PTA (particle track analysis) method. The groups of food plants studied are cereals, pulses, underground vegetables, leafy vegetables, and fruit vegetables. The commercial plants and ingredients taken are betel leaves, tobacco leaves, areca nuts, and lime. Among the different samples studied, the average uranium content, in general, is found to vary from 0.25 to 2.67 ppm. (author). 10 refs., 2 tabs., 1 fig

  14. Randomized controlled trials – a matter of design

    OpenAIRE

    Spieth PM; Kubasch AS; Penzlin AI; Illigens BM; Barlinn K; Siepmann T

    2016-01-01

    Peter Markus Spieth,1,2 Anne Sophie Kubasch,3 Ana Isabel Penzlin,4 Ben Min-Woo Illigens,2,5 Kristian Barlinn,6 Timo Siepmann2,6,7 1Department of Anesthesiology and Critical Care Medicine, University Hospital Carl Gustav Carus, Technische Universität Dresden, 2Center for Clinical Research and Management Education, Division of Health Care Sciences, Dresden International University, 3Pediatric Rheumatology and Immunology, Children’s Hospital, University Hospital Carl Gustav Carus, Te...

  15. Clinical Experience of Auditory Brainstem Response Testing on Pediatric Patients in the Operating Room

    OpenAIRE

    Wheaton Hinchion; Briana Dornan; Guangwei Zhou

    2012-01-01

    Objectives. To review our experience of conducting auditory brainstem response (ABR) test on children in the operating room and discuss the benefits versus limitations of this practice. Methods. Retrospective review study conducted in a pediatric tertiary care facility. A total of 267 patients identified with usable data, including ABR results, medical and surgical notes, and follow-up evaluation. Results. Hearing status successfully determined in all patients based on the ABR results form th...

  16. The Relationship between Organizational Citizenship Behavior and Counterproductive Work Behavior

    OpenAIRE

    Hafidz S. W. M.; Hoesni S. M.; Fatimah O.

    2012-01-01

    Job performance is the most researched concept studied in industrial and organizational psychology, with the emphasis being on organizational citizenship behavior (OCB) and counterproductive work behavior (CWB) as two dimensions of it. The relationship between these two dimensions of job performance are unclear, hence the objective of the current study was to examine the relationship between organizational citizenship behavior and counterproductive work behavior. A total of 267 students study...

  17. Individual Differences as Antecedents of Counterproductive Work Behaviour

    OpenAIRE

    Sarah Waheeda Muhammad Hafidz

    2012-01-01

    Counterproductive work behaviour (CWB) has recently gained more interest in industrial and organizational psychology, as the impact of engagement of CWB is big; influencing not just the organization but also other stakeholders. The objective of this study was to look at individual factors as antecedents of CWB, focusing on personality, locus of control, and values. Data were collected from 267 students studying psychology by means of a questionnaire measuring CWB, the Big-Five factor personal...

  18. Aplikace difúzního denuderu při vzorkování uhlíkatých aerosolů a analýze OC/EC

    Czech Academy of Sciences Publication Activity Database

    Mikuška, Pavel; Večeřa, Zbyněk; Bartošíková, Anna; Maenhaut, W.; Chi, X.

    Brno : Masarykova univerzita, 2005 - (Holoubková, I.), s. 267-269 ISBN 80-210-3688-5. [Ovzduší 2005. Brno (CZ), 09.05.2005-11.05.2005] R&D Projects: GA ČR GA526/03/1182; GA AV ČR IAA4031105 Institutional research plan: CEZ:AV0Z40310501 Keywords : diffusion denuder * carbonaceous aerosols * sampling artefacts Subject RIV: CB - Analytical Chemistry, Separation

  19. The Mycoplasma hominis P120 membrane protein contains a 216 amino acid hypervariable domain that is recognized by the human humoral immune response

    DEFF Research Database (Denmark)

    Nyvold, Charlotte Guldborg; Birkelund, Svend; Christiansen, Gunna

    1997-01-01

    In the antigenically heterogeneous species Mycoplasma hominis a monoclonal antibody, mAb 26.7D, was previously found to recognize a 120 kDa polypeptide from M. hominis 7488. This antibody did not react with the type strain PG21. The homologous gene from M. hominis PG21 was cloned and sequenced an...... response. Such a variable domain may be important in evasion of the host's immune response, and thus aid survival of the micro-organism....

  20. ECONOMIC CONDITIONS OF THE FUNCTIONING OF THE FOOD INDUSTRY COMPANIES IN POLAND

    OpenAIRE

    Firlej, Krzysztof

    2015-01-01

    Please visit: http://krzysztoffirlej.pl/ The present article examines the extent to which the processes taking place in the economy, and closer to the business environment of the food industry in Poland affect their performance and competitiveness. The study was conducted on a representative sample of 267 enterprises of the food industry in the years 2012 and 2013. The research noted that: enterprises of the food industry operate in a highly competitive market, the Polish membe...