
Sample records for bohrium 267

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: ...

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU


    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 26 CFR 1.267(b)-1 - Relationships. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Relationships. 1.267(b)-1 Section 1.267(b)-1...) INCOME TAXES Items Not Deductible § 1.267(b)-1 Relationships. (a) In general. (1) The persons referred to... partnership separately. Therefore, if the other person and a partner are within any one of the relationships...

  4. 27 CFR 24.267 - Losses in transit. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses in transit. 24.267 Section 24.267 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Losses of Wine § 24.267 Losses in transit. Where the loss in transit of...

  5. 39 CFR 267.4 - Information security standards. (United States)


    ... management: (1) Information system development, (2) Information collection, (3) Information handling and... 39 Postal Service 1 2010-07-01 2010-07-01 false Information security standards. 267.4 Section 267... INFORMATION § 267.4 Information security standards. (a) The Postal Service will operate under a uniform set of...

  6. 39 CFR 267.5 - National Security Information. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false National Security Information. 267.5 Section 267.5... § 267.5 National Security Information. (a) Purpose and scope. The purpose of this section is to provide regulations implementing Executive Order 12356 National Security Information (hereinafter referred to as the...

  7. 40 CFR 267.150 - State assumption of responsibility. (United States)


    ... STANDARDIZED PERMIT Financial Requirements § 267.150 State assumption of responsibility. (a) If a State either assumes legal responsibility for an owner's or operator's compliance with the closure care or liability... 40 Protection of Environment 26 2010-07-01 2010-07-01 false State assumption of responsibility...

  8. 7 CFR 2.67 - Administrator, Economic Research Service. (United States)


    ... research on supply, demand, and trade in food and fiber products and the effects on the U.S. food and... Research, Education, and Economics § 2.67 Administrator, Economic Research Service. (a) Delegations... delegations of authority are made by the Under Secretary for Research, Education, and Economics to the...

  9. 49 CFR 40.267 - What problems always cause an alcohol test to be cancelled? (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problems always cause an alcohol test to be cancelled? 40.267 Section 40.267 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.267 What problems...

  10. 26 CFR 1.267(c)-1 - Constructive ownership of stock. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Constructive ownership of stock. 1.267(c)-1...) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.267(c)-1 Constructive ownership of stock. (a) In general. (1) The determination of stock ownership for purposes of section 267(b) shall be in...

  11. 40 CFR 267.201 - What must I do when I stop operating the tank system? (United States)


    ... OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.201 What must I do when I stop operating the tank... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do when I stop operating the tank system? 267.201 Section 267.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  12. 40 CFR 267.198 - What are the general operating requirements for my tank systems? (United States)


    ... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.198 What are the general operating... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the general operating requirements for my tank systems? 267.198 Section 267.198 Protection of Environment ENVIRONMENTAL PROTECTION...

  13. 40 CFR 267.32 - What equipment am I required to have? (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What equipment am I required to have? 267.32 Section 267.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID... STANDARDIZED PERMIT Preparedness and Prevention § 267.32 What equipment am I required to have? Your facility...

  14. 40 CFR 267.197 - What are the requirements for ancillary equipment? (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the requirements for ancillary equipment? 267.197 Section 267.197 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.197 What are the requirements for ancillary...

  15. Phenotype-gene: 267 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 267 delayed whole ...plant flowering stage for AT1G79000 Han Soon-Ki et al. 2007 Jan. Plant J. 49(1):103-14. delayed whole plant flowering stage AT1G79000

  16. 40 CFR 267.116 - What must I do with contaminated equipment, structure, and soils? (United States)


    ... equipment, structure, and soils? 267.116 Section 267.116 Protection of Environment ENVIRONMENTAL PROTECTION..., structure, and soils? You must properly dispose of or decontaminate all contaminated equipment, structures, and soils during the partial and final closure periods. By removing any hazardous wastes or hazardous...

  17. 40 CFR 267.1101 - What design and operating standards must my containment building meet? (United States)


    ... dust emissions under § 267.1102(d). (2) The unit is designed and operated in a fashion that assures... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What design and operating standards... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Containment buildings § 267.1101 What design and operating...

  18. Functional, genetic and chemical characterization of biosurfactants produced by plant growth-promoting Pseudomonas putida 267. (United States)

    Kruijt, Marco; Tran, Ha; Raaijmakers, Jos M


    Plant growth-promoting Pseudomonas putida strain 267, originally isolated from the rhizosphere of black pepper, produces biosurfactants that cause lysis of zoospores of the oomycete pathogen Phytophthora capsici. The biosurfactants were characterized, the biosynthesis gene(s) partially identified, and their role in control of Phytophthora damping-off of cucumber evaluated. The biosurfactants were shown to lyse zoospores of Phy. capsici and inhibit growth of the fungal pathogens Botrytis cinerea and Rhizoctonia solani. In vitro assays further showed that the biosurfactants of strain 267 are essential in swarming motility and biofilm formation. In spite of the zoosporicidal activity, the biosurfactants did not play a significant role in control of Phytophthora damping-off of cucumber, since both wild type strain 267 and its biosurfactant-deficient mutant were equally effective, and addition of the biosurfactants did not provide control. Genetic characterization revealed that surfactant biosynthesis in strain 267 is governed by homologues of PsoA and PsoB, two nonribosomal peptide synthetases involved in production of the cyclic lipopeptides (CLPs) putisolvin I and II. The structural relatedness of the biosurfactants of strain 267 to putisolvins I and II was supported by LC-MS and MS-MS analyses. The biosurfactants produced by Ps. putida 267 were identified as putisolvin-like CLPs; they are essential in swarming motility and biofilm formation, and have zoosporicidal and antifungal activities. Strain 267 provides excellent biocontrol activity against Phytophthora damping-off of cucumber, but the lipopeptide surfactants are not involved in disease suppression. Pseudomonas putida 267 suppresses Phy. capsici damping-off of cucumber and provides a potential supplementary strategy to control this economically important oomycete pathogen. The putisolvin-like biosurfactants exhibit zoosporicidal and antifungal activities, yet they do not contribute to biocontrol of Phy

  19. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    The periodic table of elements, the basic and most important component of research in chemistry and physics is growing continu- ously. It is interesting to note that until the. 16th century, only a handful of elements have been known to mankind (10, to be pre- cise) and during the 18th century, 10 more elements have been ...

  20. Functional, genetic and chemical characterization of biosurfactants produced by plant growth-promoting Pseudomonas putida 267

    NARCIS (Netherlands)

    Kruijt, M.; Tran, H.; Raaijmakers, J.M.


    Aims: Plant growth-promoting Pseudomonas putida strain 267, originally isolated from the rhizosphere of black pepper, produces biosurfactants that cause lysis of zoospores of the oomycete pathogen Phytophthora capsici. The biosurfactants were characterized, the biosynthesis gene(s) partially

  1. 40 CFR 267.101 - What must I do to address corrective action for solid waste management units? (United States)


    ... action for solid waste management units? 267.101 Section 267.101 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Releases from Solid Waste Management Units § 267.101 What must I do to address corrective action for solid waste management units? (a) You must institute...

  2. 26 CFR 1.267(a)-2T - Temporary regulations; questions and answers arising under the Tax Reform Act of 1984 (temporary). (United States)


    ... arising under the Tax Reform Act of 1984 (temporary). 1.267(a)-2T Section 1.267(a)-2T Internal Revenue... Not Deductible § 1.267(a)-2T Temporary regulations; questions and answers arising under the Tax Reform...) take into account changes made to section 267(b) by section 174 of the Tax Reform Act of 1984 (without...

  3. Complete genome sequence of Corynebacterium pseudotuberculosis strain Cp267, isolated from a llama. (United States)

    Lopes, Thiago; Silva, Artur; Thiago, Rommel; Carneiro, Adriana; Dorella, Fernanda Alves; Rocha, Flavia Souza; dos Santos, Anderson Rodrigues; Lima, Alex Ranieri Jerônimo; Guimarães, Luis Carlos; Barbosa, Eudes G V; Ribeiro, Dayana; Fiaux, Karina Kelly; Diniz, Carlos Augusto Almeida; de Abreu, Vinicius Augusto Carvalho; de Almeida, Sintia Silva; Hassan, Syed Shah; Ali, Amjad; Bakhtiar, Syeda Marriam; Aburjaile, Flávia Figueira; Pinto, Anne Cybelle; Soares, Siomar de Castro; Pereira, Ulisses de Padua; Schneider, Maria Paula C; Miyoshi, Anderson; Edman, Judy; Spier, Sharon; Azevedo, Vasco


    In this work we report the genome of Corynebacterium pseudotuberculosis strain 267, isolated from a llama. This pathogen is of great veterinary and economic importance, as it is the cause of caseous lymphadenitis in several livestock species around the world and causes significant losses due to the high cost of treatment.

  4. 27 CFR 44.267 - Return of cigars from other sources. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Return of cigars from... CIGARETTE PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Withdrawal of Cigars From Customs Warehouses Return of Shipment § 44.267 Return of cigars from other sources. A customs warehouse...

  5. 42 CFR 2.67 - Orders authorizing the use of undercover agents and informants to criminally investigate... (United States)


    ... informants to criminally investigate employees or agents of a program. 2.67 Section 2.67 Public Health PUBLIC... use of undercover agents and informants to criminally investigate employees or agents of a program. (a... involved in the criminal activities to be investigated by the undercover agent or informant; or (2) The...

  6. 40 CFR 267.34 - When must personnel have access to communication equipment or an alarm system? (United States)


    ... to an internal alarm or emergency communication device, either directly or through visual or voice... communication equipment or an alarm system? 267.34 Section 267.34 Protection of Environment ENVIRONMENTAL... have access to communication equipment or an alarm system? (a) Whenever hazardous waste is being poured...

  7. 5 CFR 532.267 - Special wage schedules for aircraft, electronic, and optical instrument overhaul and repair... (United States)


    ... manufacturing. 334418 Printed circuit assembly (electronic assembly) manufacturing. 334419 Other electronic..., electronic, and optical instrument overhaul and repair positions in Puerto Rico. 532.267 Section 532.267 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PREVAILING RATE SYSTEMS...

  8. 20 CFR 1002.267 - How is compensation during the period of service calculated in order to determine the employee's... (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How is compensation during the period of service calculated in order to determine the employee's pension benefits, if benefits are based on compensation? 1002.267 Section 1002.267 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF...

  9. Functional characterization of the protein C A267T mutation: evidence for impaired secretion due to defective intracellular transport

    Directory of Open Access Journals (Sweden)

    Tjeldhorn Lena


    Full Text Available Abstract Background Activated protein C (PC is a serine protease that regulates blood coagulation by inactivating coagulation factors Va and VIIIa. PC deficiency is an autosomally inherited disorder associated with a high risk of recurrent venous thrombosis. The aim of the study was to explore the mechanisms responsible for severe PC deficiency in a patient with the protein C A267T mutation by in-vitro expression studies. Results Huh7 and CHO-K1 cells were transiently transfected with expression vectors containing wild-type (WT PC and mutated PC (A267T PC cDNAs. PC mRNA levels were assessed by qRT-PCR and the PC protein levels were measured by ELISA. The mRNA levels of WT PC and A267T PC were similar, while the intracellular protein level of A267T PC was moderately decreased compared to WT PC. The secretion of A267T PC into the medium was severely impaired. No differences in molecular weights were observed between WT and A267T PC before and after treatment with endo-β-N-acetylglucosaminidase. Proteasomal and lysosomal degradations were examined using lactacystin and bafilomycin, respectively, and revealed that A267T PC was slightly more susceptible for proteasomal degradation than WT PC. Intracellular co-localization analysis indicated that A267T PC was mainly located in the endoplasmic reticulum (ER, whereas WT PC was observed in both ER and Golgi. Conclusions In contrast to what has been reported for other PC mutants, intracellular degradation of A267T PC was not the main/dominant mechanism underlying the reduced intracellular and secretion levels of PC. Our results indicate that the A267T mutation most likely caused misfolding of PC, which might lead to increased retention of the mutated PC in ER.

  10. J1-M267 Y lineage marks climate-driven pre-historical human displacements. (United States)

    Tofanelli, Sergio; Ferri, Gianmarco; Bulayeva, Kazima; Caciagli, Laura; Onofri, Valerio; Taglioli, Luca; Bulayev, Oleg; Boschi, Ilaria; Alù, Milena; Berti, Andrea; Rapone, Cesare; Beduschi, Giovanni; Luiselli, Donata; Cadenas, Alicia M; Awadelkarim, Khalid Dafaallah; Mariani-Costantini, Renato; Elwali, Nasr Eldin; Verginelli, Fabio; Pilli, Elena; Herrera, Rene J; Gusmão, Leonor; Paoli, Giorgio; Capelli, Cristian


    The present day distribution of Y chromosomes bearing the haplogroup J1 M267(*)G variant has been associated with different episodes of human demographic history, the main one being the diffusion of Islam since the Early Middle Ages. To better understand the modes and timing of J1 dispersals, we reconstructed the genealogical relationships among 282 M267(*)G chromosomes from 29 populations typed at 20 YSTRs and 6 SNPs. Phylogenetic analyses depicted a new genetic background consistent with climate-driven demographic dynamics occurring during two key phases of human pre-history: (1) the spatial expansion of hunter gatherers in response to the end of the late Pleistocene cooling phases and (2) the displacement of groups of foragers/herders following the mid-Holocene rainfall retreats across the Sahara and Arabia. Furthermore, J1 STR motifs previously used to trace Arab or Jewish ancestries were shown unsuitable as diagnostic markers for ethnicity.

  11. Protein kinase A phosphorylates serine 267 in the homeodomain of engrailed-2 leading to decreased DNA binding

    DEFF Research Database (Denmark)

    Hjerrild, Majbrit; Stensballe, Allan; Jensen, Ole N


    Engrailed-2 (En-2) belongs to an evolutionarily conserved family of DNA binding homeodomain-containing proteins that are expressed in mammalian brain during development. Here, we demonstrate that serine 267 in the homeodomain of En-2 is phosphorylated by protein kinase A (PKA) in forskolin......-treated COS-7 cells. Furthermore, we analyze the physiological function of En-2 phosphorylation by PKA. The nuclear localization of En-2 is not influenced by the phosphorylation of serine 267. However, substitution of serine 267 with alanine resulted in increased binding of En-2 to DNA, while replacing serine...... 267 with glutamic acid resulted in decreased En-2 DNA binding. These results suggest that the transcriptional activity of En-2 is regulated by PKA....

  12. A Question of Jurisdiction: Art. 267 TFEU Preliminary References of a CFSP Nature

    DEFF Research Database (Denmark)

    Butler, Graham


    Can the Court of Justice of the European Union assert jurisdiction and provide a national court with an interpretation of Union law in a case referred to it from a national court under an Art. 267 TFEU preliminary reference, when the subject matter is in regard to the Common Foreign and Security...... Policy (CFSP)? This was one of a number of questions referred to the Court of Justice from the High Court of England and Wales in Rosneft (judgment of 28 March 2017, case C-72/15). In March 2017, the Court of Justice meeting in a Grand Chamber formation, answered this jurisdictional question...

  13. Mutation of androgen receptor N-terminal phosphorylation site Tyr-267 leads to inhibition of nuclear translocation and DNA binding.

    Directory of Open Access Journals (Sweden)

    Mehmet Karaca

    Full Text Available Reactivation of androgen receptor (AR may drive recurrent prostate cancer in castrate patients. Ack1 tyrosine kinase is overexpressed in prostate cancer and promotes castrate resistant xenograft tumor growth and enhances androgen target gene expression and AR recruitment to enhancers. Ack1 phosphorylates AR at Tyr-267 and possibly Tyr-363, both in the N-terminal transactivation domain. In this study, the role of these phosphorylation sites was investigated by characterizing the phosphorylation site mutants in the context of full length and truncated AR lacking the ligand-binding domain. Y267F and Y363F mutants showed decreased transactivation of reporters. Expression of wild type full length and truncated AR in LNCaP cells increased cell proliferation in androgen-depleted conditions and increased colony formation. However, the Y267F mutant of full length and truncated AR was defective in stimulating cell proliferation. The Y363F mutant was less severely affected than the Y267F mutant. The full length AR Y267F mutant was defective in nuclear translocation induced by androgen or Ack1 kinase. The truncated AR was constitutively localized to the nucleus. Chromatin immunoprecipitation analysis showed that it was recruited to the target enhancers without androgen. The truncated Y267F AR mutant did not exhibit constitutive nuclear localization and androgen enhancer binding activity. These results support the concept that phosphorylation of Tyr-267, and to a lesser extent Tyr-363, is required for AR nuclear translocation and recruitment and DNA binding and provide a rationale for development of novel approaches to inhibit AR activity.

  14. A Question of Jurisdiction: Art. 267 TFEU Preliminary References of a CFSP Nature

    DEFF Research Database (Denmark)

    Butler, Graham


    Can the Court of Justice of the European Union assert jurisdiction and provide a national court with an interpretation of Union law in a case referred to it from a national court under an Art. 267 TFEU preliminary reference, when the subject matter is in regard to the Common Foreign and Security...... Policy (CFSP)? This was one of a number of questions referred to the Court of Justice from the High Court of England and Wales in Rosneft (judgment of 28 March 2017, case C-72/15). In March 2017, the Court of Justice meeting in a Grand Chamber formation, answered this jurisdictional question...... in the affirmative. Given the significance of this judgment for the law of CFSP, and the Opinion of the Advocate General in 2016, this judgment was hotly anticipated given its implications for the “specific rules and procedures” that are applicable to the law of CFSP. As the Court of Justice continues in a line...

  15. 78 FR 56859 - Foreign-Trade Zone 267-Fargo, North Dakota; Authorization of Production Activity; CNH America... (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-51-2013] Foreign-Trade Zone 267--Fargo, North Dakota; Authorization of Production Activity; CNH America, LLC, (Construction and Agricultural Equipment..., submitted a notification of proposed production activity to the Foreign-Trade Zones (FTZ) Board on behalf of...

  16. 18 CFR 2.67 - Calculation of taxes for property of pipeline companies constructed or acquired after January 1... (United States)


    ... Natural Gas Act § 2.67 Calculation of taxes for property of pipeline companies constructed or acquired after January 1, 1970. Pursuant to the provisions of section 441(a)(4)(A) of the Tax Reform Act of 1969, 83 Stat. 487, 625, natural gas pipeline companies which have exercised the option provided by that...

  17. 78 FR 33052 - Foreign-Trade Zone (FTZ) 267-Fargo, North Dakota; Notification of Proposed Production Activity... (United States)


    ...%) for the foreign status inputs noted below and in the existing scope of authority. Customs duties also... Agricultural Equipment Production); Fargo, North Dakota The Fargo Municipal Airport Authority, grantee of FTZ... within Site 2 of FTZ 267. The facilities currently have FTZ authority to produce tractors, wheel loaders...

  18. Report of 267 Cases of Scorpion Bite Referring to an Emergency Department during One Year

    Directory of Open Access Journals (Sweden)

    Mohammad Manouchehrifar


    Full Text Available Scorpion bite is a common health problem in many parts of the world, including the Iran’s tropics. There are thousands of cases and a number of deaths due to scorpion bite every year in the country. The present study aims to provide further data regarding the details, complications and outcomes of scorpion bite cases referring to Razi Hospital, Ahwaz, from March 2011 to April 2012. A total of 267 patients (56.3% females with a mean age of 35.2±15.8 years, were included in the study. The most common genus of scorpion involved was Hemiscorpius (69.3% and the most frequent body part involved was the lower limb (38.9%. The frequency of hemolysis-induced renal insufficiency and death after scorpion bite were 1.9% and 1.1%, respectively. Of all the factors evaluated in this series only the old age was associated with higher possibility of renal insufficiency (P<0.001. 

  19. 267-W cw AlGaAs/GaInAs diode laser bars (United States)

    Braunstein, Juergen; Mikulla, Michael; Kiefer, Rudolf; Walther, Martin; Jandeleit, Juergen; Brandenburg, Wolfgang; Loosen, Peter; Poprawe, Reinhart; Weimann, Guenter


    High-power 980 nm-diode laser bars have been fabricated in the AlGaAs/GaInAs material system. The bars are 1 cm wide and comprise 25 broad area lasers with 200 micrometer aperture and 2 mm resonator length. Hence, the fill factor is 50%. To reduce the power density at the facet, we used an LOC structure with low modal gain, which also helps to prevent filamentation. The measured threshold current was 14 A and a record output power of 267 W cw was achieved at 333 A with an electro-optical conversion efficiency of 40%. With less thermal load, at 150 W output power the conversion efficiency was as high as 50% and the corresponding slope efficiency was 0.9 W/A. Microchannel copper heat sinks with a thermal resistance of less than 0.29 K/W were used for mounting the bars. The coolant temperature was set for all measurements to 22 degrees Celsius and the flux was 0.9 l/min. Additionally, the top electrode of the p-side down mounted bars was cooled by a second heat sink, which was pressed gently on the top electrode.

  20. Magellan/M2FS Spectroscopy of Galaxy Clusters: Stellar Population Model and Application to Abell 267 (United States)

    Tucker, Evan; Walker, Matthew G.; Mateo, Mario; Olszewski, Edward W.; Bailey, John I., III; Crane, Jeffrey D.; Shectman, Stephen A.


    We report the results of a pilot program to use the Magellan/M2FS spectrograph to survey the galactic populations and internal kinematics of galaxy clusters. For this initial study, we present spectroscopic measurements for 223 quiescent galaxies observed along the line of sight of the galaxy cluster Abell 267 (z˜ 0.23). We develop a Bayesian method for modeling the integrated light from each galaxy as a simple stellar population, with free parameters that specify the redshift ({v}{los}/c) and characteristic age, metallicity ([{Fe}/{{H}}]), alpha-abundance ([α /{Fe}]), and internal velocity dispersion ({σ }{int}) for individual galaxies. Parameter estimates derived from our 1.5 hr observation of A267 have median random errors of {σ }{v{los}}=20 {km} {{{s}}}-1, {σ }{Age}=1.2 {Gyr}, {σ }[{Fe/{{H}}]}=0.11 {dex}, {σ }[α /{Fe]}=0.07 {dex}, and {σ }{σ {int}}=20 {km} {{{s}}}-1. In a companion paper, we use these results to model the structure and internal kinematics of A267.

  1. VizieR Online Data Catalog: Magellan/M2FS spectroscopy of Abell 267 (Tucker+, 2017) (United States)

    Tucker, E.; Walker, M. G.; Mateo, M.; Olszewski, E. W.; Bailey, J. I.; Crane, J. D.; Shectman, S. A.


    We select targets for Michigan/Magellan Fiber System (M2FS) observations by identifying galaxies detected in SDSS images (Data Release 12; Alam et al.2015, Cat. V/147) that are projected along the line of sight to Abell 267 and are likely to be quiescent cluster members. We observed 223 individual galaxy spectra on 2013 November 30 on the Clay Magellan Telescope using M2FS. We used the low-resolution grating on M2FS and chose a coverage range of 4600-6400Å with a resolution of R~2000. The detector used with M2FS consists of two 4096*4112 pixel CCDs. (1 data file).

  2. New Nuclide {sup 267}108 Produced by the {sup 238}U+{sup 34}S Reaction

    Energy Technology Data Exchange (ETDEWEB)

    Lazarev, Y.A.; Lobanov, Y.V.; Oganessian, Y.T.; Tsyganov, Y.S.; Utyonkov, V.K.; Abdullin, F.S.; Iliev, S.; Polyakov, A.N.; Rigol, J.; Shirokovsky, I.V.; Subbotin, V.G.; Sukhov, A.M.; Buklanov, G.V.; Gikal, B.N.; Kutner, V.B.; Mezentsev, A.N.; Sedykh, I.M.; Vakatov, D.V. [Joint Institute for Nuclear Research, 141980 Dubna, Russian Federation (Russian Federation); Lougheed, R.W.; Wild, J.F.; Moody, K.J.; Hulet, E.K. [University of California, Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)


    In bombardments of {sup 238}U targets with 186-MeV {sup 34}S projectiles we discovered the {alpha}-decaying nuclide {sup 267}108 with a half-life of 19{sub {minus}10}{sup +29} ms, {ital E}{sub {alpha}}=9.74 to 9.87 MeV, and a production cross section of about 2.5 pb. The new nuclide was identified by measuring correlations in energy, time, and position to establish genetic links between its implantation in a position-sensitive silicon detector and subsequent {alpha} decay followed by {alpha} decays of known descendant nuclides.

  3. Male specific association between the 5-HTR6 gene 267C/T SNP and suicide in the Portuguese population. (United States)

    Azenha, Diana; Alves, Mariana; Matos, Rita; Santa, Jerónimo Fonte; Silva, Beatriz; Cordeiro, Cristina; Vieira, Duarte Nuno; Ambrósio, Alda M


    Serotonergic system dysfunction has been implicated in the etiology of suicide. A large number of genetic studies have focused on the potential involvement of genes coding for components of serotonergic system in suicidal behavior. However, other genes belonging to this system remain to be investigated or have been poorly studied, as is the case of the 5-HT6 receptor (5-HTR6) gene. In this study, we investigated the potential association between the 5-HTR6 gene 267C/T SNP and suicide in a Portuguese population. Blood samples were collected from 179 suicide victims and 189 controls. Genotypes for the 5-HTR6 gene 267C/T SNP were obtained with the restriction enzyme Rsa I. A tendency was found for genotype association between this polymorphism and suicide, but the differences were not statistically significant (chi(2)=5.374, df=2, p=0.068). However, a gender-specific association was detected when comparing the genotype distribution between male suicide victims and male controls (chi(2)=6.988, df=2, p=0.030), suggesting that this SNP might have a role in the etiology of suicide in male subjects in the Portuguese population.

  4. Nustar Reveals the Extreme Properties of the Super-Eddington Accreting Supermassive Black Hole in PG 1247+267 (United States)

    Lanzuisi, G.; Perna, M.; Comastri, A.; Cappi, M.; Dadina, M.; Marinucci, A.; Masini, A.; Matt, G.; Vagnetti, F.; Vignali, C.; hide


    PG1247+267 is one of the most luminous known quasars at z approximately 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad band covered by the new NuSTAR and the archival XMM-Newton data. Several measurements are in agreement with the super-Eddington scenario for PG1247+267: the soft power law (gamma = 2.3 +/- 0.1); the weak ionized Fe emission line; and a hint of the presence of outflowing ionized gas surrounding the SMBH. The presence of an extreme reflection component is instead at odds with the high accretion rate proposed for this quasar. This can be explained with three different scenarios; all of them are in good agreement with the existing data, but imply very different conclusions: i) a variable primary power law observed in a low state, superimposed on a reflection component echoing a past, higher flux state; ii) a power law continuum obscured by an ionized, Compton thick, partial covering absorber; and iii) a relativistic disk reflector in a lamp-post geometry, with low coronal height and high BH spin. The first model is able to explain the high reflection component in terms of variability. The second does not require any reflection to reproduce the hard emission, while a rather low high-energy cutoff of approximately 100 keV is detected for the first time in such a high redshift source. The third model require a face-on geometry, which may affect the SMBH mass and Eddington ratio measurements. Deeper X-ray broad-band data are required in order to distinguish between these possibilities.

  5. Body temperature and cardiac changes induced by peripherally administered oxytocin, vasopressin and the non-peptide oxytocin receptor agonist WAY 267,464: a biotelemetry study in rats (United States)

    Hicks, C; Ramos, L; Reekie, T; Misagh, G H; Narlawar, R; Kassiou, M; McGregor, I S


    Background and Purpose There is current interest in oxytocin (OT) as a possible therapeutic in psychiatric disorders. However, the usefulness of OT may be constrained by peripheral autonomic effects, which may involve an action at both OT and vasopressin V1A receptors. Here, we characterized the cardiovascular and thermoregulatory effects of OT, vasopressin (AVP) and the non-peptide OT receptor agonist WAY 267,464 in rats, and assessed the relative involvement of the OT and V1A receptors in these effects. Experimental Approach Biotelemetry in freely moving male Wistar rats was used to examine body temperature and heart rate after OT (0.01 – 1 mg kg−1; i.p.), AVP (0.001 – 0.1 mg kg−1; i.p.) or WAY 267,464 (10 and 100 mg kg−1; i.p.). The actions of the OT receptor antagonist Compound 25 (C25, 5 and 10 mg kg−1) and V1A receptor antagonist SR49059 (1 and 10 mg kg−1) were studied, as well as possible V1A receptor antagonist effects of WAY 267,464. Key Results OT and AVP dose-dependently reduced body temperature and heart rate. WAY 267,464 had similar, but more modest, effects. SR49059, but not C25, prevented the hypothermia and bradycardia induced by OT and AVP. WAY 267,464 (100 mg·kg−1) prevented the effects of OT, and to some extent AVP. Conclusions and Implications Peripherally administered OT and AVP have profound cardiovascular and thermoregulatory effects that appear to principally involve the V1A receptor rather than the OT receptor. Additionally, WAY 267,464 is not a simple OT receptor agonist, as it has functionally relevant V1A antagonist actions. PMID:24641248

  6. Body temperature and cardiac changes induced by peripherally administered oxytocin, vasopressin and the non-peptide oxytocin receptor agonist WAY 267,464: a biotelemetry study in rats. (United States)

    Hicks, C; Ramos, L; Reekie, T; Misagh, G H; Narlawar, R; Kassiou, M; McGregor, I S


    There is current interest in oxytocin (OT) as a possible therapeutic in psychiatric disorders. However, the usefulness of OT may be constrained by peripheral autonomic effects, which may involve an action at both OT and vasopressin V1A receptors. Here, we characterized the cardiovascular and thermoregulatory effects of OT, vasopressin (AVP) and the non-peptide OT receptor agonist WAY 267,464 in rats, and assessed the relative involvement of the OT and V1A receptors in these effects. Biotelemetry in freely moving male Wistar rats was used to examine body temperature and heart rate after OT (0.01 - 1 mg kg(-1); i.p.), AVP (0.001 - 0.1 mg kg(-1); i.p.) or WAY 267,464 (10 and 100 mg kg(-1); i.p.). The actions of the OT receptor antagonist Compound 25 (C25, 5 and 10 mg kg(-1)) and V1A receptor antagonist SR49059 (1 and 10 mg kg(-1)) were studied, as well as possible V1A receptor antagonist effects of WAY 267,464. OT and AVP dose-dependently reduced body temperature and heart rate. WAY 267,464 had similar, but more modest, effects. SR49059, but not C25, prevented the hypothermia and bradycardia induced by OT and AVP. WAY 267,464 (100 mg·kg(-1)) prevented the effects of OT, and to some extent AVP. Peripherally administered OT and AVP have profound cardiovascular and thermoregulatory effects that appear to principally involve the V1A receptor rather than the OT receptor. Additionally, WAY 267,464 is not a simple OT receptor agonist, as it has functionally relevant V1A antagonist actions. © 2014 The British Pharmacological Society.

  7. NuSTAR reveals the extreme properties of the super-Eddington accreting supermassive black hole in PG 1247+267

    DEFF Research Database (Denmark)

    Lanzuisi, G.; Perna, M.; Comastri, A.


    PG1247+267 is one of the most luminous known quasars at z similar to 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad...

  8. Bentonite buffer pre-test. Core drilling of drillholes ONK-PP264...267 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.


    Suomen Malmi Oy (Smoy) core drilled four drillholes for bentonite buffer pre-test in ONKALO at Eurajoki, Olkiluoto in July 2010. The identification numbers of the holes are ONK-PP264..267, and the lengths of the drillholes are approximately 4.30 metres each. The drillholes are 75.7 mm by diameter. The drillholes were drilled in a niche at access tunnel chainage 1475. The hydraulic DE 130 drilling rig was used for the work. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. In addition to drilling, the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock type in the drillholes is pegmatitic granite. The average fracture frequency in the drill cores is 4.0 pcs / m and the average RQD value 94.2 %. (orig.)

  9. Pages 259 - 267.pmd

    African Journals Online (AJOL)


    Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...


    African Journals Online (AJOL)


    ABSTRACT. The prevalence of malaria parasite and antimalarial preventive measures among students of University of Lagos, Nigeria was carried out between November 2014 and February 2015. Blood samples were collected from 400 students (with age ranging from. 15-46year) by finger pricking and analyzed ...

  11. Et spørgsmål om kompetence: Artikel 267 TEUF præjudiciel forelæggelse af FUSP-karakter

    DEFF Research Database (Denmark)

    Butler, Graham


    Kan Den Europæiske Unions Domstol (’Domstolen’) udøve kompetence og pålægge den nationale ret en fortolkning af EU retten i en sag, der henvises til Domstolen fra en national domstol i henhold til artikel 267 TEUF ang. præjudiciel forelæggelse, når emnet drejer sig om den fælles udenrigs- og sikk...

  12. Isobaric (vapor + liquid) equilibria of the binary system maleic anhydride and diethyl phthalate at p = (2.67, 5.33, and 8.00) kPa

    Energy Technology Data Exchange (ETDEWEB)

    Xu Wei [Department of Chemistry, Institute of Science, Tianjin University, Tianjin 300072 (China); Liu Zhihua [Department of Chemistry, Institute of Science, Tianjin University, Tianjin 300072 (China); Tian Yiling [Department of Chemistry, Institute of Science, Tianjin University, Tianjin 300072 (China)]. E-mail:; Zhu Rongjiao [Department of Chemistry, Institute of Science, Tianjin University, Tianjin 300072 (China)


    Saturated vapor pressures of pure diethyl phthalate were measured with the ebulliometer. And isobaric (vapor + liquid) equilibrium data for the binary system (maleic anhydride + diethyl phthalate) at p = (2.67, 5.33, and 8.00) kPa were determined using the ebulliometric method. The parameters of the NRTL model for the binary system were obtained by calculating equilibrium compositions of the liquid and vapor phase with the experimental equilibrium temperatures, pressures and feed compositions. Moreover (vapor + liquid) equilibrium data for the binary system were predicted by use of the UNIFAC model. Predicted results were compared with those from the ebulliometric method, and showed good agreement.

  13. Novel selective catalytic reduction with tritium: synthesis of the GABAA receptor radioligand 1-(4-ethynylphenyl)-4-[2,3-3H2]propyl-2,6,7-trioxabicyclo[2.2.2 ]octane

    International Nuclear Information System (INIS)

    Palmer, C.J.; Casida, J.E.


    Protection of the terminal alkyne function in 1-(4-ethynylphenyl)-4-(prop-2-enyl)-2,6,7-trioxabicyclo[2.2.2] octane with a trimethylsilyl group permits the selective catalytic reduction of the olefin moiety with tritium gas to give after deprotection 1-(4-ethynylphenyl)-4-[2,3- 3 H 2 ] propyl-2,6,7-trioxabicyclo-[2.2.2] octane. The labeled product at high specific activity is an improved radioligand for the GABA-gated chloride channel of insects and mammals and the intermediate 4-[2,3- 3 H 2 ]propyl-1-[4-[(trimethylsilyl)ethynyl]phenyl]-2,6,7-trioxabicyclo[2.2.2]octane is useful for studies on the metabolic activation of this selective proinsecticide. (author)

  14. Nisin Z Production by Lactococcus lactis subsp. cremoris WA2-67 of Aquatic Origin as a Defense Mechanism to Protect Rainbow Trout (Oncorhynchus mykiss, Walbaum) Against Lactococcus garvieae. (United States)

    Araújo, Carlos; Muñoz-Atienza, Estefanía; Pérez-Sánchez, Tania; Poeta, Patrícia; Igrejas, Gilberto; Hernández, Pablo E; Herranz, Carmen; Ruiz-Zarzuela, Imanol; Cintas, Luis M


    Probiotics represent an alternative to chemotherapy and vaccination to control fish diseases, including lactococcosis caused by Lactococcus garvieae. The aims of this study were (i) to determine the in vitro probiotic properties of three bacteriocinogenic Lactococcus lactis subsp. cremoris of aquatic origin, (ii) to evaluate in vivo the ability of L. cremoris WA2-67 to protect rainbow trout (Oncorhynchus mykiss, Walbaum) against infection by L. garvieae, and (iii) to demonstrate the role of nisin Z (NisZ) production as an anti-infective mechanism. The three L. cremoris strains survived in freshwater at 18 °C for 7 days, withstood exposure to pH 3.0 and 10 % (v/v) rainbow trout bile, and showed different cell surface hydrophobicity (37.93-58.52 %). The wild-type NisZ-producer L. cremoris WA2-67 and its non-bacteriocinogenic mutant L. cremoris WA2-67 ∆nisZ were administered orally (10(6) CFU/g) to rainbow trout for 21 days and, subsequently, fish were challenged with L. garvieae CLG4 by the cohabitation method. The fish fed with the bacteriocinogenic strain L. cremoris WA2-67 reduced significantly (p trout against infection with the invasive pathogen L. garvieae and the relevance of NisZ production as an anti-infective mechanism. This is the first report demonstrating the effective in vivo role of LAB bacteriocin (NisZ) production as a mechanism to protect fish against bacterial infection. Our results suggest that the wild-type NisZ-producer strain L. cremoris WA2-67 could be used in fish farming to prevent lactococcosis in rainbow trout.

  15. 46_ _267 - 278__Aminu- Biosynthesis

    African Journals Online (AJOL)


    Keywords: Syzygium guineenses, Green Chemistry, Spectroscopy, Optoelectronics, Biomedical. Sensors. INTRODUCTION. Nanoscience is one of the critical fields of modern science that has received and still receiving enormous attention by several researchers both in the academia and industries due to its wider range of ...

  16. 264 - 267_Uduma_thorium

    African Journals Online (AJOL)



    Jun 1, 2017 ... range is even wider, from Berllium to uranium (Be to. U). The elemental concentration detection ... toys for lead (Pb) content, sorting scrap metals and measuring the lead content of residential paint. They ... associated with metal ore mining and processing in. Nigeria and provides a robust tool for economic.

  17. Multifarious beneficial traits and plant growth promoting potential of Serratia marcescens KiSII and Enterobacter sp. RNF 267 isolated from the rhizosphere of coconut palms (Cocos nucifera L.). (United States)

    George, Priya; Gupta, Alka; Gopal, Murali; Thomas, Litty; Thomas, George V


    Two plant growth promoting bacteria designated as KiSII and RNF 267 isolated from the rhizosphere of coconut palms were identified as Serratia marcescens and Enterobacter sp. based on their phenotypic features, BIOLOG studies and 16S rRNA gene sequence analysis. Both bacteria exhibited phosphate solubilization, ammonification, and production of indole acetic acid, β-1, 3 glucanase activities and 1-aminocyclopropane-1-carboxylate-deaminase activity. They could also tolerate a range of pH conditions, low temperature and salinity (NaCl). In addition, S. marcescens KiSII exhibited N- fixation potential, chitinase activity, siderophore production and antibiotics production. Seed bacterization with these bacteria increased the growth parameters of test plants such as paddy and cowpea over uninoculated control in green house assay. In coconut seedlings, significant increase in growth and nutrient uptake accompanied with higher populations of plant beneficial microorganisms in their rhizospheres were recorded on inoculation with both the PGPRs. The present study clearly revealed that PGPRs can aid in production of healthy and vigorous seedlings of coconut palm which are hardy perennial crops. They offer a scope to be developed into novel PGPR based bioinoculants for production of elite seedlings that can benefit the coconut farming community and the coconut based ecology.

  18. Publications | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Building a fisheries research network. In the early 1980s, the fishing industry in many Southeast Asian ... Newspaper reporters and television cameras were drawn by the site of the giant mesh collectors that trapped droplets of fog drifting in from the coast. Those droplets —... Solving the water crisis: Increase supplies or ...

  19. Publications | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Lebanon's sparsely settled highlands, a long-time Arab method for settling disputes has taken a decidedly technological twist, as video cameras help the traditional majlis council structure do its work. The cameras helped... Examining the feasibility of informal settlement flood Early Warning Systems : focus on the urban ...

  20. Publications | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  1. 7 CFR 1822.267 - Special conditions. (United States)


    ... be required to agree not to discriminate or permit discrimination, in accordance with section 3 of... included in the price charged for the lots when they are sold. (g) Compliance with local codes and... in this site being sold for $___ (price to be determined as provided for in (§ 1822.275(b))). (3) In...

  2. 26 CFR 1.267(f)-1 - Controlled groups. (United States)


    ..., and not it's attributes (e.g., its source and character) or the holding period of property. (ii) The... States within the meaning of section 864 (unless the income is exempt from taxation pursuant to a treaty... loss is taken into account based on subsequent events (e.g., B's sale of the land to a nonmember...

  3. 40 CFR 267.14 - What are my security requirements? (United States)


    ... minimize the possibility for, livestock and unauthorized people from entering the active portion of your... legend must be in English and in any other language predominant in the area surrounding the facility (for... at least 25 feet. You may use existing signs with a legend other than “Danger—Unauthorized Personnel...

  4. 77 FR 267 - Marine Mammals; File No. 16621 (United States)


    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA915 Marine Mammals; File No. 16621 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Alejandro Acevedo- Guti[eacute]rrez, Ph.D., Biology Department, Western Washington University, Bellingham...

  5. Surgical treatment of hyperparathyroidism : with an analysis of 267 cases

    NARCIS (Netherlands)

    H.A. Bruining (Hajo)


    textabstractIt is generally accepted that for autonomous hyperparathyroidism, whether primary or tertiary, surgery is still the only suitable method of treatment available. Analysis of a series of cases treated in t his way over the past twenty years has shown that there are certain problems

  6. 43 CFR 26.7 - Application format and instructions. (United States)


    ... State Grant Procedures Handbook for definitions of cost categories and for budget narrative instructions. (c) Part III—(Program Narrative Statement). Complete a separate description of each project, which..., planned units of production if applicable, and any constraints that are anticipated. Explain how...

  7. Dicty_cDB: SLA267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YWIVKNSWGTSWGIKGYILMSKDRKKNCGI ASVSSYPLA*iygskmnrrmfgsi**pemffy*knknknnnf*ly Tran...I ASVSSYPLA*iygskmnrrmfgsi**pemffy*knknknnnf*ly Frame B: nkpllstrmkiiklnplmihlivldqrqiiigslkihgvphgv*kvtf*cq

  8. Dicty_cDB: SSH267 [Dicty_cDB

    Lifescience Database Archive (English)


  9. All projects related to | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    Despite the widespread nature of abuse facing women in contexts of armed conflict and transition, there is little documentation on how such women experience injustice and how they exercise their agency to demand justice. Start Date: October 31, 2011. End Date: April 30, 2014. Topic: WAR CRIMES, VIOLENCE AGAINST ...

  10. Dicty_cDB: CHC267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *xxiktkngxaxxxtgdenxxrmvvktikmgden**xrw**x **iknggennqdggxnnqdgdexnnqdggennqdgennqdgdennnqdgeqnqdgdennq egdennnqgddennnqdgdxn...xx*kprmvkxxxxrvmkixqgww*kqsrwvmkinnxdgdxn nksrmvvkiikmvvxtikmvmxiiikmvvkiikmvktik

  11. 1935 15' Quad #267 Aerial Photo Mosaic Index (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. 40 CFR 267.151 - Wording of the instruments. (United States)


    ... = $_____ *12. Total Assets $_____ *13. Intangible Assets $_____ *14. Tangible Assets (Line 12.−Line 13) $_____ *15. Tangible Net Worth (Line 14.−Line 1.) $_____ *16. Assets in the United States $_____ Is Line 15... Assets $_____ *2. Intangible Assets $_____ *3. Tangible Assets (Line 1−Line 2) $_____ *4. Total...

  13. 12 CFR 26.7 - Change in circumstances. (United States)


    ... the depository organization, or an acquisition, merger, consolidation, or any reorganization of the ownership structure of a depository organization that causes a previously permissible interlock to become... change in circumstances may include an increase in asset size of an organization, a change in the...

  14. Electrochemical hydrogen-storage properties of La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.}-5 composites

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Hongxia, E-mail: [Key Lab of New Processing Technology for Nonferrous Metals and Materials Ministry of Education, Guilin University of Technology, Guilin (China); Li, Guohui [Guangxi Scientific Experiment Center of Mining, Metallurgy and Environment, College of Chemistry and Bioengineering, Guilin University of Technology, Guilin (China); Zhuang, Shuxin [School of Material Science and engineering, Xiamen University of Technology, Xiamen (China)


    For improving the electrochemical properties of nonstoichiometric AB{sub 3} -type La{sub 0.7}8Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52} alloy as negative electrode of Ni-MH battery, its related composites La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-x wt.% M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.5} (x = 0, 10, 20, 30) were prepared. Analysis by X-ray diffractometry (XRD) revealed that the composites consist mainly of LaNi{sub 5} and La{sub 2}Ni{sub 7} phases. Despite the small decrease in the maximum discharge capacity, the cycle performance was significantly enhanced. Linear polarization (LP), anodic polarization (AP) and potential step discharge experiments revealed that the electrochemical kinetics increases first and then decreases with increasing x. (author)

  15. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian


    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py......CSP simulator is able to simulate 220 Monte Carlo simulations in less than 35 seconds in the smallest BPU simulation....

  16. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  17. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  18. 40 CFR 267.141 - Definitions of terms as used in this subpart. (United States)


    ... assets or provide services to other entities in the future as a result of past transactions or events. Tangible net worth means the tangible assets that remain after deducting liabilities; such assets would not... meanings of terms in a way that conflicts with generally accepted accounting practices: Assets means all...

  19. Mexico: Neighbor in Transition. Foreign Policy Association Headline Series, No. 267. (United States)

    Smith, Peter H.

    One of a series of booklets on world issues, this five-part document presents information about Mexico. Part one examines Mexican history from Cortez to Madero. Emphasis is placed on the revolution era (1910-1920) and the creation of two political parties: the Partido de la Revolucion Mexicana (Mexican Revolutionary Party or PRM) and the Partido…

  20. SU-E-T-267: Proton Pencil Beam Scanning for Mediastinal Lymphoma: 4-Dimensional Feasibility Study

    International Nuclear Information System (INIS)

    Zeng, C; Plastaras, J; Tochner, Z; Hill-Kayser, C; Hahn, S; Both, S


    Purpose: To assess the feasibility of proton pencil beam scanning (PBS) for the treatment of mediastinal lymphoma. Methods: A group of 6 patients were planned using an anterior field with PBS. Spots with ∼5 mm σ were used for all patients, while large spots (∼10 mm σ) were employed for patients with motion perpendicular to the beam (≥5 mm). We considered volumetric repainting such that, in each fraction, the same field would be delivered twice. Four-dimensional dose was calculated on initial and verification 4-dimensional computed tomography (4D-CT) scans (2—3) based on respiratory trace and beam delivery sequence. This was implemented by binning the spots into separate plans on each 4D-CT phase respectively. Four starting phases were sampled for each painting and 4 energy switching times (0.5 s, 1 s, 3 s, and 5 s) were tested, resulting in 2560 dose distributions for the cohort. Plan robustness was measured for target and critical structures in terms of the percentage difference between delivered dose and planned dose. Results: For 5 of the 6 patients, the ITV (internal target volume) D98% was degraded by <3% (standard deviations ∼ 0.1%) when averaged over the whole course (up to 5% per fraction). Deviations of mean lung dose, heart maximum dose, and cord maximum dose were within 5% of prescribed dose. For one patient with motion perpendicular to the beam (up to 5 mm), the degradation of ITV D98% was 9% over the whole course (12% per fraction), which was mitigated to 1% (3% per fraction) by employing large spots and repainting. No significant difference in coverage was observed for different energy switching times. Conclusion: This feasibility study demonstrates that, for mediastinal lymphoma, the PBS plan robustness can be maintained during delivery when target motion is measured and volumetric repainting and/or large spots are employed. This work was supported by Ion Beam Application

  1. SU-E-T-267: Proton Pencil Beam Scanning for Mediastinal Lymphoma: 4-Dimensional Feasibility Study

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, C; Plastaras, J; Tochner, Z; Hill-Kayser, C; Hahn, S; Both, S [University Pennsylvania, Philadelphia, PA (United States)


    Purpose: To assess the feasibility of proton pencil beam scanning (PBS) for the treatment of mediastinal lymphoma. Methods: A group of 6 patients were planned using an anterior field with PBS. Spots with ∼5 mm σ were used for all patients, while large spots (∼10 mm σ) were employed for patients with motion perpendicular to the beam (≥5 mm). We considered volumetric repainting such that, in each fraction, the same field would be delivered twice. Four-dimensional dose was calculated on initial and verification 4-dimensional computed tomography (4D-CT) scans (2—3) based on respiratory trace and beam delivery sequence. This was implemented by binning the spots into separate plans on each 4D-CT phase respectively. Four starting phases were sampled for each painting and 4 energy switching times (0.5 s, 1 s, 3 s, and 5 s) were tested, resulting in 2560 dose distributions for the cohort. Plan robustness was measured for target and critical structures in terms of the percentage difference between delivered dose and planned dose. Results: For 5 of the 6 patients, the ITV (internal target volume) D98% was degraded by <3% (standard deviations ∼ 0.1%) when averaged over the whole course (up to 5% per fraction). Deviations of mean lung dose, heart maximum dose, and cord maximum dose were within 5% of prescribed dose. For one patient with motion perpendicular to the beam (up to 5 mm), the degradation of ITV D98% was 9% over the whole course (12% per fraction), which was mitigated to 1% (3% per fraction) by employing large spots and repainting. No significant difference in coverage was observed for different energy switching times. Conclusion: This feasibility study demonstrates that, for mediastinal lymphoma, the PBS plan robustness can be maintained during delivery when target motion is measured and volumetric repainting and/or large spots are employed. This work was supported by Ion Beam Application.

  2. 26 CFR 1.267(d)-1 - Amount of gain where loss previously disallowed. (United States)


    ... corporate stock with an adjusted basis for determining loss to him of $800. The loss of $300 is not... transaction 1,600 Less: Loss sustained by H on sale of class A stock to W not allowable as a deduction: Basis... Unallowable loss to H on sale of class A stock 200 Recognized gain on sale of class A stock by W 1,400 Example...

  3. 267 Isolement des bactéries lactiques à partir des produits laitiers ...

    African Journals Online (AJOL)


    genres Lactobacillus, Lactococcus et Leuconostoc, que les Lactobacillus et les Lactococcus isolés en culture pure provoquent ... un produit originaire du Caucasse, est issu d'une fermentation à dominance lactique (Lactobacillus, Lactococcus,. Leuconostoc) ..... Bulgaricus Strains Isolated from Traditional Greek. Yogurts ...

  4. Anabolic-Androgenic Steroids - doi:10.5020/18061230.2007.p267

    Directory of Open Access Journals (Sweden)

    Urival Magno Gomes Ferreira


    Full Text Available There are evidences of the increase in the consumption of anabolic steroids and the damages to health caused by their indiscriminate use, mainly among children and youngsters. The anabolic-androgenic steroids (AAS consist in testosterone and its derivatives. They are produced endogenously in the testicles and adrenal cortex and are responsible for the secondary sexual characteristics associated to masculinity. Although the results of the exogenous use of AAS are still controversial, they have been used for the increase of physical strength and muscle mass. These substances are directly related to different clinical conditions such as: bladder cancer, coronary disease, gynecomastia, hepatic disorders and cancer, and sterility. This study aimed at approaching relevant topics related to the drugs action mechanisms, ways of use and metabolism, and side effects, besides the importance of the prevention in the use of those drugs in most diverse age groups. The abusive use of anabolic-androgenic steroids consists in a problem that has gradually occurred, which has given rise to laws, rules and support groups turned to the prevention, education and restriction of their use.

  5. SU-E-J-267: Change in Mean CT Intensity of Lung Tumors During Radiation Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Mahon, R; Tennyson, N; Weiss, E; Hugo, G [Virginia Commonwealth University, Richmond, VA (United States)


    Purpose: To evaluate CT intensity change of lung tumors during radiation therapy. Methods: Repeated 4D CT images were acquired on a CT simulator during the course of therapy for 27 lung cancer patients on IRB approved protocols. All subjects received definitive radiation treatment ± chemotherapy. CT scans were completed prior to treatment, and 2–7 times during the treatment course. Primary tumor was delineated by an experienced Radiation Oncologist. Contours were thresholded between −100 HU and 200 HU to remove airways and bone. Correlations between the change in the mean tumor intensity and initial tumor intensity, SUVmax, and tumor volume change rate were investigated. Reproducibility was assessed by evaluating the variation in mean intensity over all phases in 4DCT, for a subgroup of 19 subjects. Results: Reproducibility of tumor intensity between phases as characterized by the root mean square of standard deviation across 19 subjects was 1.8 HU. Subjects had a mean initial tumor intensity of 16.5 ± 11.6 HU and an overall reduction in HU by 10.3 ± 8.5 HU. Evaluation of the changes in tumor intensity during treatment showed a decrease of 0.3 ± 0.3 HU/day for all subjects, except three. No significant correlation was found between change in HU/day and initial HU intensity (p=0.53), initial PET SUVmax (p=0.69), or initial tumor volume (p=0.70). The rate of tumor volume change was weakly correlated (R{sup 2}=0.05) with HU change (p=0.01). Conclusion: Most lung cancer subjects showed a marked trend of decreasing mean tumor CT intensity throughout radiotherapy, including early in the treatment course. Change in HU/day is not correlated with other potential early predictors for response, such as SUV and tumor volume change. This Result supports future studies to evaluate change in tumor intensity on CT as an early predictor of response.

  6. The stoichiometric dissociation constants of carbonic acid in seawater brines from 298 to 267 K (United States)

    Papadimitriou, Stathys; Loucaides, Socratis; Rérolle, Victoire M. C.; Kennedy, Paul; Achterberg, Eric P.; Dickson, Andrew G.; Mowlem, Matthew; Kennedy, Hilary


    The stoichiometric dissociation constants of carbonic acid (K1C∗ and K2C∗) were determined by measurement of all four measurable parameters of the carbonate system (total alkalinity, total dissolved inorganic carbon, pH on the total proton scale, and CO2 fugacity) in natural seawater and seawater-derived brines, with a major ion composition equivalent to that of Reference Seawater, to practical salinity (SP) 100 and from 25 °C to the freezing point of these solutions and -6 °C temperature minimum. These values, reported in the total proton scale, provide the first such determinations at below-zero temperatures and for SP > 50. The temperature (T, in Kelvin) and SP dependence of the current pK1C∗ and pK2C∗ (as negative common logarithms) within the salinity and temperature ranges of this study (33 ≤ SP ≤ 100, -6 °C ≤ t ≤ 25 °C) is described by the following best-fit equations: pK1C∗ = -176.48 + 6.14528 SP0.5 - 0.127714 SP + 7.396 × 10-5SP2 + (9914.37 - 622.886 SP0.5 + 29.714 SP) T-1 + (26.05129 - 0.666812 SP0.5) lnT (σ = 0.011, n = 62), and pK2C∗ = -323.52692 + 27.557655 SP0.5 + 0.154922 SP - 2.48396 × 10-4 SP2 + (14763.287 - 1014.819 SP0.5 - 14.35223 SP) T-1 + (50.385807 - 4.4630415 SP0.5) lnT (σ = 0.020, n = 62). These functions are suitable for application to investigations of the carbonate system of internal sea ice brines with a conservative major ion composition relative to that of Reference Seawater and within the temperature and salinity ranges of this study.

  7. 40 CFR 267.16 - What training must my employees have? (United States)


    ... management procedures must direct this program, and must teach facility personnel hazardous waste management procedures (including contingency plan implementation) relevant to their employment positions. (2) At a.... Employees hired after the effective date of your standardized permit must not work in unsupervised positions...

  8. SU-F-T-267: A Clarkson-Based Independent Dose Verification for the Helical Tomotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Nagata, H [Shonan Kamakura General Hospital, Kamakura, Kanagawa, (Japan); Juntendo University, Hongo, Tokyo (Japan); Hongo, H [Shonan Kamakura General Hospital, Kamakura, Kanagawa, (Japan); Tsukuba University, Tsukuba, Ibaraki (Japan); Kawai, D [Kanagawa Cancer Center, Yokohama, Kanagawa (Japan); Takahashi, R [Cancer Institute Hospital of Japanese Foundation for Cancer Research, Koto, Tokyo (Japan); Hashimoto, H [Shonan Fujisawa Tokushukai Hospital, Fujisawa, Kanagawa (Japan); Tachibana, H [National Cancer Center, Kashiwa, Chiba (Japan)


    Purpose: There have been few reports for independent dose verification for Tomotherapy. We evaluated the accuracy and the effectiveness of an independent dose verification system for the Tomotherapy. Methods: Simple MU Analysis (SMU, Triangle Product, Ishikawa, Japan) was used as the independent verification system and the system implemented a Clarkson-based dose calculation algorithm using CT image dataset. For dose calculation in the SMU, the Tomotherapy machine-specific dosimetric parameters (TMR, Scp, OAR and MLC transmission factor) were registered as the machine beam data. Dose calculation was performed after Tomotherapy sinogram from DICOM-RT plan information was converted to the information for MU and MLC location at more segmented control points. The performance of the SMU was assessed by a point dose measurement in non-IMRT and IMRT plans (simple target and mock prostate plans). Subsequently, 30 patients’ treatment plans for prostate were compared. Results: From the comparison, dose differences between the SMU and the measurement were within 3% for all cases in non-IMRT plans. In the IMRT plan for the simple target, the differences (Average±1SD) were −0.70±1.10% (SMU vs. TPS), −0.40±0.10% (measurement vs. TPS) and −1.20±1.00% (measurement vs. SMU), respectively. For the mock prostate, the differences were −0.40±0.60% (SMU vs. TPS), −0.50±0.90% (measurement vs. TPS) and −0.90±0.60% (measurement vs. SMU), respectively. For patients’ plans, the difference was −0.50±2.10% (SMU vs. TPS). Conclusion: A Clarkson-based independent dose verification for the Tomotherapy can be clinically available as a secondary check with the similar tolerance level of AAPM Task group 114. This research is partially supported by Japan Agency for Medical Research and Development (AMED)

  9. 27 CFR 26.267 - Payment of tax by electronic fund transfer. (United States)


    ... which include partnerships and/or sole proprietorships. If one entity maintains more than 50% control over a group consisting of corporations and one, or more, partnerships and/or sole proprietorships, all...

  10. Far-infrared spectrophotometry of SN 1987A - Days 265 and 267 (United States)

    Moseley, S. H.; Dwek, E.; Silverberg, R. F.; Glaccum, W.; Graham, J. R.; Loewenstein, R. F.


    The paper presents 16-66-micron spectra of SN 1987A taken on days 266 and 268 after core collapse. The spectrum consists of a nearly flat continuum, strong emission lines of hydrogen, and fine-structure lines of Fe II, Fe III, Co II, S I, and possibly Fe I, Ni II, and S III. From the relative strength of three lines which arise from transitions within the ground and excited states of Fe II, the temperature and a lower limit on the density of the line-emitting region are derived. From the line strengths, the abundances of Fe and S I, the end products of explosive nucleosynthesis in the supernova are estimated. An upper limit is also set to the amount of Co II remaining in the mantle. The low measured mass of Fe suggests that the ejecta are clumpy. The flat continuum is most likely free-free emission from the expanding supernova ejecta. About 35 percent of this emission arises from the ionized metals in the mantle; the rest arises from ionized hydrogen. At the time of these observations, there is no evidence for any emission from dust that may have formed in the supernova ejecta or from preexisting dust in the surrounding medium.

  11. 40 CFR 267.199 - What inspection requirements must I meet? (United States)


    ... waste. (2) Data gathered from monitoring and leak detection equipment (for example, pressure or temperature gauges, monitoring wells) to ensure that the tank system is being operated according to its design...

  12. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Gammelsrud, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Solhaug, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Dendelé, B. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Sandberg, W.J. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Ivanova, L. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Kocbach Bølling, A. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Lagadic-Gossmann, D. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Refsnes, M.; Becher, R. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Eriksen, G. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Holme, J.A., E-mail: [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway)


    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  13. People and things. CERN Courier, Sep 1986, v. 26(7)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The next regular meeting of the Division of Particles and Fields of the American Physical Society will take place from 14-17 January 1987 in Salt Lake City, Utah, hosted by the Department of Physics of the University of Utah.; A meeting on Computing in High Energy Physics will be held from 2-6 February 1987 at Asilomar State Beach, Monterey, California, arranged by the Stanford Linear Accelerator Center (SLAC) and the Santa Cruz Institute for Particle Physics

  14. A survey of the use of arterial catheters in anesthetized dogs and cats: 267 cases. (United States)

    Trim, Cynthia M; Hofmeister, Erik H; Quandt, Jane E; Shepard, Molly K


    To describe the clinical practice of insertion of arterial catheters in anesthetized dogs and cats, to document complications of arterial catheterization, and to determine risk factors associated with the complications. Prospective clinical study and retrospective evaluation of medical records. University teaching hospital. Dogs (n = 251) and 13 cats anesthetized for clinical procedures with arterial catheters inserted for blood pressure monitoring. None. Details of the animal and catheter were collected at the time of anesthesia. On the following day, the catheter site was palpated and observed for abnormalities and the medical records of all animals were reviewed retrospectively for complications. Details of catheter placement were available for 216 catheters: 158 catheters in a dorsal pedal artery, 50 catheters in the median caudal (coccygeal) artery, 6 in the median artery, and 1 each in a cranial tibial and lingual artery. Blood pressure was obtained from 200 catheters, and 12 catheters failed before the end of anesthesia. Postoperative observational data obtained from 112 catheters described a palpable arterial pulse at 73 sites and no pulse at 21 sites. No risk factor for arterial occlusion was identified. No complications resulting from arterial catheterization were noted in the medical records. Arterial catheterization resulted in loss of a peripheral pulse postoperatively in 21/94 (22.3%) of animals examined, although no evidence of tissue ischemia was noted in the medical records of any of the patients in this study. These results suggest that insertion of a catheter in the dorsal pedal or coccygeal arteries was not associated with a high risk for complications. However, the course of arterial occlusion postoperatively warrants further investigation. © Veterinary Emergency and Critical Care Society 2016.

  15. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    International Nuclear Information System (INIS)

    Gammelsrud, A.; Solhaug, A.; Dendelé, B.; Sandberg, W.J.; Ivanova, L.; Kocbach Bølling, A.; Lagadic-Gossmann, D.; Refsnes, M.; Becher, R.; Eriksen, G.; Holme, J.A.


    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  16. 40 CFR 267.17 - What are the requirements for managing ignitable, reactive, or incompatible wastes? (United States)


    ..., cutting and welding, hot surfaces, frictional heat, sparks (static, electrical, or mechanical...) of this section. You may base this documentation on references to published scientific or engineering...

  17. 40 CFR 267.195 - What are the secondary containment requirements? (United States)


    ... wastes or accumulated liquid out of the system to the soil, groundwater, or surface water at any time... the failure of either the primary or secondary containment structure or the presence of any release of... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the secondary containment...

  18. : tous les projets | Page 267 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... accru pour le travail d'évaluation que les capacités d'évaluation ne peuvent toutefois soutenir. Date de début : 1 octobre 2011. End Date: 24 novembre 2015. Sujet: RESEARCH CAPACITY, RESEARCH METHODS, EVALUATION TECHNIQUES, GENDER ANALYSIS. Région: India, South Asia, Central Asia, Far East Asia.

  19. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...... in the cases where we were not able to gain any performance boost by specialization, the added cost, for kernel generation and extra bookkeeping, is minimal. Many of the lessons learned developing and optimizing the Bohrium GPU vector engine has proven to be valuable in a broader perspective, which has made...

  20. 78 FR 267 - Fisheries of the Exclusive Economic Zone Off Alaska; Inseason Adjustment to the 2013 Gulf of... (United States)


    ... December 5, 2012 (77 FR 72297). In accordance with the FMP, the annual jig sector allocations may increase... performance of the jig sector. NMFS has proposed increasing the jig sector's Pacific cod allocation in the... 2012 allocation in the Western GOA. NMFS also has proposed increasing the jig sector's Pacific cod...

  1. 77 FR 22480 - Guidance Under Section 267(f); Deferral of Loss on Transactions Between Members of a Controlled... (United States)


    ... stock to controlled group members. The proposed regulations provided that a deferred loss is taken into... loss continues to be deferred. For purposes of this paragraph, stock held by S, stock held by B, stock... sells all of the T stock to B at a loss (in a transaction that is treated as a sale or exchange for...

  2. INTEGRAL detects the recurrent transients XTE J1709-267 and XTE J1739-285 in outburst

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, C.; Chenevez, Jérôme; Pavan, L.


    in the 20-40 keV band. We estimate a rough flux of ~8 mCrab (5 sigma) for an effective ISGRI exposure time of 21 ks. A preliminary spectral fit to the JEM-X data is consistent with an absorbed disk blackbody model of temperature ~2.2 keV. The onset of this outburst was also detected by MAXI

  3. Thermodinamic study the uranium-oxygen system within the composition range 2,61 < O/U < 2,67

    International Nuclear Information System (INIS)

    Caneiro, Alberto.


    Oxygen partial pressures (Psub(O2)) as a function of composition and temperature were studied in order to determine the thermodynamic properties of the Uranium-Oxygen (U-O) system. To measure and control Psub(O2), an electrochemical system was used, consisting of an oxygen electrochemical pump and a zirconia gauge which allowed a very accurate determination of the CO + 1/2O 2 = CO 2 reaction. In order to determine oxygen composition, a symmetrical thermogravimetric system a Cahn 1000 electrobalance was constructed and coupled to the system for controlling and measuring Psub(O2) so as to constitute an experimental set-up, which is unique in its type at the present. This facility allowed to determine the thermodynamic properties of the (U-O) system within the composition-temperature range 2,61 3 O 8 ) and of a non-stoichiometric phase (U 8 Osub(21+x)), both being separated by a narrow region of coexistence. Analytical expressions were established for the oxygen chemical potential as a function of composition and temperature, for the stable equilibrium states of the U 8 Osub(21+x) phase and for the metastable ones obtained by oxidation of U 8 Osub(21+x). (M.E.L.) [es

  4. 40 CFR 267.200 - What must I do in case of a leak or a spill? (United States)


    ... migration of the leak or spill to soils or surface water. (2) Remove, and properly dispose of, any visible... the following information: (i) The likely route of migration of the release. (ii) The characteristics... system to service unless the repair is certified by an independent, qualified, registered, professional...

  5. 77 FR 2699 - Foreign-Trade Zone 267-Fargo, ND; Application for Temporary/Interim Manufacturing Authority, CNH... (United States)


    ... agriculture and construction (HTSUS 8701.30, duty-free); cabs and steps for construction equipment (HTSUS 8431...); speed sensors (HTSUS 8526.10), switches (HTSUS 8536.50); terminals and couplings (HTSUS 8536.90...

  6. 40 CFR 267.191 - What are the required design and construction standards for new tank systems or components? (United States)


    ... of the tank system will be in contact with the soil or with water, a determination by a corrosion expert of: (1) Factors affecting the potential for corrosion, such as: (i) Soil moisture content. (ii) Soil pH. (iii) Soil sulfides level. (iv) Soil resistivity. (v) Structure to soil potential. (vi...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF. pp 101-102 Book Review. Fixed Points - From Russia with Love - A Primer of Fixed Point Theory · A K Vijaykumar · More Details Fulltext PDF. pp 102-103 Book Review. The Medusa and the Snail.

  8. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  9. Fulltext PDF

    Indian Academy of Sciences (India)

    64 Fulfilling Mendeleev's Dream. A G Samuelson. 67 Glenn Seaborg 1912-1999. Gregory J Butera. RESEARCH EWS. 91 Nobel Prize in Physiology or Medicine 1999. Utpal Tatu. 95 Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. BO K REV EWS. Fixed Points. From Russia with Love - A Primer of ...

  10. Phosphorylation of murine double minute clone 2 (MDM2) protein at serine-267 by protein kinase CK2 in vitro and in cultured cells

    DEFF Research Database (Denmark)

    Hjerrild, M; Milne, D; Dumaz, N


    Murine double minute clone 2 oncoprotein (MDM2) is a key component in the regulation of the tumour suppressor p53. MDM2 mediates the ubiqutination of p53 in the capacity of an E3 ligase and targets p53 for rapid degradation by the proteasome. Stress signals which impinge on p53, leading to its ac...

  11. 47 CFR 90.267 - Assignment and use of frequencies in the 450-470 MHz band for low power use. (United States)


    ... 80 kilometers (50 miles) of the specified coordinates of the top 100 urban areas listed in § 90.741... station alarm use within the urban areas described in § 90.35(c)(63). Outside the urban areas described in... edge of any structure or is routed below ground level. (4) Sea-based stations may utilize antennas...

  12. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels


    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  13. Avaliação psicológica e ética: um estudo com universitários - doi: 10.5102/ucs.v5i1.267

    Directory of Open Access Journals (Sweden)

    Adauto Garcia de Jesus Junior


    Full Text Available A ética é considerada um fator importante nas avaliações psicológicas e na atuação do psicólogo. O presente estudo objetivou compreender os fatores éticos no processo de avaliação psicológica. Foram participantes desse estudo 126 alunos de 1º, 5º e 9º semestres do curso de psicologia de uma universidade particular do interior do estado de São Paulo. Desse total a maioria era do sexo feminino. A média de idade foi de 25,69. O instrumento utilizado continha 24 itens com três possibilidades de respostas dispostas em escala likert.A coleta de dados ocorreu em uma única sessão, coletivamente, em sala de aula. Esse estudo possibilitou discutir que o tempo de formação profissional influencia na forma como os alunos conciliam ética nas situações práticas que envolvam a avaliação psicológica.

  14. Interferências da subjetividade estrangeira na tradução americana de Diário de Bitita, de Carolina Maria de Jesus DOI - 10.5752/P.2358-3428.2014v18n35p267

    Directory of Open Access Journals (Sweden)

    Raffaela Andréa Fernandez


    Full Text Available Este artigo empreende um estudo comparatista entre a versão brasileira de Diário de Bitita, de Carolina Maria de Jesus e sua tradução para o inglês americano feita por Emanuelle Oliveira e Beth Joan Vinkler, intitulada Bitita’s Diary: the childhood memoires of Carolina Maria de Jesus. As versões analisadas são baseadas na edição original francesa da obra, primeira versão póstuma publicada pela jornalista e editora A. M. Métaillié, que teve acesso aos manuscritos antes da morte de Carolina e os publicou em 1982. O romance só viria a público no Brasil em 1986, quatro anos após essa primeira tirada europeia, quando teve os direitos de edição em língua portuguesa adquiridos pela Editora Nova Fronteira. O nosso intuito neste estudo é observar em que medida a subjetividade das tradutoras da obra para a língua inglesa produziu efeitos de sentido e de que maneira essas possíveis interferências podem vir a afetar o leitor. Procuramos ainda refletir se as modificações realizadas podem incidir sobre os leitores na absorção desses novos sentidos gerados pela retextualização. Para tanto, baseamo-nos nos estudos de Rosemary Arrojo; Jacqueline Authier-Revuz; Rodrigues; Venuti; Neuza Gonçalves Travaglia, Paul Ricoeur e Germana Souza.Palavras-chave: Carolina Maria de Jesus. Tradução. Interferência. Subjetividade.

  15. "Nouvelle théorie des taches du Soleil", Esprit Pezenas (1692-1776) s.j. - Archives Départementales de l'Hérault, Ms. D.128 S.D., fol. 261-267


    BOISTEL, Guy


    Edition commentée et annotée par Guy Boistel.; Cette étude présente le manuscrit, en grande partie inédit, de la « Nouvelle théorie des taches du Soleil » écrit par l’astronome et professeur d’hydrographie jésuite marseillais, le père Esprit Pezenas (1692-1776), texte composé et revu entre les années 1766 et 1772. Dans ce manuscrit, dont nous allons étudier les conditions de sa composition, le P. Pezenas donne l’une des dernières méthodes géométriques, apparentées aux méthodes graphiques, per...

  16. Kratki udvojeni sljedovi DYS458.2 neuobičajenih (“Non-consensus”) alela na kromosomu Y nalaze se nezavisno u obje binarne haploskupine J1-M267 i R1b3-M405


    Myres, Natalie M.; Ekins, Jayne E.; Lin, Alice A.; Cavalli-Sforza, L. Luca; Woodward, Scott R.; Underhill, Peter A.


    Cilj: Odrediti haploskupinsku osnovu “non-consensus” kratkih udvojenih sljedova (engl., short tandem repeat, STR) alela DYS458.2 na kromosomu Y i procijeniti njihov filogenetski podustroj i učestalost u reprezentativnim uzorcima sa Srednjega Istoka, Europe i Pakistana. Postupci: Molekularna karakterizacija povezanosti i konstrukcija haplotipova provedena je kombinacijom dvaju pristupa – analizom binarnog polimorfizma koji definira haploskupinu kromosoma Y i analizom do 37 lokusa STR, uklju...

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.


    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  18. A High Performance Backend for Array-Oriented Programming on Next-Generation Processing Units

    DEFF Research Database (Denmark)

    Lund, Simon Andreas Frimann

    are analyzed and experimentally tested. Resulting in the design and implementation of Bohrium a runtime-system for transforming, scheduling and executing array-oriented programs. Multiple interfaces for existing languages such as Python, C++, C#, and F# have been built which utilize the backend. A suite...... and the efficient execution of them on high performance systems. This work investigates the requirements for, and the implementation of, a high performance backend supporting these goals. This involves an outline of the hardware available today, in the near future and how to program it for high performance....... The main challenge is to bridge the gaps between performance, productivity and portability. A declarative high-level array-oriented programming model is explored to achieve this goal and a backend implemented to support it. Different strategies to the backend design and application of optimizations...

  19. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.


    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  20. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)


  1. Intense near-infrared and midinfrared luminescence from the Dy.sup.3+./sup.-doped GeSe.sub.2./sub.-Ga.sub.2./sub.Se.sub.3./sub.MI (M=K, Cs, Ag) chalcohalide glasses at 1.32, 1.73, and 2.67 μm

    Czech Academy of Sciences Publication Activity Database

    Ren, J.; Wágner, T.; Bartoš, M.; Frumar, M.; Oswald, Jiří; Kincl, M.; Frumarová, Božena; Chen, G.


    Roč. 109, č. 3 (2011), "033105-1"-"033105-7" ISSN 0021-8979 R&D Projects: GA ČR GA203/09/0827 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z40500505 Keywords : chalcohalide glasses * rare earth * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.168, year: 2011

  2. Sintering characteristic and microwave dielectric properties of 0.45Ca0.6Nd0.267TiO3-0.55Li0.5Nd0.5TiO3 ceramics with La2O3-B2O3-ZnO additive (United States)

    Chen, Yawei; Zhang, Shuren; Li, Enzhu; Niu, Na; Yang, Hongcheng


    The La2O3-B2O3-ZnO (LBZ) glass was proved to be an effective sintering aid of the 0.45Ca0.6Nd0.26TiO3-0.55Li0.5Nd0.5TiO3 (CNT-LNT) ceramics. The influence of LBZ glass on the phase composition, low temperature sintering process, microstructure, activation energy, and dielectric properties of CNT-LNT ceramics was investigated in detail. The LBZ glass induced an obvious decrease of the CNT-LNT ceramics sintering temperature from 1350 to 1000 °C due to the liquid phase formation, which reduced the activation energy ( E a) of the CNT-LNT ceramics. In addition, the near zero temperature coefficient of resonant frequency (τƒ) value was obtained by adding moderate quantity of LBZ glass. CNT-LNT + 5 wt% LBZ (CNT-LNT + 5L) ceramics sintered at 1000°C/4 h displayed good microwave dielectric properties of: ɛ r = 101.7, Q × f = 1560 GHz ( f = 3.25 GHz) and τ ƒ = 2.3 ppm °C-1.

  3. Site characterization and validation - Tracer migration experiment in the validation drift, report 2, Part 2: breakthrough curves in the validation drift appendices 5-9

    International Nuclear Information System (INIS)

    Birgersson, L.; Widen, H.; Aagren, T.; Neretnieks, I.; Moreno, L.


    Flowrate curves for the 53 sampling areas in the validation drift with measureable flowrates are given. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. The total flowrate for these three sampling areas is given in a separate plot. The flowrates are given in ml/h. The time is given in hours since April 27 00:00, 1990. Disturbances in flowrates are observed after 8500 hours due to opening of boreholes C1 and W1. Results from flowrate measurements after 8500 hours are therefore excluded. The tracer breakthrough curves for 38 sampling areas in the validation drift are given as concentration values versus time. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. This gives a total of 40 breakthrough curves for each tracer. (au)

  4. ORF Alignment: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 110; Issue 4. Volume 110, Issue 4. December 2001, pages 267-463. Recent Researchers in Petrology and Geochemistry. pp 267-267. Preface · S Bhattacharya J Ganguly · More Details Fulltext PDF. pp 269-285. Earth support systems: Threatened? Why? What can ...

  6. Report on the behalf of the Parliamentary Office for the Assessment of Scientific and Technological Choices on drones and safety of nuclear installations. Restricted report of the hearing of the 24 November 2014 at 2 p.m., report of the public hearing on the same day at 4.30 p.m., and presentation of conclusions on the 26 November 2014. Nr 2523, Nr 267

    International Nuclear Information System (INIS)

    Le Deaut, Jean-Yves; Sido, Bruno


    The first part of this document partially reports discussions between different experts on the responses and threats related to the flyover of nuclear installations by drones. This hearing more particularly addressed the following topics: drones and national defence, the external protection of sensitive installations, and safety within facility perimeter. Hearing of experts is followed by a discussion involving these experts and members of Parliament. The second part reports hearings of experts on the issues of control and regulation related to this type of flyover. The following topics have been addressed: the various actors of the drone sector (manufacturers, operators, users, and regulation), the role distribution along actors for nuclear safety and security. A debate is also reported

  7. Comparative Effect of an Addition of a Surface Term to Woods-Saxon Potential on Thermodynamics of a Nucleon (United States)

    Lütfüoğlu, B. C.


    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schrödinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an α particle confined in Bohrium-270 nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared for both wells. The internal energy and the specific heat capacity increase as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the number of available states. Supported by the Turkish Science and Research Council (TÜBİTAK) and Akdeniz University

  8. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.


    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  11. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  12. Binary asteroid population. 3. Secondary rotations and elongations

    Czech Academy of Sciences Publication Activity Database

    Pravec, Petr; Scheirich, Peter; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián; Naidu, S.P.; Pray, D. P.; Világi, J.; Gajdoš, Š.; Kornoš, L.


    Roč. 267, March (2016), s. 267-295 ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229; GA ČR GA15-07193S Institutional support: RVO:67985815 Keywords : asteroids * rotation * dynamics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016

  13. Isolation of live Borrelia burgdorferi sensu lato spirochaetes from patients with undefined disorders and symptoms not typical for Lyme borreliosis

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Vancová, Marie; Clark, K.; Grubhoffer, Libor; Oliver, J. H., Jr.


    Roč. 22, č. 3 (2016), 267.e9-267.e15 ISSN 1198-743X EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : antibiotic treatment * live Borrelia burgdorferi * live Borrelia bissettii * Lyme borreliosis * recovery of live spirochaetes Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 5.292, year: 2016

  14. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 115; Issue 3. Volume 115, Issue 3. June 2006, pages 267-386. pp 267-276. Fast computation of Hankel Transform using orthonormal exponential approximation of complex kernel function · Pravin K Gupta Sri Niwas Neeta Chaudhary · More Details Abstract Fulltext ...

  15. Methods in half-linear asymptotic theory

    Czech Academy of Sciences Publication Activity Database

    Řehák, Pavel


    Roč. 2016, Č. 267 (2016), s. 1-27 ISSN 1072-6691 Institutional support: RVO:67985840 Keywords : half-linear differential equation * nonoscillatory solution * regular variation Subject RIV: BA - General Math ematics Impact factor: 0.954, year: 2016 http://ejde. math

  16. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. June 2009, pages 267-410. pp 267-274. A Finer Classification of the Unit Sum Number of the Ring of Integers of Quadratic Fields and Complex Cubic Fields · Nahid Ashrafi · More Details Abstract ...

  17. 76 FR 64163 - Submission Deadline for Schedule Information for San Francisco International Airport for the... (United States)


    ... to: [email protected] . FOR FURTHER INFORMATION CONTACT: Robert Hawks, Office of the Chief... number: 202-267-7143; fax number: 202- 267-7971; e-mail: . SUPPLEMENTARY INFORMATION... representatives of carriers operating at SFO) have been meeting regularly to review construction plans, identify...

  18. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 88, Issue 3. December 2009, pages 267-391. pp 267-272 Research Article ... pp 273-279 Research Article. Evaluation of RAPD-PCR and protein profile analysis to .... More Details Fulltext PDF. pp 345-348 Research Note. Genetic variation in colchicine-treated regenerated plants of Eucalyptus globulus Labill.

  19. Untitled

    Indian Academy of Sciences (India)

    Seo-glasses are shown in figure 5. As the average coordination number (r) is increased, T, also increases gradually and shows a saturation behaviour beyond (r) = 267. Another important feature observed is that the T, values for both glasses follow the same variation up to around (r) = 267 and then deviate showing.

  20. The importance of being subtle: small changes in calcium homeostasis control cognitive decline in normal aging

    Czech Academy of Sciences Publication Activity Database

    Toescu, E.C.; Verkhratsky, Alexei


    Roč. 6, - (2007), s. 267-273 ISSN 1474-9718 Institutional research plan: CEZ:AV0Z50390512 Keywords : Aging * Ca homeostasis * Cognitive decline Subject RIV: FH - Neurology Impact factor: 5.854, year: 2007

  1. 155 - 164 Influence of Mineral Nitrogen and Potassium Fertilizers on ...

    African Journals Online (AJOL)


    . Production on Alluvial Soil in ... rate of nitrogen fertilizer required to enhance seed tuber production was found to be higher than that required to optimize ware potato ...... to lime in the Midwestern United States. Soil acidity and liming: 267 ...

  2. Co víme o historii vápnitých slatinišť v Západních Karpatech

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, M.; Horsák, M.; Jamrichová, Eva


    Roč. 50, č. 2 (2015), s. 267-282 ISSN 1211-5258 Institutional support: RVO:67985939 Keywords : bryophytes * Caricion davallianae * macrofossils * palaeoecology * relicts * succession Subject RIV: EH - Ecology, Behaviour

  3. 75 FR 12121 - Extended Operations (ETOPS) of Multi-Engine Airplanes; Technical Amendment (United States)


    ... CONTACT: Zara Willis, Office of Rulemaking, Federal Aviation Administration, 800 Independence Ave., SW., Washington, DC 20591; telephone (202) 493-4405 facsimile (202) 267- 5075; e-mail Zara[email protected

  4. Butenolides from Plant-Derived Smoke: Natural Plant-Growth Regulators with Antagonistic Actions on Seed Germination

    Czech Academy of Sciences Publication Activity Database

    Light, M. E.; Burger, B. V.; Staerk, D.; Kohout, Ladislav; van Staden, J.


    Roč. 73, č. 2 (2010), s. 267-269 ISSN 0163-3864 Institutional research plan: CEZ:AV0Z40550506 Keywords : butenolides * karrikins * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 2.872, year: 2010

  5. 75 FR 18253 - Notice of Final Federal Agency Actions on Proposed Highway in California (United States)


    ... project, State Route 28 between State Route 267 and Chipmunk Street in the community of Kings Beach, in...: Caltrans proposes to improve bicycle and pedestrian circulation, implement streetscape elements, and meet...

  6. 78 FR 73850 - Pacific Fishery Management Council; Public Meetings and Hearings (United States)


    ... include a description of the adopted salmon management alternatives and a summary of their biological and... Lion Hotel, South Umpqua Room, 1313 N Bayshore Drive, Coos Bay, OR 97420, telephone: (541) 267-4141...

  7. Occurrence and Species Distribution of Strictly Anaerobic Bacterium Pectinatus in Brewery Bottling Halls

    Czech Academy of Sciences Publication Activity Database

    Matoulková, D.; Kosař, K.; Slabý, M.; Sigler, Karel


    Roč. 70, č. 4 (2012), s. 262-267 ISSN 0361-0470 Institutional support: RVO:61388971 Keywords : Beer spoilage * Biofilm * Conveyor belt Subject RIV: EE - Microbiology, Virology Impact factor: 1.000, year: 2012

  8. Coccidioides complement fixation (United States)

    ... be false positive tests in people with other fungal diseases such as histoplasmosis and blastomycosis , and false negative ... ed. Philadelphia, PA: Elsevier Saunders; 2015:chap 267. Review Date 9/27/2017 Updated by: Jatin M. ...

  9. New Uropodine mites from Tanzania (Acari: Mesostigmata)

    Czech Academy of Sciences Publication Activity Database

    Kontschán, J.; Starý, Josef


    Roč. 3683, č. 3 (2013), s. 267-279 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Acari * Mesostigmata * Uropodina * new genus * new species * Tanzania Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  10. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette


    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  11. The Elgar companion to health economics

    National Research Council Canada - National Science Library

    Jones, Andrew M


    ... from the British Library Library of Congress Control Number: 2006005895 ISBN 978 1 84980 267 3 (cased) Typeset by Servis Filmsetting Ltd, Stockport, Cheshire Printed and bound by MPG Books Group, UK...

  12. Lidová hudba a zvukový záznam

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj


    Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Effect of body mass and physical activity volume and intensity on ...

    African Journals Online (AJOL)

    measured total weekly activity energy expenditure (EEAct) in rural black South Africans in the Limpopo Province. Design. We analysed 7-day pedometry data in 775 subjects (female: N=508; male: N=267). Variance components models for ...

  14. 77 FR 44309 - Petition for Exemption; Summary of Petition Received (United States)


    ... INFORMATION CONTACT: Frances Shaver, ARM-207, (202) 267- 4059, FAA, Office of Rulemaking, 800 Independence Ave... No.: FAA-2012-0081. Petitioner: Blue Ridge Community College. Section of 14 CFR Affected: Sec. 147.21...

  15. Caloplaca allochroa (lichenized Ascomycetes), a new saxicolous lichen species from South Korea

    Czech Academy of Sciences Publication Activity Database

    Joshi, Y.; Vondrák, Jan; Vondráková, O.; Nguyen, T.T.; Hur, J.-S.


    Roč. 2011, č. 117 (2011), s. 261-267 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z60050516 Keywords : anthraquinone s * taxonomy * Teloschistaceae Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  16. Kodiak, Alaska 3 arc-second DEM (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 3-second Kodiak Alaska Elevation Grid provides bathymetric data in ASCII raster format of 2.67-second resolution in geographic coordinates. This grid is strictly...

  17. The Effect of Transient Operations on the Levels and Congener Profiles of PCBz, PCPh and PCDD/F in Raw Flue Gases of MSWI Plant

    Czech Academy of Sciences Publication Activity Database

    Šyc, Michal; Fišerová, Eva; Karban, Jindřich; Punčochář, Miroslav; Pekárek, Vladimír


    Roč. 118, JAN 2015 (2015), s. 261-267 ISSN 0045-6535 Institutional support: RVO:67985858 Keywords : benzenes * phenols * waste incineration Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.698, year: 2015

  18. Increased detection of respiratory syncytial virus, influenza viruses, parainfluenza viruses, and adenoviruses with real-time PCR in samples from patients with respiratory symptoms

    NARCIS (Netherlands)

    van de Pol, Alma C.; van Loon, Anton M.; Wolfs, Tom F. W.; Jansen, Nicolaas J. G.; Nijhuis, Monique; Breteler, Els Klein; Schuurman, Rob; Rossen, John W. A.

    Respiratory samples (n = 267) from hospitalized patients with respiratory symptoms were tested by real-time PCR, viral culture, and direct immunofluorescence for respiratory syncytial virus, influenza virus, parainfluenza viruses, and adenoviruses. Compared with conventional diagnostic tests,



    T.V. Karchinskaja; O.I. Zaparozhtseva; E.V. Vereshchak; Yu.l. Polovko; T.P. Bondar; L.D. Tsaturjan


    The results ofexamination of 267 teenagers who live in various ecological biogeochemical regions are indicated in the work. Vegetative regulation differences of cardiac function and the peculiarities oferythrocytic background have been determined


    Directory of Open Access Journals (Sweden)

    T.V. Karchinskaja


    Full Text Available The results ofexamination of 267 teenagers who live in various ecological biogeochemical regions are indicated in the work. Vegetative regulation differences of cardiac function and the peculiarities oferythrocytic background have been determined

  1. Radio Frequency Radiation Dosimetry Handbook (Fifth Edition) (United States)



  2. Dvě konference o Němcích ze středovýchodní Evropy ve Freiburku

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana


    Roč. 104, č. 2 (2017), s. 264-267 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : Germans * Central Eastern Europe * Freiburg * Ethnology * Anthropology Subject RIV: AC - Archeology, Anthropology , Ethnology OBOR OECD: Antropology, ethnology

  3. Final Rule for Control of Air Pollution From Aircraft and Aircraft Engines; Emission Standards and Test Procedures (United States)

    EPA adopted emission standards and related provisions for aircraft gas turbine engines with rated thrusts greater than 26.7 kilonewtons. These engines are used primarily on commercial passenger and freight aircraft.

  4. Proposed Rule and Related Materials for Control of Emissions of Air Pollution From Nonroad Diesel Engines Control of Air Pollution From Aircraft and Aircraft Engines; Proposed Emission Standards and Test Procedures (United States)

    EPA is proposing to adopt emission standards and related provisions for aircraft gas turbine engines with rated thrusts greater than 26.7 kilonewtons. These engines are used primarily on commercial passenger and freight aircraft.

  5. Štípaná industrie z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

    Czech Academy of Sciences Publication Activity Database

    Stolz, D.; Řídký, J.; Půlpán, M.; Burgert, Pavel


    Roč. 67, č. 2 (2015), s. 267-286 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * chipped stone industry Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan


    Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005

  7. Download this PDF file

    African Journals Online (AJOL)


    43.3 23.3. All types of company can benefit from sponsoring rural development broadcasts. 26.7 40. 26.7 6.7. 0. The category of people listening to rural development broadcasts is not our target audience. 3.3. 13.3 23.3 56.7 3.3. Rural development broadcasters possess enough persuasive skills for attracting sponsors. 6.7.

  8. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)


    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  9. New publications Barry Turner New publications , Editor Care Choices Ltd Tel: 0800 389 2077 160pp £12.99 1-898597-05-7 1898597057 Elizabeth Scott St George's Nurses League, c/o Chief Nurse's Office, Room 32, 1st Floor Grosvenor Wing, St George's Hospital, London SW17 0QT 165pp £12.50+£1.20 p&p Don Brand and Peter Fletcher National Institute for Social Work/National Housing Federation £15 plus £2.50 p&p (cheque payable to National Housing Federation) 0-86297-452-6 0862974526 Moya J Morison (editor) Mosby 267pp £24.95 0-7234-3158-2 0723431582. (United States)


    Practical handbook offering advice on finding and funding care for adults with disabilities. Also lists more than 500 useful advisory organisations, indexed by subject, from abuse through travel and holidays to women's health.

  10. Seroprevalence of hepatitis B e antigen (HBe antigen and B core antibodies (IgG anti-HBcore and IgM anti-HBcore among hepatitis B surface antigen positive blood donors at a Tertiary Centre in Nigeria

    Directory of Open Access Journals (Sweden)

    Akinbami Akinsegun A


    Full Text Available Abstract Background Hepatitis B virus (HBV is a common cause of liver disease throughout the world. HBV is transmitted through blood and other body fluids, including semen and saliva. Chronic replication of HBV virons is characterized by persistence circulation of HBsAg, HBeAg and HBV DNA; usually with anti-HBc and occasionally with anti-HBs. Aim: To determine the prevalence of HBeAg, IgG anti-HBcore and IgM anti-HBcore amongst HBsAg positive blood donors. These parameters are reflective of transmissibility and active hepatitis B infection. A cross sectional study was carried out at the blood donor clinics of Lagos State University Teaching Hospital Ikeja and Lagos University Teaching Hospital Idiaraba. A total of 267 donors were recruited to determine HBe antigen, IgG and IgM anti-HBcore antibodies amongst hepatitis BsAg positive donors. Five milliliters of blood was collected from those who tested positive to HBsAg screen during donation. The sera were subjected to enzyme linked immunosorbent assay (ELISA. Pearson chi-squared test was used for the analytical assessment. Findings A total number of 267 HBsAg positive blood donors were studied. A seroprevalence of 8.2% (22 of 267 HBeAg was obtained, 4 of 267 (1.5% were indeterminate while 241 (90.3% tested negative. Only 27 out of 267 donors (10.1% tested positive to IgM anti-HBcore, 234(87.6% tested negative, while 6(2.2% were indeterminate. A higher percentage of 60.7% (162 of 267 tested positive to IgG anti-HBcore, while 39.3% (105 of 267 tested negative. Conclusion There is a low seroprevalence rate of HBeAg-positive chronic hepatitis and relatively high IgG anti-HBcore and IgM anti-HBcore rates in South West Nigeria.

  11. 75 FR 69155 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals (United States)


    ... *97-01-C-06-SDF Louisville, KY.. 10/20/10 90,600,000 90,600,000 11/01/14 12/01/13 01-02-C-05-SDF Louisville, KY... 10/20/10 10,012,140 10,012,140 03/01/16 04/01/14 03-03-C-03-SDF Louisville, KY... 10/20/10 5,666,800 5,666,800 04/01/18 02/01/15 06-04-C-04-SDF Louisville, KY... 10/20/10 1,267,315 1,267,315...

  12. Outbreak of Tinea capitis by Trichophyton tonsurans and Microsporum canis in Niterói, RJ, Brazil Microepidemia de tinha do couro cabeludo por Trichophyton tonsurans e Microsporum canis em Niterói, RJ, Brasil

    Directory of Open Access Journals (Sweden)

    Loan Towersey


    Full Text Available 18 girls from an orphanage (Orfanato Santo Antônio in Niterói presented tinea capitis due to Trichophyton tonsurans (15 cases - 83.3% and Microsporum canis (3 cases - 26.7%. Comments are made about clinical, mycological and therapeutic aspects of this microepidemy18 meninas internas do Orfanato Santo Antônio em Niterói apresentaram tinha do couro cabeludo causada por Trichophyton tonsurans (15 casos - 83,3% e Microsporum canis (3 casos - 26,7%. São discutidos aspectos clínicos e terapêuticos desta microepidemia

  13. Virksomheden som felt: et casestudie

    DEFF Research Database (Denmark)

    Bourdieu, Pierre


    Oversættelse af Pierre Bourdieu: “Annexe. Le champ de l’entreprise: une étude de cas”, i Les structures sociales de l’économie (Editions du Seuil, 2000), s. 267-270, med tilladelse fra Polity Press.......Oversættelse af Pierre Bourdieu: “Annexe. Le champ de l’entreprise: une étude de cas”, i Les structures sociales de l’économie (Editions du Seuil, 2000), s. 267-270, med tilladelse fra Polity Press....

  14. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia


    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  15. MicroSISAK. Continuous liquid-liquid extractions of radionuclides at {>=} 0.2 mL/min

    Energy Technology Data Exchange (ETDEWEB)

    Hild, D.; Eberhardt, K.; Kratz, J.V.; Wiehl, N. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Even, J. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Helmholtz-Institut Mainz, Mainz (Germany); Loeb, P.; Werner, B.; Hofmann, C. [Institut fuer Mikrotechnik Mainz GmbH, Mainz (Germany)


    extraction yield determined as the ratio of the Tc {gamma}-ray activities in both detectors was 76 {+-} 1%. With this experiment, it was demonstrated that MicroSISAK is in principle ready for an on-line experiment for the chemical characterization of the superheavy element bohrium, element 107. However, the detection of a-particle activities by liquid scintillation counting still needs to be worked out. (orig.)

  16. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo


    Roč. 135, 3-4 (2009), s. 267-271 ISSN 0378-1135 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  17. Effect of specific ADRB1/ADRB2/AGT genotype combinations on the association between survival and carvedilol treatment in chronic heart failure

    DEFF Research Database (Denmark)

    Petersen, Morten; Andersen, Jon T; Jimenez-Solem, Espen


    the downregulated ADRB2 genotype (Gln27-carrier) was added to the ADRB1/AGT combination (Pinteraction=0.0005; hazard ratio 2.67, 95% confidence interval 1.51-4.72, P=0.0007). Two hundred and four patients were treated with metoprolol. There was no interaction between metoprolol treatment and the specific genotype...

  18. Comparative analysis of thermal stability of two different nc-TiC/a-C:H coatings

    Czech Academy of Sciences Publication Activity Database

    Zábranský, L.; Buršíková, V.; Daniel, L.; Souček, P.; Vašina, P.; Dugáček, J.; Sťahel, P.; Caha, O.; Buršík, Jiří; Peřina, Vratislav


    Roč. 267, APR (2015), s. 32-39 ISSN 0257-8972 R&D Projects: GA MŠk(CZ) LM2011019 Institutional support: RVO:68081723 ; RVO:61389005 Keywords : nanocomposite * thermal annealing * hardness Subject RIV: BM - Solid Matter Physics ; Magnetism; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 2.139, year: 2015

  19. The Impact of Collegiality amongst Australian Accounting Academics on Work-Related Attitudes and Academic Performance (United States)

    Su, Sophia; Baird, Kevin


    This study provides an insight into the collegiality of Australian accounting academics and the association of collegiality with their work-related attitudes and academic performance. Data were collected by a survey questionnaire from a random sample of 267 accounting academics within Australian universities. The results suggest a moderate level…

  20. The consequences upon patient care of moving Brits Hospital: A ...

    African Journals Online (AJOL)

    Background. In 2001, North West Province took the decision to increase bed capacity at Brits Hospital from 66 beds to 267 beds. After careful consideration of costs and an assessment of available land, it was decided to demolish the existing hospital and rebuild the new hospital on the same site. It was planned that during ...

  1. Magnonic charge pumping via spin-orbit coupling

    Czech Academy of Sciences Publication Activity Database

    Ciccarelli, C.; Hals, K.M.D.; Irvine, A.; Novák, Vít; Tserkovnyak, Y.; Kurebayashi, H.; Brataas, A.; Ferguson, A.


    Roč. 10, č. 1 (2015), 50-54 ISSN 1748-3387 R&D Projects: GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : spintronics * spin-orbit torque * GaMnAs Subject RIV: BM - Solid Matter Physics ; Magnet ism Impact factor: 35.267, year: 2015

  2. Missing data analysis and homogeneity test for Turkish precipitation ...

    Indian Academy of Sciences (India)

    In this study, missing value analysis and homogeneity tests were conducted for 267 precipitation stations throughout Turkey. For this purpose, the monthly and annual total precipitation records at stations operated by Turkish State Meteorological Service (DMI) from 1968 to 1998 were considered. In these stations ...

  3. Innovation, improvement and operations: an exploration of the management of alignment

    NARCIS (Netherlands)

    de Leede, Jan; Looise, Jan C.; Alders, B.C.M.; Alders, Ben C.M.


    Based on the assumption that the three functions of operations, improvement and innovation within companies need to be aligned to improve company performance, this article addresses two internal alignment mechanisms structural and social-dynamic alignment. A survey of 267 companies confirms that

  4. 1.4 million cubic metres of achievement

    International Nuclear Information System (INIS)



    After five years of civil engineering work, the accent at CERN's 26.7 kilometre LEP electron-positron collider is now on installation. The first 2.8 kilometre section is now virtually complete and awaits the first positron test beam this summer, while the preparations for the four big detectors enter their final phase. (orig./HSI).

  5. High-fluence implantation of iron into polyimide

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Hnatowicz, Vladimír; Peřina, Vratislav; Popok, V. N.; Khaibullin, R. I.; Bazarov, V. V.; Odzhaev, V. B.

    158/159, - (2002), s. 395-398 ISSN 0257-8972 R&D Projects: GA ČR GA203/99/1626; GA ČR GA102/01/1324 Keywords : polyimide * ion implantation * iron * Rutherford backscattering spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2002

  6. Interactive effects of ambient temperature and light sources at high relative humidity on growth performance and blood physiological variables in broilers grown to 42 day of age (United States)

    The interactive effects of ambient temperature and light sources at high relative humidity on growth performance and blood physiological reactions in broilers grown to 42 day of age were investigated. The experiment consisted of 2 levels (Moderate=21.1, High=26.7 °C) of temperatures and 2 light sour...

  7. Database Description - CREATE portal | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available n: Kazusa DNA Research Institute (KDRI) Journal Search: Contact address 2-6-7 Kazusa-Kamatari, Kisarazu, Chi...o S, Okazaki N, Ohara O. Journal: DNA Res. 2004 Aug 31;11(4):293-304. External Li... Murakami M, Shimada K, Kawai M, Koga H. Journal: DNA Res. 2005;12(5):379-87. External Links: Original websi

  8. Correction to Hilton et al. (2004) (United States)

    Hilton, N. Zoe; Harris, Grant T.; Rice, Marnie E.; Lang, Carol; Cormier, Catherine A.; Lines, Kathryn J.


    This paper reports errors in the article "A Brief Actuarial Assessment for the Prediction of Wife Assault Recidivism: The Ontario Domestic Assault Risk Assessment," by N. Zoe Hilton, Grant T. Harris, Marnie E. Rice, Carol Lang, Catherine A. Cormier, and Kathryn J. Lines (Psychological Assessment, 2004, Vol. 16, No. 3, pp. 267-275). On page 272,…

  9. Antimicrobial activity of the ethanol extract and fractions of the seeds ...

    African Journals Online (AJOL)



    Jan 18, 2008 ... Fitoterapia 65 3: 267-278. Okonji CO, Iwu MM (1988). Control of Schistosomiasis using Nigerian medicinal plants as molluscicides. Int. J. Crude drug Res. 26(4): 246-. 252. Russel AD, Fur JR (1977). Antibacteria activity of a new chloroxylenol prepration containing ethylenediamine tetra acetic acid. J. Appl.

  10. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva


    Roč. 563, č. 1 (2006), s. 263-267 ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  11. Generation and basic characterization of glutamate carboxypeptidase II knock-out mice

    Czech Academy of Sciences Publication Activity Database

    Vorlová, Barbora; Kašpárek, Petr; Šácha, Pavel; Sedláček, Radislav; Konvalinka, Jan


    Roč. 25, č. 2 (2016), s. 267 ISSN 0962-8819. [Transgenic Technology Meeting (TT2016) /13./. 20.03.2016-23.03.2016, Praha] Institutional support: RVO:61388963 ; RVO:68378050 Keywords : GCPII * PSMA * FolhI * knock-out mice Subject RIV: CE - Biochemistry

  12. Journal of Agricultural Extension ...

    African Journals Online (AJOL)


    Food and Agricultural Organization (FAO) 76 ... that could facilitate ICT utilization in agriculture, there were more women. (28.9%) compared to men (27.8%) and youth (26.7%). ... Information communication technologies (ICTs) in recent years have witnessed major changes and are ...

  13. Margaret Atwood: "The handmaid´s tale"


    Pache, Walter


    Margaret Atwood: "The handmaid´s tale". - In: Große Werke der Literatur / [hrsg. von Hans Vilmar Geppert]. - Augsburg : Presse-Dr.- u. Verl.-GmbH. - Bd. 2. (1992). - S. 245-267. - Veränd. auch ersch. in: Anglistentag: Proceedings. 1991 (1992). S. 386-400

  14. Factors influencing recruitment and retention of professional nurses ...

    African Journals Online (AJOL)

    We compared responses from rural and urban based HP as well as professional nurses (PNs), doctors, and allied HPs. Results: 417 questionnaires were completed: 150 from HPs in rural and 267 from HPs in urban hospitals. Perceptions of living/working in rural areas is negative and the quality of health care provided in ...

  15. 77 FR 54805 - Revocation of Jet Route J-528; WA (United States)


    ...-0749; Airspace Docket No. 11-ANM-29] RIN 2120-AA66 Revocation of Jet Route J-528; WA AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action removes Jet Route J-528... 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Background Jet Route J-528 is currently...

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D K Avasthi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  17. Featuring Old/New Recognition: The Two Faces of the Pseudoword Effect (United States)

    Joordens, Steve; Ozubko, Jason D.; Niewiadomski, Marty W.


    In his analysis of the pseudoword effect, [Greene, R.L. (2004). Recognition memory for pseudowords. "Journal of Memory and Language," 50, 259-267.] suggests nonwords can feel more familiar that words in a recognition context if the orthographic features of the nonword match well with the features of the items presented at study. One possible…

  18. South African Journal of Education - Vol 26, No 2 (2006)

    African Journals Online (AJOL)

    Die ontwikkeling van lees- en speltoetse vir Sesotho-sprekende leerders in die grondslagfase · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marëtte Koen, Karel Esterhuyse, Mohlomi Moleleki, 267-279 ...

  19. A review of typhoid perforation in a rural African hospital ...

    African Journals Online (AJOL)

    Apart from the patients who had resection and primary anastomosis, 95(90.5%) had 2 layered closure of the perforation. The most common complications were wound infections (26.7%). Intra-abdominal abscesses (9.5%) and would dehiscence (7.6%). The mortality rate was 16.2% showing a remarkable improvement in ...

  20. Volumetric studies of some amino acids in binary aqueous solutions ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volumetric studies of some amino acids in binary aqueous solutions of MgCl2.6H2O at 288.15, and 308.15 K. Amalendu Pal Suresh Kumar. Volume 117 Issue 3 May 2005 pp 267-273 ...

  1. Transient expression of fusion gene coding for the HPV-16 epitopes fused to the sequence of potyvirus coat protein using different means of inoculation of Nicotiana benthamiana and Brassica rapa, cv. Rapa plants

    Czech Academy of Sciences Publication Activity Database

    Hoffmeisterová, Hana; Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Kmoníčková, Jitka; Velemínský, Jiří


    Roč. 94, č. 3 (2008), s. 261-267 ISSN 0167-6857 R&D Projects: GA ČR GA521/06/0973 Institutional research plan: CEZ:AV0Z50380511 Keywords : Edible vaccine * epitope expression * E7 oncogen Subject RIV: EE - Microbiology, Virology Impact factor: 1.017, year: 2008

  2. Knowledge and Beliefs about Developmental Dyslexia in Pre-Service and In-Service Spanish-Speaking Teachers (United States)

    Soriano-Ferrer, Manuel; Echegaray-Bengoa, Joyce; Joshi, R. Malathesa


    The present study investigated knowledge, misconceptions, and lack of information about dyslexia among pre-service (PST) and in-service (IST) Spanish-speaking teachers in Spain and Peru. Two hundred and forty-six pre-service teachers and 267 in-service teachers completed the Knowledge and Beliefs about Developmental Dyslexia Scale (KBDDS).…

  3. Risk of multiple myeloma is associated with polymorphisms within telomerase genes and telomere length

    DEFF Research Database (Denmark)

    Campa, Daniele; Martino, Alessandro; Varkonyi, Judit


    Compelling biological and epidemiological evidences point to a key role of genetic variants of the TERT and TERC genes in cancer development. We analyzed the genetic variability of these two gene regions using samples of 2,267 multiple myeloma (MM) cases and 2,796 healthy controls. We found...

  4. Original Research Original Research

    African Journals Online (AJOL)


    rts Research Journal. 2015, 4(4): 58-64. :// ts of Some Species stern Ghats. 577 451, vempu University,. Article Information. Article History: ..... Journal of. Medicinal Plants Research 4(3): 267-270. Johns, T., Duquette, M. (1991). Deficiency of phosphorus in man. The American Journal of Clinical Nutrition ...

  5. The histological significance of atypical glandular cells on cervical ...

    African Journals Online (AJOL)

    with an increased risk of premalignant and invasive lesions.[2,6,7] To our knowledge, there have been no studies published in the English language literature correlating AGC classification with histological diagnosis in South African (SA) patients. Our study may therefore be relevant in the SA context, given that cervical ...

  6. 10. An Overview Of The Aetiologic Agents Of Diarrhoea Diseases In ...

    African Journals Online (AJOL)


    incidence of acute diarrhoea among infants less than. 1 year old was 26.7 ... the intestinal lumen. This usually results from intracellular accumulation of cyclic Adenosine monophosphate (cAMP) or cyclic Guanosine monophosphate which is stimulated by ... celiac disease, tuberculosis, and cancer of the colon has also be ...


    Indian Academy of Sciences (India)


    6H2O at 288⋅15, and. 308⋅15 K. 267. Interactions of ionic and nonionic solutes. Viscometric and thermodynamic studies of interac- tions in ternary solutions containing sucrose and aqueous alkali metal halides at 293⋅15, 303⋅15 and.

  8. Redes vir sportdeelname van hoërskoolleerlinge | Coetzee | South ...

    African Journals Online (AJOL)

    The purpose of this study was to investigate the reasons that motivate high school pupils to participate in sport. Four hundred and seventy eight pupils (211 boys and 267 girls) from four high schools in the Potchefstroom district participated in the study. The Participation Motivation Questionnaire (PMQ) was used.

  9. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Pravin K Gupta. Articles written in Journal of Earth System Science. Volume 115 Issue 3 June 2006 pp 267-276. Fast computation of Hankel Transform using orthonormal exponential approximation of complex kernel function · Pravin K Gupta Sri Niwas Neeta Chaudhary.

  10. Body Image, Self-Esteem, and Health-Related Behaviors among Male and Female First Year College Students (United States)

    Lowery, Sarah E.; Kurpius, Sharon E. Robinson; Befort, Christie; Blanks, Elva Hull; Sollenberger, Sonja; Nicpon, Megan Foley; Huser, Laura


    This study examined the relationships among self-esteem, body image, and health-related behaviors of 267 female and 156 male first-year college students. Data were collected in 23 classrooms. Instruments included a demographic sheet, the Objectified Body Consciousness Scale, the Weight and Appearance Visual Analogue Scales, the Contour Drawing…

  11. Mass spectrometry is a powerful tool for identification of proteins associated with lipid rafts of Jurkat T-cell line

    Czech Academy of Sciences Publication Activity Database

    Pompach, Petr; Man, Petr; Novák, Petr; Havlíček, Vladimír; Fišerová, Anna; Bezouška, Karel


    Roč. 32, - (2004), s. 777-780 ISSN 0300-5127 Institutional research plan: CEZ:AV0Z5020903 Keywords : immune synapse * jurkat t-cell line * membrane Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004

  12. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem


    Oct 6, 2017 ... UNDP-FAO 1966 Etudes des Ressources en Eaux Souter- raines (République Arabe Syrienne); Rapport Final,. FAO/SF: 17/SYR, p. 267. UN-ESCWA and BGR 2013 (United Nations Economic and Social Commission for Western Asia; Bundesanstalt für Geowissenschaften und Rohstoffe) 2013 Inventory of.

  13. the conservation status of eagles in south african law

    African Journals Online (AJOL)


    religions, the use of eagles in heraldry and advertising, and the portrayal of eagles in art and publications. At the other extreme, many people, especially those ...... poaching. However, as noted above,267 in the case of creatures as mobile as eagles, habitat protection, while undoubtedly essential, may on its own not be ...


    African Journals Online (AJOL)


    REFERENCES. 1. Singh D, Worst J, Singh I. Cataract and IOL 1993. 1 ed Amristar st. 1991: 264-267. 2. Pine D. Restoring vision through keratoprosthesis. P&S Journal. 1997; 17(3): 10-11. 3. Pavel JM. 200 years of keratoprosthesis: Pellier de Quengsy and the artificial cornea. Anales del Instituto Barraquer 1999; 28: 33-41.

  15. Here comes the bad news: Doctor robot taking over

    NARCIS (Netherlands)

    Hoorn, J.F.; Winter, S.D.


    To test in how far the Media Equation and Computers Are Social Actors (CASA) validly explain user responses to social robots, we manipulated how a bad health message was framed and the language that was used. In the wake of Experiment 2 of Burgers et al. (Patient Educ Couns 89(2):267–273, 2012.

  16. Regulation of Isoprenoid Pheromone Biosynthesis in Bumblebee Males

    Czech Academy of Sciences Publication Activity Database

    Prchalová, Darina; Buček, Aleš; Brabcová, Jana; Žáček, Petr; Kindl, Jiří; Valterová, Irena; Pichová, Iva


    Roč. 17, č. 3 (2016), s. 260-267 ISSN 1439-4227 R&D Projects: GA MŠk LO1302; GA ČR GA15-06569S Institutional support: RVO:61388963 Keywords : biosynthesis * Bombus spp. * gene expression * isoprenoids * pheromones * transcriptional regulation Subject RIV: CE - Biochemistry Impact factor: 2.847, year: 2016

  17. Composite Repair of Cracked Aluminum Alloy Aircraft Structure (United States)


    report was initiated by a request from the Australian Aeronautical Research Laboratory to conduct a TTCP (The Technical Cooperation Program) round- robin ...1ITE S’PTCH SHAPE SENi ICI RCLE CURE SYSTEM COCURE 350 F 7=57 TYPE SINE TEST LEVEL L0, 00 :TAL RAK LENGTH .267 FAILURE CYCLES FAILURE ryDE BORON AND

  18. Fission product interactions with nitrogen donor ligands used for spent nuclear fuel treatment

    Czech Academy of Sciences Publication Activity Database

    Aneheim, E.; Grüner, Bohumír; Ekberg, C.; Foreman, M.R.S.J.; Hájková, Zuzana; Löfström-Engdahl, E.; Drew, M. G. B.; Hudson, M.J.


    Roč. 50, č. 1 (2013), s. 154-163 ISSN 0277-5387 R&D Projects: GA MŠk(CZ) 7G08073 Grant - others:ACSEPT(XE) FP7-CP-2007-211 267 Institutional support: RVO:61388980 Keywords : BTBP * palladium * complexation * water solubility Subject RIV: CA - Inorganic Chemistry Impact factor: 2.047, year: 2013

  19. Bird watching and estimation of bird diversity – not always ...

    African Journals Online (AJOL)

    Some occurrences of rare or unusual bird species reported by us in a previous paper (Ostrich 86(3): 267–276, 2015) are considered to be doubtful by Hogg and Vande weghe (Ostrich 88(1): 83–88, 2017). We believe that some of the problems raised are taxonomic. The main objective of our study was to obtain reliable ...

  20. Author Index

    Indian Academy of Sciences (India)

    Author Index. Ahmad Farooq see Iqbal Naseer, 373. Ali Syed Salman Study of a Large Helical Eruptive Prominence Associated with. Double CME on 21 April 2001, 347; see Uddin Wahab, 267. Ali, A. Chemistry of Carbon Rich Star IRAS 15194–5115, 399. Ambastha Ashok Photospheric, Chromospheric and Helioseismic ...

  1. Optimisation of Lab-Scale Continuous Alcohol-Free Beer Production

    Czech Academy of Sciences Publication Activity Database

    Lehnert, R.; Novák, Pavel; Macieira, F.; Kuřec, M.; Teixeira, J.A.; Brányik, T.


    Roč. 27, č. 4 (2009), s. 267-275 ISSN 1212-1800 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol-free beer * continuous reactor * immobilised yeast Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.602, year: 2009

  2. The Structure of a Rhodium/Titania Catalyst in the Strong Metal-Support Interaction State as Determined by EXAFS

    NARCIS (Netherlands)

    Koningsberger, D.C.; Martens, J.H.A.; prins, R.; Short, D.R.; Sayers, D.E.


    Reduction of a highly dispersed 2.85 wt % Rh/Ti02 catalyst at 473 K after previous calcination at 623 K resulted in EXAFS whose primary contributions are due to nearest rhodium (average coordination number of 3.1 and distance of 2.67 A) and oxygen neiphbors (coordination 2.5 and distance 2.71 A).

  3. Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

    Czech Academy of Sciences Publication Activity Database

    Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.


    Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

  4. Ethiopian Journal of Environmental Studies & Management 7(3 ...

    African Journals Online (AJOL)



    Apr 2, 2014 ... Ethiopian Journal of Environmental Studies & Management 7(3): 267 – 278, 2014. ISSN:1998-0507 ... 1 Microbial Physiology and Biochemistry Research Unit, Department of Microbiology, University of. Ibadan, Ibadan, Nigeria. 2Division of Microbial ..... Occupational and dietary exposures of humans to ...

  5. New lichen records from Bukovské vrchy Mts (NE Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Pišút, I.; Lackovičová, A.; Guttová, A.; Palice, Zdeněk


    Roč. 42, č. 2 (2007), s. 267-280 ISSN 0001-625X R&D Projects: GA ČR GA206/03/1214 Institutional research plan: CEZ:AV0Z60050516 Keywords : lichen * Carpathians * lichenofloristics Subject RIV: EF - Botanics

  6. Dicty_cDB: Contig-U10738-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available betanus isolate AF... 252 6e-72 DQ381839_1( DQ381839 |pid:none) Tulasnella pruino...R... 267 2e-71 DQ381841_1( DQ381841 |pid:none) Tulasnella violea RNA polymerase I... 246 2e-71 DQ385887_1( D

  7. Case report

    African Journals Online (AJOL)


    16 oct. 2015 ... Nasal leech infestation: report of seven leeches and literature review. Eur Arch. Otorhinolaryngol. 2010 Aug; 267(8): 1225-9. PubMed |. Google Scholar. 4. Hari Uppal C, Vijay Singh Chandel, Lata Chandel R. Extraction of live leech from nasal cavity: an interesting case report from a rural area hospital.


    African Journals Online (AJOL)

    LOCAL ANAESTHESIA. Physiology and Pharmacology oj Local Anesthesia. By R. H. de Jong, M.D. Pp. xiv + 267. Illustrated. $12.50. Spring- field, Ill.: Charles C. Thomas. 1970. This book fills a gap in anaesthetic literature. It is written in lucid style, with ideas logically, if repetitively developed with clear figures and useful ...

  9. Mismatch between ectotherm thermal preferenda and optima for swimming: a test of the evolutionary pace hypothesis

    Czech Academy of Sciences Publication Activity Database

    Gvoždík, Lumír


    Roč. 42, č. 2 (2015), s. 137-145 ISSN 0071-3260 R&D Projects: GA ČR GAP506/10/2170 Institutional support: RVO:68081766 Keywords : Amphibia * Coadaptation * Evolutionary rates * Newts * Preferred body temperatures * Thermal performance curves * Thermal sensitivity Subject RIV: EG - Zoology Impact factor: 2.267, year: 2015

  10. L. Munro 2011-2012 Travel & Hospitality English.xlsx

    International Development Research Centre (IDRC) Digital Library (Canada)


    Quarter 3. October 19. Manchester, UK. Meetings and Lectures. 10,062.48. 2,960.98. 267.50. 13,290.96. November 17 to December 12 New Delhi, India and Harare, Zimbabwe Conference and Regional Office Visit. Quarter 4. February 10. Washington DC, USA. Memorial Service. March 2. Ottawa, Canada. Meeting.

  11. Preliminary estimation of bryophyte biomass and carbon pool from three contrasting different vegetation types

    Czech Academy of Sciences Publication Activity Database

    Singh, M.K.; Juhász, A.; Csintalan, Z.; Kaligaric, M.; Marek, Michal V.; Urban, Otmar; Tuba, Z.


    Roč. 33, č. 1 (2005), s. 267-270 ISSN 0133-3720 Grant - others:EU(CZ) HPRI-CT-2002-00197 Institutional research plan: CEZ:AV0Z60870520 Keywords : bryophyte * carbon pool * rain forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.320, year: 2005

  12. Fiscal Year 2014: Comprehensive Oversight Plan for Southwest Asia (United States)


    391-13-004-P Audit of USAID/Pakistan’s Agribusiness Project (Project: GG100513) 06/12/2013 PK 1010 6-267-13-031-N Audit of the Fund Accountability...Audit of the Program Titled: “USAID Agribusiness Project,” USAID/Pakistan Agreement No. AID-391-A-12-00001, Managed by Agribusiness Support Fund

  13. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav


    Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  14. Genetic diversity in selected stud and commercial herds of the ...

    African Journals Online (AJOL)

    ... as being 2.67 - 7.78, with an average of 5.18 alleles per locus. It could be concluded that a moderate to high degree of variation is still present within the Afrikaner cattle breed, despite the recent decline in numbers of this indigenous breed. Keywords: Bos taurus africanus, heterozygosity, inbreeding, microsatellite markers ...

  15. Volumetric studies of some amino acids in binary aqueous solutions

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volumetric studies of some amino acids in binary aqueous solutions of MgCl2.6H2O at 288.15, and 308.15 K. Amalendu Pal Suresh Kumar. Volume 117 Issue 3 May 2005 pp 267-273 ...

  16. LGBT Adult Immigrants in the United States


    Gates, Gary J.


    There are approximately 267,000 LGBT-identified individuals among the adult undocumented immigrant population and an estimated 637,000 LGBT-identified individuals among the adult documented immigrant population. The report finds that approximately 71 percent of undocumented LGBT adults are Hispanic and 15 percent of undocumented LGBT adults are Asian or Pacific Islander.

  17. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Wheat line CSP44, a selection from an Australian bread wheat cultivar Condor, has shown resistance to stripe rust in India since the last twenty years. Seedlings and adult plants of CSP44 showed susceptible infection types against stripe rust race 46S119 but displayed average terminal disease severity of 2.67 on adult ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 267 ... Vol 4, No 2 (2006), Persavation of Morphine in Opium by Spraying Preservative Chemicals on Capsules and Latex of Opium Poppy (Papaver somniferum L.) cv. Dhawla Chotta, Abstract. MO Obasi, HI Usman. Vol 3, No 1 (2005), Pests and diseases of African yam bean, Sphenostylis stenocarpa ...

  19. Download this PDF file

    African Journals Online (AJOL)


    Planta Medica., 75(9): 994-999. 3. Dagne, E., van Wyk, B.E., Mueller, M., and Steglish, W. (1996). Three dihydroanthracenones from Gasteria bicolor. Phytochem., 41: 795-799. 4. Dold, A.P., and Cocks, M.L. (1999). Preliminary list of Xhosa plant names from Eastern Cape, South Africa. Bothalia., 29: 267-292. 5. Dyubeni, L.

  20. Importance socioculturelle de Artocarpus altilis (Parkinson) Fosberg ...

    African Journals Online (AJOL)


    31 mars 2014 ... conducted to evaluate the economic value of the species and to clarify the parental relationship between the two local forms of ..... arecaceae, an understory palm used for roof thatching in the Peruvian Amazon. Economic. Botany 54 (3), 267–277. Goussanou AC, Tente B, Djègo J, Agbani P, Sinsin B,. 2011.

  1. Numerical modelling of the reinforcing effect of geosynthetic material used in a ballasted railway tracks

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš


    Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010

  2. Strategic Insights. Volume 10, Issue 2, Summer 2011 (United States)


    pilots were injured or killed during the initial takeover , and the operatives had to land the plane themselves.29 Haddad’s personal involvement in... Hawaii with 267 passengers aboard, most of them Japanese. Shortly before landing, the bomb exploded. The passenger sitting in Rashid’s seat died

  3. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Rakshit. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  4. Seasonal and diel patterns of song output by great reed warblers Acrocephalus arundinaceus

    Czech Academy of Sciences Publication Activity Database

    Čapek Jr., Miroslav; Kloubec, B.


    Roč. 57, č. 2 (2002), s. 267-276 ISSN 0006-3088 R&D Projects: GA AV ČR IAC6087702; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : Acrocephalus warblers * seasonal and diel rhythm of song Subject RIV: EG - Zoology Impact factor: 0.169, year: 2002

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    identity. 1. Complex cubic field. A finer classification of the unit sum number of the ring of integers of quadratic fields and complex cubic fields. 267. Congruence equation. On the 2m-th power mean of Dirichlet. L-functions with the weight of trigono- metric sums. 411. Conjugate functions. A new Fenchel dual problem in vector.

  6. Gemeenskapsbetrokkenheid ter bevordering van onderwys in skole

    African Journals Online (AJOL)

    Marks ML 1997. Consulting in mergers and acquisitions. Journal of Organisational. Change Management, 10:267-279. National Plan for Higher Education (NPHE) 2001. Pretoria: Ministry of Education. O'Flaherty C & Conway N 1990. Merging icebergs. Marketing Mix, 8:24-26. Pereira P 1999. Winds of change blow Asmal's ...

  7. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Mahlburg's Work on Crank Functions - Ramanujan's Partitions Revisited · Nagesh Juluru Arni S R Srinivasa Rao · More Details Fulltext PDF. pp 244-256 Classroom. Optimization of the Anderson Bridge Experiment · P Arun Kuldeep Kumar Mamta · More Details Fulltext PDF. pp 257-267 Classroom. Chaos from Jerk Circuit.

  8. The impact of HIV infection on maternal deaths in South Africa ...

    African Journals Online (AJOL)

    Tuberculosis (26.9%), community-acquired pneumonia (26.7%) and pneumocystis pneumonia (13.3%), and cryptococcal meningitis (4.2%) and other meningitis (8.7%) were the main underlying causes of death in the NPRI group, of which 87.4% were HIV positive. Complications of highly active antiretroviral therapy ...

  9. 76 FR 12367 - Proposed Information Collection; Visibility Valuation Survey Pilot Study (United States)


    ... before May 6, 2011. ADDRESSES: Direct all written comments on this IC to Dr. Bruce Peacock, Chief, Social... Collins, CO 80525-5596 (mail); Bruce[email protected] (e-mail); or 970-267-2106 (phone). FOR FURTHER... a pilot study to test the survey instrument and implementation procedures prior to the full survey...

  10. Au implantation into various types of silicate glasses

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Macková, Anna; Bočan, Jiří; Švecová, B.; Nekvindová, P.


    Roč. 267, - (2009), s. 1575-1578 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : Au+ ion implantation * Glass es * RBS Depth profiling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  11. South African Medical Journal - Vol 106, No 3 (2016)

    African Journals Online (AJOL)

    Breast cancer in high-risk Afrikaner families: Is BRCA founder mutation testing sufficient? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HJ Seymour, T Wainstein, S Macaulay, T Haw, A Krause, 264-267. ...

  12. Pesticide exposures in a malarious and predominantly farming area ...

    African Journals Online (AJOL)

    Frequent symptoms that were reported after spraying, included cough (32.3%; 336/1040), difficulty in breathing (26.7%; 278/1040) and skin irritation (39.0%; 406/1040). Pesticide use among community members in the Kintampo area of Ghana is common and its potential health impacts warrant further investigation.

  13. Research

    African Journals Online (AJOL)



    Jan 27, 2016 ... obesity, hypertension and diabetes in urban and rural. Cameroon. International Journal Of Obesity. 2002; 26(7):. 1009-116. PubMed | Google Scholar. 13. Akintunde AA, Ayodele OE, Akinwusi PO, Opadijo GO. Metabolic syndrome: comparison of occurrence using three definitions in hypertensive patients.

  14. Effect of tandospirone, a serotonin-1A receptor partial agonist, on information processing and locomotion in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Horáček, J.; Sumiyoshi, T.


    Roč. 212, č. 2 (2010), s. 267-276 ISSN 0033-3158 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : Tandospirone * Schizophrenia * NMDA receptor Subject RIV: FH - Neurology Impact factor: 3.817, year: 2010

  15. Adigun and Olorunfemi (6)

    African Journals Online (AJOL)


    agriculture, industries and domestic needs depend upon the availability of water resources. (Awomeso et al., 2010). ... from agricultural farmland and industries have contributed immensely to water pollution when contaminants ...... Geneva, Switzerland, WHO, pp. 9. 267. Adigun and Olorunfemi: Integrated Geophysical and ...

  16. Prediction of Peaks in Wolf Numbers in Cycle 24 according to Actual ...

    Indian Academy of Sciences (India)

    However, the meaning of these results is relatively restricted as both phenomena (PF and SP) wax and wane with the same period and roughly in a similar .... Makarov, V. 2002, Private communication. Makarov, V. I., Makarova, V. V. 1996, Solar Phys., 163, 267. Makarov, V. I., Makarova, V. V., Callebaut, D. K. 2008, Solar ...

  17. Oxidative stress elicited by insecticides: A role for the adipokinetic hormnone

    Czech Academy of Sciences Publication Activity Database

    Velki, M.; Kodrík, Dalibor; Večeřa, Josef; Hackenberger, B. K.; Socha, Radomír


    Roč. 172, č. 1 (2011), s. 77-84 ISSN 0016-6480 R&D Projects: GA ČR GAP501/10/1215 Institutional research plan: CEZ:AV0Z50070508 Keywords : Insect * adipokinetic hormone * oxidative stress Subject RIV: ED - Physiology Impact factor: 3.267, year: 2011

  18. Correct Interpretation of Creep Rates: A Case Study of Cu

    Czech Academy of Sciences Publication Activity Database

    Blum, W.; Dvořák, Jiří; Král, Petr; Eisenlohr, P.; Sklenička, V.


    Roč. 31, č. 11 (2015), s. 1065-1068 ISSN 1005-0302 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Cu * Creep * Minimum creep rate * Activation energy * Stress exponent Subject RIV: JJ - Other Materials Impact factor: 2.267, year: 2015

  19. On p dependent boundedness of singular integral operators

    Czech Academy of Sciences Publication Activity Database

    Honzík, Petr


    Roč. 267, 3-4 (2011), s. 931-937 ISSN 0025-5874 Institutional research plan: CEZ:AV0Z10190503 Keywords : singular integral operators Subject RIV: BA - General Mathematics Impact factor: 0.749, year: 2011

  20. 75 FR 71183 - 23rd Meeting: RTCA Special Committee 206: EUROCAE WG 76 Plenary: AIS and MET Data Link Services (United States)


    ... operating picture for evolving global ATM concepts. The AIS and MET Services Delivery Architecture... System Performance Standards (MASPS) for Flight Information Services-Broadcast (FIS-B) Data Link, RTCA DO-267A, revision and an AIS and MET Data Link MASPS, that defines the system-level requirements to...

  1. Comparative Study of the Spherical Downward Continuation

    Czech Academy of Sciences Publication Activity Database

    Sebera, Josef; Pitoňák, M.; Hamáčková, E.; Novák, P.


    Roč. 36, č. 2 (2015), s. 253-267 ISSN 0169-3298 Grant - others:GA MŠk(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985815 Keywords : limited airborne gravity * potential-field data * horizontal plane Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.622, year: 2015

  2. In Vitro Digestibility of Aluminum from Hibiscus sabdariffa Hot Watery Infusion and Its Concentration in Urine of Healthy Individuals

    Czech Academy of Sciences Publication Activity Database

    Frankova, A.; Malik, J.; Drabek, O.; Szakova, J.; Sperlingova, I.; Kloucek, P.; Novy, P.; Tejnecky, V.; Landa, Přemysl; Leuner, O.; Kokoska, L.


    Roč. 174, č. 2 (2016), s. 267-273 ISSN 0163-4984 Institutional support: RVO:61389030 Keywords : dialysis dementia * tea * bioavailability * speciation * toxicity * Aluminum * In vitro digestion * Hot watery infusion * Urine * Hibiscus sabdariffa L Subject RIV: EF - Botanics Impact factor: 2.399, year: 2016

  3. 10. An Overview Of The Aetiologic Agents Of Diarrhoea Diseases In ...

    African Journals Online (AJOL)


    incidence of acute diarrhoea among infants less than. 1 year old was 26.7 cases per 1,000 children per. 6 month. ... celiac disease, tuberculosis, and cancer of the colon has also be implicated. Other pathophysiologic ... and food contamination with faecal materials, poor food storage techniques, poor hand hygiene in both.


    Indian Academy of Sciences (India)

    An electromagnetic calorimeter for the silicon detector concept. 1025. Investigations into properties of charge traps created in CCDs by neutron and electron irradiation. 1093. Breidenbach M see Brau J E. 1025. Brill Dieter. Horizons in 2+1-dimensional collapse of particles. 109. Budhani R C see Senapati K. 267. Buesser K.

  5. Analgesic synergism of gabapentin and carbamazepine in rat model ...

    African Journals Online (AJOL)

    REFERENCES. 1. Deli G, Bosnyak E, Pusch G, Komoly S, Feher G. Diabetic neuropathies: diagnosis and management. Neuroendocrinology 2014; 98(4): 267-280. 2. Franklin GM, Kahn LB, Baxter J, Marshall JA, HAMMAN. RF. Sensory neuropathy in non-insulin-dependent diabetes mellitus The San Luis Valley Diabetes ...

  6. Fungal community on decomposing leaf litter undergoes rapid successional changes

    Czech Academy of Sciences Publication Activity Database

    Voříšková, Jana; Baldrian, Petr


    Roč. 7, č. 3 (2013), s. 477-486 ISSN 1751-7362 R&D Projects: GA MŠk(CZ) ME10152; GA MŠk LD12050; GA ČR GAP504/12/0709 Institutional support: RVO:61388971 Keywords : fungi * litter decomposition * cellulose Subject RIV: EE - Microbiology, Virology Impact factor: 9.267, year: 2013

  7. La-Zn substituted hexaferrites prepared by chemical method

    Czech Academy of Sciences Publication Activity Database

    Grusková, A.; Lipka, J.; Papánová, M.; Sláma, J.; Tóth, J.; Kevická, D.; Mendoza, G.; Corral, J.C.; Šubrt, Jan


    Roč. 164, 1-4 (2006), s. 27-33 ISSN 0304-3843 Grant - others:VEGA(SK) G-1/3096/06; CONACYT(MX) J28283U Institutional research plan: CEZ:AV0Z40320502 Keywords : ferrites-hexagonal * magnetic recording * Mossbauer effect Subject RIV: CA - Inorganic Chemistry Impact factor: 0.267, year: 2006

  8. Wet effluent diffusion denuder: The tool for determination of monoterpenes in forest

    Czech Academy of Sciences Publication Activity Database

    Křůmal, Kamil; Mikuška, Pavel; Večeřová, Kristýna; Urban, Otmar; Pallozzi, E.; Večeřa, Zbyněk


    Roč. 153, JUN (2016), s. 260-267 ISSN 0039-9140 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:68081715 ; RVO:67179843 Keywords : diffusion denuder * monoterpene * biogenic volatile organic compounds * tenax tubes Subject RIV: CB - Analytical Chemistry , Separation; EH - Ecology, Behaviour (UEK-B) Impact factor: 4.162, year: 2016

  9. Pattern of presentation and management of patients with ...

    African Journals Online (AJOL)

    43.3%), hypospadias in 2 (6.7%) and a hydrocele in 1 (3.3%). The UDT was detected by the parents in 13 cases (43.3%), by the patient himself in 9 (30%) and by health care staff in 8 cases (26.7%). Only 10 parents (33.3%) received advice from ...

  10. The Sphecidae (Hym

    African Journals Online (AJOL)


    Lourenço WR, Cloudsley-Thompson JL & Cuellar O (2000) A review of parthenogenesis in scorpions with a description postembryonic development in Tityus metuendus (Scorpiones, Buthidae) from Western. Amazonia. Zoologischer Anzeiger 239: 267-276. Lourenço WR, Cloudsley-Thompson JL, Cuellar O, Von Eickstedt ...

  11. Kasim A Korkmaz

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Kasim A Korkmaz. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 267-280. Uncertainty modelling of critical column buckling for reinforced concrete buildings · Kasim A Korkmaz Fuat Demir Hamide Tekeli · More Details Abstract Fulltext PDF. Buckling is a critical issue for structural ...

  12. Kohakaasluskorras töötamise tingimuste määrustik

    Index Scriptorium Estoniae


    Lisatud tööde loetelu, mida ei peeta kohakaasluseks. Vene keeles: В помощь профсоюзному активисту 1989 nr. 3, lk. 9-14. Selgitused vt. Nõukogude Õigus 1989 nr. 4, lk. 267-268

  13. 76 FR 56053 - 2011-2012 Refuge-Specific Hunting and Sport Fishing Regulations (United States)


    ... shooting time until 1 p.m. We require a refuge hunt permit (signed brochure), a State-approved hunter... different. Bird shot has a different trajectory and much less mass than a rifled slug or bullet and would... hunting activities (2.67) derived from the report ``Economic Importance of Hunting in America'' yields a...

  14. Cosmopolites sordidus Germar

    African Journals Online (AJOL)


    (Germar) (Coleoptera: Curculionidae), in Ugandan Musa germplasm. Euphytica 133:267-277. Kiggundu, A. 2000. Host plant reactions and resistance mechanisms to banana weevil, Cosmopolites sordidus. (Germar) in Ugandan Musa germplasm. Msc.Thesis. University of the Orange Free Stae, Bloemfontain,. South Africa.

  15. Smokeless Tobacco Use among Ontario Students. (United States)

    Adlaf, Edward M.; Smart, Reginald G.


    Estimated use and characteristics of users of smokeless tobacco among probability sample of 4,267 Ontario (Canada) teenagers. Results indicated that smokeless tobacco use was not common, varying from one to three percent depending on age and gender, but was more likely to occur among smokers (10% to 32%). Group most prone to use was young smoking…

  16. File list: ALL.Dig.20.AllAg.Caco-2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Dig.20.AllAg.Caco-2 hg19 All antigens Digestive tract Caco-2 SRX026263,SRX08035...267,SRX026265,SRX190019,SRX080354,SRX189989,SRX026266,SRX189986 ...

  17. Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo


    Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. unusually high prevalence of asymptomatic bacteriuria among male

    African Journals Online (AJOL)


    The two most prevalent organisms reported in this study were Micrococcus luteus (40%) and Micrococcus ... urethritis due to gonorrhoeal infections, homosexuality, and lack of circumcision (6, 7, 8, 9). Reports from a previous work conducted on the same population of Redeemer's University students showed a 26.7% ...

  19. Investigating Unique Environmental Influences of Parenting Practices on Youth Anxiety: A Monozygotic Twin Differences Study (United States)

    Chen, Jie; Yu, Jing; Zhang, Jianxin


    The associations between parenting practices and adolescent anxiety symptoms were examined in both individual and monozygotic (MZ) twin differences levels. Participants were 804 pairs of Chinese MZ adolescent twins aged 10-18 years (M = 13.57, SD = 2.67, 52% females). Twins' anxiety symptoms were assessed by self- and parent-reports. Twins also…

  20. Protective cytokinin action switches to damaging during senescence of detached wheat leaves in continuous light

    Czech Academy of Sciences Publication Activity Database

    Vlčková, A.; Špundová, M.; Kotabová, E.; Novotný, R.; Doležal, Karel; Nauš, J.


    Roč. 126, č. 2 (2006), s. 257-267 ISSN 0031-9317 R&D Projects: GA AV ČR IBS4055304 Grant - others:FRVŠ MŠk FRVŠ 3190/2005 Institutional research plan: CEZ:AV0Z50380511 Keywords : senescence * cytokinin * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 2.169, year: 2006

  1. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.


    Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  2. Possible Suppression of Magnetorotational Instability by Rapid Radial Flow

    Czech Academy of Sciences Publication Activity Database

    Abramowicz, M. A.; Horák, Jiří; Kluzniak, W.


    Roč. 63, č. 2 (2013), s. 267-273 ISSN 0001-5237 R&D Projects: GA ČR(CZ) GAP209/11/2004 Institutional support: RVO:67985815 Keywords : accretion disks * magnetohydrodynamics * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.955, year: 2013

  3. Hydrodesulfurization Activities of NiMo Catalysts Supported on Mechanochemically Prepared Al‐Ce Mixed Oxides.

    Czech Academy of Sciences Publication Activity Database

    Jirátová, Květa; Spojakina, A.; Kaluža, Luděk; Palcheva, R.; Balabánová, Jana; Tyuliev, G.


    Roč. 37, č. 2 (2016), s. 258-267 ISSN 0253-9837 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : nickel * molybdenum * alumina Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.813, year: 2016

  4. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. G Nandakumar. Articles written in Journal of Earth System Science. Volume 113 Issue 3 September 2004 pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, ...

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 267 ... Vol 1, No 2 (2003), Qualitative and Quantitative Evaluation of Multi-source Piroxicam Capsules Available in Nigeria, Abstract. PO Osadebe, CO Esimone. Vol 7, No 1 (2009), Quantitative difference method for estimation of fertilizer nitrogen balance and uptake by zea mays on an orthic oxisol of North ...

  6. Additivity of the Stabilization Effect of Single Amino Acid Substitutions in Triple Mutants of Recombinant Formate Dehydrogenase from the Soybean Glycine max. (United States)

    Alekseeva, A A; Kargov, I S; Kleimenov, S Yu; Savin, S S; Tishkov, V I


    Recently, we demonstrated that the amino acid substitutions Ala267Met and Ala267Met/Ile272Val (Alekseeva et al., Biochemistry, 2012), Phe290Asp, Phe290Asn and Phe290Ser (Alekseeva et al., Prot. Eng. Des. Select, 2012) in recombinant formate dehydrogenase from soya Glycine max (SoyFDH) lead to a significant (up to 30-100 times) increase in the thermal stability of the enzyme. The substitutions Phe290Asp, Phe290Asn and Phe290Ser were introduced into double mutant SoyFDH Ala267Met/Ile272Val by site-directed mutagenesis. Combinations of three substitutions did not lead to a noticeable change in the catalytic properties of the mutant enzymes. The stability of the resultant triple mutants was studied through thermal inactivation kinetics and differential scanning calorimetry. The thermal stability of the new mutant SoyFDHs was shown to be much higher than that of their precursors. The stability of the best mutant SoyFDH Ala267Met/Ile272Val/Phe290Asp turned out to be comparable to that of the most stable wild-type formate dehydrogenases from other sources. The results obtained with both methods indicate a great synergistic contribution of individual amino acid substitutions to the common stabilization effect.

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 267 ... Vol 7, No 2 (2009), Cissus rotundifolia soup meal - it's physiological effect on the postprandial plasma blood glucose and insulin levels of healthy non diabetic .... Vol 8, No 2 (2010), Effect of Root Extracts of Lantana camara (Verbenaceae) on Larvae of Aedes aegypti (Diptera: Culicidae), Abstract.

  8. Some unique activities of the smallest reactor : UTR-KINKI

    International Nuclear Information System (INIS)

    Shibata, Toshikazu


    In the UTR-KINKI, school teaches trainings are being done, besides utilizations for research and student experiments. In this paper, some details of the school teachers training course are presented. 267 teachers have attended the training since 1987, the beginning of the program. Drastic impacts by the training were recognized in impressions of the attended teachers about nuclear energy. (author)

  9. Vlijanije glutamata na processy spontannoj sekreciji acetilcholina v nervno-myšečnom sinapse krysy

    Czech Academy of Sciences Publication Activity Database

    Malamough, A. I.; Mukhtarov, M. R.; Urazaev, A. K.; Nikolsky, E. E.; Vyskočil, František


    Roč. 87, č. 4 (2001), s. 492-498 ISSN 0869-8139 R&D Projects: GA MŠk OK 267 Institutional research plan: CEZ:AV0Z5011922 Keywords : glutamate * neuromuscular junction * quantal release Subject RIV: ED - Physiology

  10. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

    Czech Academy of Sciences Publication Activity Database

    Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta


    Roč. 69, č. 4 (2004), s. 267-272 ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak-point pressure Subject RIV: FK - Gynaecology, Childbirth

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Zeynab Khosravinia. Articles written in Sadhana. Volume 39 Issue 2 April 2014 pp 267-281. A new colour constancy algorithm based on automatic determination of gray framework parameters using neural network · Mohammad Mehdi Faghih Zeynab Khosravinia Mohsen Ebrahimi Moghaddam.


    Indian Academy of Sciences (India)

    255. Diurnal variability of upper ocean temperature and heat budget in the southern Bay of Bengal during October--. November, 1998 (BOBMEX-Pilot). 267. Controls of dimethyl sulphide in the Bay of Bengal during BOBMEX-Pilot cruise 1998. 279. Bio-physical model. 4D-Var data assimilation system for a coupled physical-.

  13. Slow-neutron-induced charged-particle emission-channeling-measurements with Medipix detectors

    Czech Academy of Sciences Publication Activity Database

    Koster, U.; Granja, C.; Jakubek, J.; Uher, J.; Vacík, Jiří


    Roč. 633, č. 1 (2011), S267-S269 ISSN 0168-9002. [11th International Workshop on Radiation Imaging Detectors. Praha, 28.06.2009-02.07.2009] Institutional research plan: CEZ:AV0Z10480505 Keywords : Emission channeling * Neutron induced reaction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.207, year: 2011

  14. F-18 Interior Lighting Analysis: Red versus White (United States)


    Sealed Cabins for Space and Orbital Flights. TEDNAM RE-i403, 22 July 1960. Cavonius, C.R. and Hilz, R. Visual performance after Preadaptation to Colored...261-267, 1945. -18- NADC-761 77-40 Hulbert, EDO . Time of Dark Adaptation after Stimulation by Various Bright- nesses and Colors. J.Q.S.A. 1951. Intano

  15. An improvement of dimension-free Sobolev imbeddings in r spaces

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, A.; Krbec, Miroslav; Schmeisser, H.-J.


    Roč. 267, č. 1 (2014), s. 243-261 ISSN 0022-1236 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : imbedding theorem * small Lebesgue space * rearrangement-invariant Banach Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014

  16. Heat stress impairs repeated jump ability after competitive elite soccer games

    DEFF Research Database (Denmark)

    Mohr, Magni; Krustrup, Peter


    ABSTRACT:: The present study examined the effect of environmental heat stress on repeated jump performance after elite competitive soccer games. Male elite soccer players (n=19) from two Scandinavian teams participated (age; 26.7±1.0 yrs, height; 181.7±1.1 cm, body mass; 75.8±1.0 kg). The players...

  17. An Assessment of Publication Productivity in Career Development and Transition for Exceptional Individuals: 1978-2012 (United States)

    Unger, Darlene D.; Rumrill, Phillip D., Jr.


    This literature review examined publication patterns in the journal of "Career Development and Transition for Exceptional Individuals" across 35 years of publication. Overall, 732 contributors affiliated with 267 organizations were identified in our analysis of 436 articles. Frequency counts identified the most productive scholars in…

  18. A Longitudinal Examination of Risky Sexual Behaviors among Canadian and Italian Adolescents: Considering Individual, Parental, and Friend Characteristics (United States)

    Boislard P., Marie-Aude; Poulin, Francois; Kiesner, Jeff; Dishion, Thomas J.


    In this study, two longitudinal models of early adolescent risky sexual behaviors (RSB) were compared using a pooled sample of 267 Canadian and Italian adolescents (55% females; 53% Canadians) assessed yearly from grade 8 to 10. We focused on parenting practices (monitoring, control, limit setting), adolescent problem behaviors (antisocial…

  19. Formulation of Sodium Alginate Nanospheres Containing ...

    African Journals Online (AJOL)

    Patrick Erah

    Pharmacology. 1995; 27: 171. 15. Davison CJ, Smith KE, Hutchinson L, Mullane JE,. Brookman JE, Patrak K and Hardings SE. Physical and biological properties of water soluble polyelectrolyte complexes, Journal of Bioactive. Compatable Polymer. 1990; 5: 267-282. 16. Korsmeyer RW, Gurny R, Doelkar E, Buri P and.

  20. The Calan-Yale Deep Extragalactic Research (CYDER) Survey: Optical Properties and Deep Spectroscopy of Extragalactic Serendipitous X-Ray Sources

    NARCIS (Netherlands)

    Coppi, P.S.; Treister, E.; Castander, F.J.; Maccarone, T.J.; Gawiser, E.; Maza, J.; Herrera, D.; Urry, C.M.; Gonzalez, V.; Montoya, C.; Pineda, P.


    We present the results of deep optical imaging and spectroscopy of archival Chandra sources with intermediate fluxes (>1e-15 erg/cm2/sec). 267 Chandra sources were detected in 5 archival fields, with 106 spectroscopic IDs obtained using Magellan and the VLT. The survey is designed to fill the gap

  1. Dinesh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Dinesh. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 267-272 Superconductors. Specific heat studies in Ho–Ba–CuO superconductors: Fermionic and bosonic contributions · Dinesh Varshney Sanjay Shah R K Singh · More Details Abstract ...

  2. Voltammetry on Mercury and Carbon Electrodes as a Tool for Studies of Metallothionein Interactions with Metal Ions

    Czech Academy of Sciences Publication Activity Database

    Šestáková, Ivana; Mader, P.


    Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000

  3. Solar disinfection of drinking water in the prevention of dysentery in South African children under 5 years: the role of participant motivation

    CSIR Research Space (South Africa)

    Du Preez, M


    Full Text Available Africa.Wecompared 383 children in 297 households using SODIS with 335 children in 267 households with no intervention. At baseline 62.4% of the study households had stored water which met WorldHealth Organization guidelines for zero thermotolerant...

  4. Ion-beam induced chemical and structural modification in polymers

    Czech Academy of Sciences Publication Activity Database

    Guenther, M.; Gerlach, G.; Suchaneck, G.; Sahre, K.; Eichorn, K. J.; Wolf, B.; Deineka, Alexander; Jastrabík, Lubomír

    158-159, - (2002), s. 108-113 ISSN 0257-8972 Grant - others:Ge(DE) 779/6-1 Institutional research plan: CEZ:AV0Z1010914 Keywords : polyimide * polyethersulfone- hardness * conductivity * polymer structure * ion implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.267, year: 2002

  5. EST Table: FY016256 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY016256 rbmov16f06 11/11/04 40 %/267 aa ref|XP_001651177.1| eukariotic translation... initiation factor 2b, epsilon subunit [Aedes aegypti] gb|EAT42872.1| eukariotic translation initiation fact

  6. Survey of Knowledge, Attitudes and Sexual Practices Relating to ...

    African Journals Online (AJOL)

    Of the 120 students (26.7%) who became sexually active a month before the survey, 34 (28.3%) had multiple sexual partners. Constituent condom use was reported in only 22 (19.8%) of the sexually active students. The use of unreliable methods for the prevention of sexually transmitted diseases was common. There is an ...

  7. 30~kb~sp•.~kjngs ,.130016. R~~j~ws

    African Journals Online (AJOL)

    Z-plan, 'n grootskaalse aanbouprogram. (p. 267) was op 9 Februarie 1939 goedgekeur en sou eers in 1944 ... v!ootvoog, Adm. Marshall, lei (p. 114 e.v.) en met laasgenoemde vervanging deur Vise-. Adm Gunther ... die plan se uitvoering is deur Hitler willens en wetens uitgestel omdat hy uiteindelik ge- reken het dat die ...

  8. Evolutionary stability of optimal foraging: Partial preferences in the diet and patch models

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil


    Roč. 267, č. 4 (2010), s. 486-494 ISSN 0022-5193 Grant - others:The University of Tennessee(US) EF-0832858 Institutional research plan: CEZ:AV0Z50070508 Keywords : evolutionarily stable strategy * game theory * ideal free distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.371, year: 2010

  9. Impact of daily consumption of Moringa ( Moringa oleifera ) dry leaf ...

    African Journals Online (AJOL)

    A randomized study was conducted to test the efficacy of Moringa powder on iron status and weight gain in women. In an open-labelled randomized trial, 82 moderately anaemic, lactating women, aged 26.7 6.5 years, received a weekly dose of either 100g of Moringa powder(Moringa group) or 120 mg iron sulphate with ...

  10. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. P. V. Ramchander. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma.

  11. The Health of University Athletes: Attitudes, Behaviors, and Stressors. (United States)

    Selby, Rosemary; And Others


    This study surveyed 267 university athletes to identify sources of stress for student athletes and sex differences among athletes with respect to health-related behaviors and attitudes. Specific recommendations based on the findings are made for health professionals who work with college athletes. (IAH)

  12. Patterns of Environmental Preference (United States)

    Kaplan, Rachel


    This study sought to evaluate components of the Environmental Preference Questionnaire (EPQ). The 267 teenagers who completed the EPQ in this study also responded to questions relating to facets of self esteem and the reasons for selecting their favorite activities. (BT)

  13. Data of evolutionary structure change: 1APXA-6CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-6CCPA 1APX 6CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...ine>PRO CA 323 PRO CA 267 GLU CA 263 6CCP... A 6CCPA RVDTPEDTTPDN ...ex> 6CCP A 6CCPA YED...389602661133 3.6602940559387207 2 6CCP

  14. Data of evolutionary structure change: 1APXA-5CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-5CCPA 1APX 5CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...ine>PRO CA 323 PRO CA 267 GLU CA 263 5CCP... A 5CCPA RVDTPEDTTPDN ...ex> 5CCP A 5CCPA YED...4090881347656 3.6460940837860107 2 5CCP

  15. Data of evolutionary structure change: 1APXA-7CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-7CCPA 1APX 7CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...e> PRO CA 323 PRO CA 267 GLU CA 263 7CCP... A 7CCPA RVDTPEDTTPDN 7CCP A 7CCPA Y...34991455078 3.6459429264068604 2 7CCP

  16. Gender and Psychiatric Morbidity at First Contact in General Practice ...

    African Journals Online (AJOL)

    Background: Gender is a predictor of prevalence of psychiatric morbidity. The present study was to examine gender difference, prevalence and pattern of psychiatric morbidity among attendees of a general outpatient clinic in a tertiary hospital in sokoto, Nigeria. Methods: A total of 267,000 patients attended the general ...

  17. Provenance of Neoproterozoic to upper Cretaceous sedimentary rocks, eastern Greenland: Implications for recognizing the sources of sediments in the Norwegian Sea

    Czech Academy of Sciences Publication Activity Database

    Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.


    Roč. 238, 3/4 (2011), s. 254-267 ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011

  18. Distribuce uranu a thoria v širším okolí Temelína

    Czech Academy of Sciences Publication Activity Database

    René, Miloš


    Roč. 10, - (2002), s. 264-267 ISSN 1211-0329 R&D Projects: GA MŠk ME 555 Institutional research plan: CEZ:AV0Z3046908 Keywords : paragneiss * granitoids * Moldanubian Zone Subject RIV: DB - Geology ; Mineralogy

  19. Peer Deviancy Training and Peer Coercion: Dual Processes Associated with Early-Onset Conduct Problems (United States)

    Snyder, James; Schrepferman, Lynn; McEachern, Amber; Barner, Stacy; Johnson, Kassy; Provines, Jessica


    The prospective relationships of conduct problems and peer coercion and deviancy training during kindergarten (mean age = 5.3 years) to overt and covert conduct problems in third-fourth grade were examined in a sample of 267 boys and girls. Coercion and deviancy training were distinct peer processes. Both were associated with earlier child conduct…

  20. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    NARCIS (Netherlands)

    Gretarsdottir, Solveig; Baas, Annette F.; Thorleifsson, Gudmar; Holm, Hilma; den Heijer, Martin; de Vries, Jean-Paul P. M.; Kranendonk, Steef E.; Zeebregts, Clark J. A. M.; van Sterkenburg, Steven M.; Geelkerken, Robert H.; van Rij, Andre M.; Williams, Michael J. A.; Boll, Albert P. M.; Kostic, Jelena P.; Jonasdottir, Adalbjorg; Jonasdottir, Aslaug; Walters, G. Bragi; Masson, Gisli; Sulem, Patrick; Saemundsdottir, Jona; Mouy, Magali; Magnusson, Kristinn P.; Tromp, Gerard; Elmore, James R.; Sakalihasan, Natzi; Limet, Raymond; Defraigne, Jean-Olivier; Ferrell, Robert E.; Ronkainen, Antti; Ruigrok, Ynte M.; Wijmenga, Cisca; Grobbee, Diederick E.; Shah, Svati H.; Granger, Christopher B.; Quyyumi, Arshed A.; Vaccarino, Viola; Patel, Riyaz S.; Zafari, A. Maziar; Levey, Allan I.; Austin, Harland; Girelli, Domenico; Pignatti, Pier Franco; Olivieri, Oliviero; Martinelli, Nicola; Malerba, Giovanni; Trabetti, Elisabetta; Becker, Lewis C.; Becker, Diane M.; Reilly, Muredach P.; Rader, Daniel J.; Mueller, Thomas; Dieplinger, Benjamin; Haltmayer, Meinhard; Urbonavicius, Sigitas; Lindblad, Bengt; Gottsater, Anders; Gaetani, Eleonora; Pola, Roberto; Wells, Philip; Rodger, Marc; Forgie, Melissa; Langlois, Nicole; Corral, Javier; Vicente, Vicente; Fontcuberta, Jordi; Espana, Francisco; Grarup, Niels; Jorgensen, Torben; Witte, Daniel R.; Hansen, Torben; Pedersen, Oluf; Aben, Katja K.; de Graaf, Jacqueline; Holewijn, Suzanne; Folkersen, Lasse; Franco-Cereceda, Anders; Eriksson, Per; Collier, David A.; Stefansson, Hreinn; Steinthorsdottir, Valgerdur; Rafnar, Thorunn; Valdimarsson, Einar M.; Magnadottir, Hulda B.; Sveinbjornsdottir, Sigurlaug; Olafsson, Isleifur; Magnusson, Magnus Karl; Palmason, Robert; Haraldsdottir, Vilhelmina; Andersen, Karl; Onundarson, Pall T.; Thorgeirsson, Gudmundur; Kiemeney, Lambertus A.; Powell, Janet T.; Carey, David J.; Kuivaniemi, Helena; Lindholt, Jes S.; Jones, Gregory T.; Kong, Augustine; Blankensteijn, Jan D.; Matthiasson, Stefan E.; Thorsteinsdottir, Unnur; Stefansson, Kari

    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to

  1. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    DEFF Research Database (Denmark)

    Gretarsdottir, Solveig; Baas, Annette F; Thorleifsson, Gudmar


    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to as...

  2. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.


    Roč. 16, č. 2 (2010), s. 267-276 ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  3. 19 CFR 12.142 - Entry of softwood lumber and softwood lumber products from any country into the United States. (United States)


    ...” means: (1) A person bears a relationship to such other person described in section 152(a) of the Internal Revenue Code of 1986; (2) A person bears a relationship to such person described in section 267(b.... The term “tenure rights” means rights to harvest timber from public land granted by the country of...

  4. Radiolysis of C5-BTBP in cyclohexanone irradiated in the absence and presence of an aqueous phase

    Czech Academy of Sciences Publication Activity Database

    Fermvik, A.; Aneheim, E.; Grüner, Bohumír; Hájková, Zuzana; Kvíčalová, Magdalena; Ekberg, C.


    Roč. 100, č. 4 (2012), s. 273-282 ISSN 0033-8230 Grant - others:ACSEPT(XE) FP7-CP-2007-211 267 Institutional research plan: CEZ:AV0Z40320502 Keywords : radiolysis * degradation product * solvent extraction * partitioning * BTBP Subject RIV: CA - Inorganic Chemistry Impact factor: 1.373, year: 2012

  5. 78 FR 16496 - Public Service Company of Colorado; Notice Revising Precedural Schedule (United States)


    ... Energy Regulatory Commission Public Service Company of Colorado; Notice Revising Precedural Schedule On... the Public Service Company of Colorado's Cabin Creek Pumped Storage Project No. 2351, located on the... currently licensed, is located on 267 acres of U.S. Forest Service lands within the Arapahoe National Forest...

  6. N L Singh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N L Singh. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  7. Why is the number of days required for induction of adult diapause in the linden bug Pyrrhocoris apterus fewer in the larval than in the adult stage?

    Czech Academy of Sciences Publication Activity Database

    Hodková, Magdalena


    Roč. 77, JUN 01 (2015), s. 39-44 ISSN 0022-1910 R&D Projects: GA ČR GAP502/10/1612 Institutional support: RVO:60077344 Keywords : diapause * reproduction * diapuase information Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015

  8. PH Regulation by Breast Cancer Cells In Vitro and In Vivo

    National Research Council Canada - National Science Library

    Gillies, Robert


    ...) and inorganic phosphate (Pi) (Gillies et al., 1994, Am J Physiol 267, C195-C203). However, this method is limited to measuring average tumor pHe, and was not capable of reporting the pH range or localized values...

  9. Discovery of a transient U-band dropout in a Lyman break survey : A tidally disrupted star at z=3.3?

    NARCIS (Netherlands)

    Stern, D; van Dokkum, PG; Nugent, P; Sand, DJ; Ellis, RS; Sullivan, M; Bloom, JS; Frail, DA; Kneib, JP; Koopmans, LVE; Treu, T


    We report the discovery of a transient source in the central regions of galaxy cluster A267. The object, which we call "PALS-1,'' was found in a survey aimed at identifying highly magnified Lyman break galaxies in the fields of intervening rich clusters. At discovery, the source had U(n)>24.7 (2

  10. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.


    Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  11. The Stochastic Galerkin Method for Darcy Flow Problem with Log-Normal Random

    Czech Academy of Sciences Publication Activity Database

    Beres, Michal; Domesová, Simona


    Roč. 15, č. 2 (2017), s. 267-279 ISSN 1336-1376 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : Darcy flow * Gaussian random field * Karhunen-Loeve decomposition * polynomial chaos * Stochastic Galerkin method Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics

  12. sexual risk behaviour among hiv-positive persons in kumasi, ghana

    African Journals Online (AJOL)

    David Ofori-Adjei


    Mar 1, 2012 ... cent CD4 cell count, current health status, year partici- pants first tested HIV positive, HIV related ..... 17. Kalichman SC, Ramachandran B, Catz S. Adher- ence to combination antiretroviral therapies in HIV patients of low health literacy. J Gen Int Med. 1999; 14:267-273. 18. Ghana Statistical Survey and ...

  13. Intrapartální fetální monitoring, senzitivita a specificita metod

    Czech Academy of Sciences Publication Activity Database

    Hájek, Z.; Srp, B.; Pavlíková, Markéta; Zvárová, Jana; Liška, K.; Haddad El, R.; Pašková, A.; Pařízek, A.


    Roč. 71, č. 4 (2006), s. 263-267 ISSN 1210-7832 Grant - others:GA MZd(CZ) NH7664 Institutional research plan: CEZ:AV0Z10300504 Keywords : senzitivita * specificita * diagnostika hypoxie * kardiotokografie * fetální pulzní oxymetrie * ST analýza EKG plodu Subject RIV: BB - Applied Statistics, Operational Research

  14. Factors influencing alcohol and illicit drug use amongst first year medical students

    NARCIS (Netherlands)

    Popescu, Codruta Alina; Bob, Mihai Horatiu; Junjan, Veronica; Armean, Sebastian Mihai; Buzoianu, Anca Dana


    The aims of this study were a) to investigate patterns of alcohol, smoking and illicit drug use and b) evaluate the relationship between substance abuse and personality factors in a cohort of 267 first year medical students. 12.3 % (men) and 11.8% (female) medical students reported to be drinking

  15. Bacterial and Fungal Community Structures in Loess Plateau Grasslands with Different Grazing Intensities. (United States)

    Huhe; Chen, Xianjiang; Hou, Fujiang; Wu, Yanpei; Cheng, Yunxiang


    The Loess Plateau of China is one of the most fragile ecosystems worldwide; thus, human production activities need to be conducted very cautiously. In this study, MiSeq high-throughput sequencing was applied to assess the relationship between bacterial and fungal community structures and changes in vegetation and soil physical and chemical properties induced by grazing, in four grasslands with different levels of grazing intensity (0, 2.67, 5.33, and 8.67 sheep/ha) in the semiarid region of the Loess Plateau. The relative abundances of the bacterial community in the grasslands with 2.67 and 5.33 sheep/ha were significantly higher than those in grasslands with 0 and 8.67 sheep/ha, and the fungal diversity was significantly lower for grasslands with 2.67 sheep/ha than for the other grasslands. Redundancy analysis (RDA) showed that plant biomass, nitrate, and total nitrogen have significant effects on bacterial community structure, whereas nitrate and total nitrogen also significantly affect fungal community structure. Variation partitioning showed that soil and plant characteristics influence the bacterial and fungal community structures; these characteristics explained 51.9 and 52.9% of the variation, respectively. Thus, bacterial and fungal community structures are very sensitive to grazing activity and change to different extents with different grazing intensities. Based on our findings, a grazing intensity of about 2.67 sheep/ha is considered the most appropriate in semiarid grassland of the Loess Plateau.

  16. The National Shipbuilding Research Program. Strategies and Demonstrations for the Reduction of Government Regulations Related to Commercial Shipbuilding (United States)


    Norfolk, Virginia North American Shipbuilding, Galliano , Louisiana Pacific Ship Repair & Fabrication, San Diego, California Peterson Builders, Sturgeon...tion. Status: NPRM published February 23, 1995(60 FR 10044). FR being drafted. Contact LCDR John Farthing, tel.: (202)267-0505. Coast Guard proposes to

  17. Genetics of adult plant stripe rust resistance in CSP44, a selection ...

    Indian Academy of Sciences (India)


    Wheat line CSP44, a selection from an Australian bread wheat cultivar Condor, has shown resistance to stripe rust in. India since the last twenty years. Seedlings and adult plants of CSP44 showed susceptible infection types against stripe rust race 46S119 but displayed average terminal disease severity of 2.67 on adult ...

  18. Evaluation of Pediatric Patients with Orbital and Preseptal Cellulitis

    Directory of Open Access Journals (Sweden)

    Eren Cagan


    Conclusion: Preseptal cellulitis is more frequently observed than orbital cellulitis. The most important predisposing factor for orbital cellulitis is sinusitis. Patients with preseptal cellulitis suspected clinically may be diagnosed with orbital cellulitis radiologically. As a result radiological imaging of preseptal cellulitis patients should be considered. [Cukurova Med J 2015; 40(2.000: 267-274

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    Gupta Pravin K. Fast computation of Hankel Transform using ortho- normal exponential approximation of complex kernel function. 267. Gupta Prabhat K see Mandal T K. 473. Guptha M V S see Mergulhao Lina P. 415. Jadhav D B see Meena G S. 333. Jain S L see Mandal T K. 473. Jana P K. Ozone decline and its effect on ...

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    255–267. Leptonic flavor and CP violation. Yuval Grossman. 269–281. Higgs bosons in the standard model, the MSSM and beyond. John F Gunion. 283–305 .... The gravity dual of the non-perturbative N = 2 supersymmetric Yang–. Mills theory. Satchidananda Naik. 717–720. N = 1 super quantum chromodynamics and ...

  1. Large Deviations for Stochastic Tamed 3D Navier-Stokes Equations

    International Nuclear Information System (INIS)

    Roeckner, Michael; Zhang, Tusheng; Zhang Xicheng


    In this paper, using weak convergence method, we prove a large deviation principle of Freidlin-Wentzell type for the stochastic tamed 3D Navier-Stokes equations driven by multiplicative noise, which was investigated in (Roeckner and Zhang in Probab. Theory Relat. Fields 145(1-2), 211-267, 2009).

  2. Environmental distribution of coral-associated relatives of apicomplexan parasites

    Czech Academy of Sciences Publication Activity Database

    Janouškovec, J.; Horák, Aleš; Barott, K. L.; Rohwer, F. L.; Keeling, P. J.


    Roč. 7, č. 2 (2013), s. 444-447 ISSN 1751-7362 Institutional support: RVO:60077344 Keywords : apicomplexan-related lineages * Chromera * coral symbionts * coral reef ecosystem Subject RIV: EH - Ecology, Behaviour Impact factor: 9.267, year: 2013

  3. Internal conversion to the electronic ground state occurs via two distinct pathways for pyrimidine bases in aqueous solution


    Hare, Patrick M.; Crespo-Hernández, Carlos E.; Kohler, Bern


    The femtosecond transient absorption technique was used to study the relaxation of excited electronic states created by absorption of 267-nm light in all of the naturally occurring pyrimidine DNA and RNA bases in aqueous solution. The results reveal a surprising bifurcation of the initial excited-state population in

  4. Roostetav legomaja / Karen Jagodin ; kommenteerinud Laila Põdra

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-


    Betoonelementidest eramu (267 m²) Tabasalus. Arhitekt Laila Põdra, insener Indrek Laul. Sisekujundus: Laila Põdra koos omanikega. Projekt: 2005-2007, valmis: 2008. Betoon on viimistluspinnaks ka interjööris. Läbivaks tooniks sise- ja välisviimistluses on roostepunane, teiseks põhitooniks on valge. Konkursil "Aasta Betoonehitis 2008" pälvis tellija eripreemia

  5. Introducing CSR - The Missing Ingredient in the Land Reform Recipe?

    African Journals Online (AJOL)


    268-305; and Wood and Jones 1995 International Journal of Organisational Analysis 229-267. Burke and Logsdon 1996 Long Range Planning 495-502 note that, in the ...... [date of use 20. Sep 2011]. Anon 2011 Anonymous 2011 Pocket Guide to South Africa 2010/11 Agriculture, Forestry and Fisheries ...


    African Journals Online (AJOL)

    of Laryngology and Otology 1988;102:725-726. 4-Mcallister R.M.R, Rutty F, Hancock.k, Sanders.R. Cavernous haemangiona of the nasal bones.The Journal of Laryngology and Otology 1992;106:264-267. 5-kelemen.g, Holmes E.M. Cavernous hemangioma of the frontal bone. The. American Journal of Medicine 1964; 37, ...

  7. 78 FR 27029 - Modification of Class C Airspace; Nashville International Airport; TN (United States)


    ...., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: History On January 30, 2013, the...-aviation uses. Since the original purpose of the exclusion no longer exists, the FAA is removing the words... economic impact on a substantial number of small entities under the criteria of the Regulatory Flexibility...

  8. 75 FR 53863 - Amendment of Restricted Area R-5113; Socorro, NM (United States)


    ...; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: History On March 3, 2010, the U. S. Navy requested... substantial number of small entities under the criteria of the Regulatory Flexibility Act. The FAA's authority....51 is amended as follows: * * * * * R-5113 Socorro, NM * * * * * By removing the words ``Using Agency...

  9. Exploring the Link between Corporal Punishment and Children's Cruelty to Animals. (United States)

    Flynn, Clifton P.


    Study of college undergraduates (N=267) examined the relationship between corporal punishment inflicted by parents and perpetration of animal abuse. Analyses showed that the association between fathers' corporal punishment and sons' childhood animal cruelty persisted after controlling for child abuse, father-to-mother violence, and father's…

  10. Atmospheric Transmittance/Radiance Computer Code FASCOD2, (United States)


    the fast line-by-line atmospheric trasmittance and radiance oode FASCODIB are detailed. 002 far wings are modelled with a new sub-Lorentz lineshape...Gryvnak, D.A., Patty, R.R., and Bartky, C.E., J. Opt. Soc. Am . 59, 267 (1969). 10. K.M. Haught, "High Resolution Atmospheric Transmission Spectra from 5 to

  11. X-ray dark-field refraction-contrast imaging of micro-objects

    Czech Academy of Sciences Publication Activity Database

    Protopopov, V. V.; Sobota, Jaroslav


    Roč. 213, 4/6 (2002), s. 267 - 279 ISSN 0030-4018 Institutional research plan: CEZ:AV0Z2065902 Keywords : X-ray imaging * radiography * refraction Subject RIV: JI - Composite Materials Impact factor: 1.488, year: 2002

  12. 77 FR 68196 - Orders Limiting Operations at John F. Kennedy International Airport, LaGuardia Airport, and... (United States)


    ... 20591; telephone: (202) 267-7143; email: [email protected] . SUPPLEMENTARY INFORMATION: Background On... front, Hurricane Sandy transitioned to an extratropical storm that caused widespread power outages... historic precedence for the following scheduling season, depending on the airport.\\1\\ The FAA may grant a...

  13. Accumulation of free amino acids during exposure to drought in three springtail species

    Czech Academy of Sciences Publication Activity Database

    Holmstrup, M.; Slotsbo, S.; Rozsypal, Jan; Henriksen, P. G.; Bayley, M.


    Roč. 82, NOV 01 (2015), s. 114-121 ISSN 0022-1910 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : collembola * desiccation * osmoregulation Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015

  14. Effect of structure on creep behaviour of superalloy single crystals

    Czech Academy of Sciences Publication Activity Database

    Lukáš, Petr; Kunz, Ludvík; Svoboda, Milan; Čadek, Josef


    Roč. 482, - (2005), s. 267-270 ISSN 0255-5476 R&D Projects: GA AV ČR(CZ) IBS2041001 Institutional research plan: CEZ:AV0Z2041904; CEZ:AV0Z20410507 Keywords : Superalloys CMSX-4 and CM186LC Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.399, year: 2005

  15. A study of the effect of pollution and climate impact on plant growth based on field transplantation (A phytometer method)

    Czech Academy of Sciences Publication Activity Database

    Tůma, Ivan


    Roč. 22, č. 2 (2003), s. 253-267 ISSN 1335-342X R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : aboveground biomass * Calamagrostis arundinacea * climate and pollution impact Subject RIV: EF - Botanics Impact factor: 0.100, year: 2003

  16. The effects of strength-based versus deficit-based self-regulated learning strategies on students' effort intentions

    NARCIS (Netherlands)

    Hiemstra, Djoerd; Van Yperen, Nico W.

    In two randomized experiments, one conducted online (n = 174) and one in the classroom (n = 267), we tested the effects of two types of self-regulated learning (SRL) strategies on students’ intentions to put effort into professional development activities: strength-based SRL strategies (i.e.,

  17. Conjugacy class sizes and solvability of finite groups

    Indian Academy of Sciences (India)

    Let be a finite group and * be the set of primary, biprimary and triprimary elements of . We prove that if the conjugacy class sizes of * are {1,,,} with positive coprime integers and ,then is solvable. This extends a recent result of Kong (Manatsh. Math. 168(2)(2012) 267–271).

  18. Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

    Czech Academy of Sciences Publication Activity Database

    Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.


    Roč. 473, 1 January (2015), s. 267-273 ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.557, year: 2015

  19. Methylated trivalent arsenicals are potent inhibitors of glucose stimulated insulin secretion by murine pancreatic islets

    Czech Academy of Sciences Publication Activity Database

    Doulliet, Ch.; Currier, J. M.; Saunders, J.; Bodnar, W. M.; Matoušek, Tomáš; Stýblo, M.


    Roč. 267, č. 1 (2013), s. 11-15 ISSN 0041-008X R&D Projects: GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : arsenic speciation * tissue * hydride generation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.630, year: 2013

  20. Experience of Soviet Medicine in a Great Patriotic War 1941-1945. Part 2 (Opyt Sovetskoy Meditsimy v Velikoy Otechestvennoy Voyne 1941-1945), (United States)


    Crushed. (14). Large/coarse, small-splintered and packed in. (15). edge/boundary. (16). On the average. Page 267. If we accept the strength cf group -leaf...inside. In view of contraction/abtreviation m psoas prcximal troken end can still bend; in these cases Extremital broken end is inclined at an angle

  1. Soil development on loess overlying Cretaceous sediments and Devonian limestones

    Czech Academy of Sciences Publication Activity Database

    Žigová, Anna; Šťastný, Martin


    Roč. 12, č. 3 (2015), s. 267-278 ISSN 1214-9705 Institutional support: RVO:67985831 Keywords : loess * Cretaceous and Devonian rocks * mineral composition * soil development * Luvic Chernozem * Albic Luvisol Subject RIV: DF - Soil Science Impact factor: 0.561, year: 2015

  2. Attacking the Personal Fable: Role-Play and Its Effect on Teen Attitudes toward Sexual Abstinence. (United States)

    Saltz, Eli; And Others


    Examines role playing as a tool for changing teenagers' attitudes about sex behavior and the consequences of teen pregnancy. A sample of 267 ninth-grade students attending a high-risk urban school participated. Role playing and watching videos of friends' role playing significantly increased favorable attitudes toward abstinence in girls but not…

  3. Pattern and Outcome of Admissions in the Children's Emergency ...

    African Journals Online (AJOL)

    A five-year review of the pattern and outcome of paediatric admissions in the Children Emergency Room (CHER) of the University of Nigeria Teaching Hospital (UNTH) Enugu, showed a total of 10,267 admissions, a discharge rate of 50.4 percent, a transfer-out rate of 44.3 percent, and a mortality of 5.1 percent.

  4. LTR retrotransposon dynamics in the evolution of the olive (Olea europaea) genome

    Czech Academy of Sciences Publication Activity Database

    Barghini, E.; Natali, L.; Giordani, T.; Cossu, R.M.; Scalabrin, S.; Cattonaro, F.; Šimková, Hana; Vrána, Jan; Doležel, Jaroslav; Morgante, M.; Cavallini, A.


    Roč. 22, č. 1 (2015), s. 91-100 ISSN 1340-2838 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : LTR retrotransposons * next-generation sequencing * olive Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.267, year: 2015

  5. Experiment list: SRX524974 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX524974 hg19 Histone H3K27me3 Uterus Endometrial stromal cells NA 42283456,99.2,4...9.5,267 GSM1372866: H3K27me3 case2 w/ EP; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

  6. In vitro propagation via seeds of Capparis ovata Desf

    African Journals Online (AJOL)



    Capparis spinosa L.) seeds.J.Hortic.Sci. 58:267-270. Soyler D, Arslan N (1999). Effect of heat, light and dark treatments on seed germination of capers (Capparis spinosa L.). Anadolu 9: 63-75. Soyler D, Khawar KM (2006). Effects ...

  7. Molecular investigation of two contrasting genotypes of Medicago ...

    African Journals Online (AJOL)

    The EST-SSRs markers were polymorphic with an average of 1.33 alleles per primers and gave moderate values of polymorphic information content (PIC) that ranged from 0 to 0.267. The analysis of polymorphism loci for each genotype showed that the tolerant genotype (Tru 131) population had two alleles; genetic ...

  8. Monitoring for Equality? Asylum Seekers and Refugees' Retention and Achievement in English for Speakers of Other Languages (ESOL) (United States)

    Phillimore, Jenny


    Interest in the integration of refugees has grown with the increase in numbers of asylum seekers dispersed across the UK. The ability to communicate effectively in English is seen as the key priority in facilitating integration, while a lack of English language is seen as one of the major barriers to refugee employment. Some 267 million British…

  9. Gender, Language, and Social Influence: A Test of Expectation States, Role Congruity, and Self-Categorization Theories (United States)

    Reid, Scott A.; Palomares, Nicholas A.; Anderson, Grace L.; Bondad-Brown, Beverly


    This study compares self-categorization, expectation states, and role congruity theories' explanations for female influence. Male and female participants (N = 267) listened to a recording of a female speaker who used either tentative or assertive language under conditions that led participants to categorize her as a woman or as college-educated.…

  10. N-glycosylated catalytic unit meets O-glycosylated propeptide: complex protein architecture in a fungal hexosaminidase

    Czech Academy of Sciences Publication Activity Database

    Plíhal, Ondřej; Sklenář, Jan; Kmoníčková, J.; Man, Petr; Pompach, Petr; Havlíček, Vladimír; Křen, Vladimír; Bezouška, Karel


    Roč. 32, č. 5 (2004), s. 764-765 ISSN 0300-5127 R&D Projects: GA ČR GA203/04/1045 Institutional research plan: CEZ:AV0Z5020903 Keywords : asperillus oryzoe * glycosyl hydrolase * preproprotein Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004

  11. 47 CFR 73.202 - Table of Allotments. (United States)


    ... 261A Morgantown 256A Perryville 298A Science Hill 291A Smith Mills *233A LOUISIANA Anacoco 276C3... 250A Linden 267A Lynchburg 230A Oliver Springs 291A Pigeon Forge 292A TEXAS Annona 263A Asherton 284A...

  12. by treatment with crotonic acid and vinyl acetic acid

    Indian Academy of Sciences (India)

    random access memory devices and energy storage devices. Electrolytes, polyelectrolytes or their complexes in ... with alkali-metal salts or metal salts or acids.2,6,7. Measurement of conductivity in solid state shows ..... part and Z sin θ is the imaginary part denoted as Z′ real and. Z′′ imag, respectively. In this way for the ...

  13. Gclust Server: 201867 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201867 Rde_RD1_3334 Cluster Sequences - 267 hypothetical protein 1 1.00e-99 0.0 0.0... 0.0 6.67 0.0 0.0 Show 201867 Cluster ID 201867 Sequence ID Rde_RD1_3334 Link to cluster sequences Cluster S

  14. 76 FR 59306 - Proposed Establishment of Class D and E Airspace and Amendment of Class E Airspace; Punta Gorda, FL (United States)


    ... Aviation Administration, Room 350, 1701 Columbia Avenue, College Park, Georgia 30337. FOR FURTHER... Independence Avenue, SW., Washington, DC 20591, or by calling (202) 267-8783. Communications must identify both.... Issued in College Park, Georgia, on September 16, 2011. Mark D. Ward, Manager, Operations Support Group...

  15. 78 FR 36232 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year... (United States)


    .......... Mary Walker, Mary Walker 4912 E Tampa 85 221,411 LLC. Apartments. Linebaugh Ave. GA....... Friendship Friendship 35 Northside Dr Atlanta 102 210,251 Tower, Inc. Towers. SW. GA....... Hellenic Tower The Hellenic........ Walla Walla 49 158,616 Action Council. WI....... 3311 W. The Woods Of 3311 W College Franklin 112 267...

  16. Structure analysis of thin iron-silicide film from θ-scan RHEED Patterson function

    Czech Academy of Sciences Publication Activity Database

    Romanyuk, Olexandr; Kataoka, K.; Matsui, F.; Hatori, K.; Hiroshi, D.


    Roč. 56, č. 3 (2006), s. 267-276 ISSN 0011-4626 R&D Projects: GA ČR(CZ) GA202/04/0994 Institutional research plan: CEZ:AV0Z10100521 Keywords : Patterson function * RHEED * iron silicide * structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.568, year: 2006

  17. Occurrence of Philometra lateolabracis (Nematoda: Philometridae) in the gonads of marine perciform fishes in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.


    Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003

  18. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.


    Roč. 18, č. 2 (2011), s. 267-271 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 logistic +operations+in+discarded+munitions+processing

  19. 77 FR 74508 - Notice of Availability of the Draft Resource Management Plan Amendment, Draft Environmental... (United States)


    ... Environmental Impact Statement for the Ring of Fire Resource Management Plan--Haines Planning Area, Alaska... Cobbs, Anchorage District Planning and Environmental Coordinator, 907-267-1221, [email protected] , or in... the National Environmental Policy Act of 1969, as amended (NEPA), and the Federal Land Policy and...

  20. Flow hydrodynamics near inlet key of Piano Key Weir (PKW)

    Indian Academy of Sciences (India)

    cations have taken place making it the standard in velocity measurement in fluid flow (Yeh &. Cummins 1964). ... Turbulent intensity is basically defined as the ratio root mean square velocity to the mean velocity (Eq. 1). %T I = ... lies in between very short range (25.2–35.3) with 2.67% of standard deviation. The same feature.

  1. Regional vegetation management standards for commercial pine ...

    African Journals Online (AJOL)

    Trial sites were selected across different physiographic regions such that a range of altitudinal, climatic and environmental gradients were represented. ... Two of the trials were situated at lower-altitude sites (900 m and 1 000 m above sea level [asl]), one at a mid-altitude site (1 267 m asl), and one at a higher-altitude site (1 ...

  2. The Effects of Social Capital Levels in Elementary Schools on Organizational Information Sharing (United States)

    Ekinci, Abdurrahman


    This study aims to assess the effects of social capital levels at elementary schools on organizational information sharing as reported by teachers. Participants were 267 teachers selected randomly from 16 elementary schools; schools also selected randomly among 42 elementary schools located in the city center of Batman. The data were analyzed by…

  3. Jaderná energetika v roce 2014

    Czech Academy of Sciences Publication Activity Database

    Wagner, Vladimír


    Roč. 65, č. 5 (2014), s. 261-267 ISSN 0375-8842 Institutional support: RVO:61389005 Keywords : nuclear energy * fast breeder reactors * reactor of III+ generation * Fukushima I * Germany Energiewende Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  4. Shedding consistency of strongyle-type eggs in dutch boarding horses

    NARCIS (Netherlands)

    Dopfer, D.D.V.; Kerssens, C.M.; Meijer, Y.G.M.; Boersema, J.H.; Eysker, M.


    Faeces of 484 horses were sampled twice with an interval of 6 weeks while anthelmintic therapy was halted. Faecal eggs counts revealed that 267 (55.2%) horses had consistently low numbers of eggs per gram faeces (EPG) (EPG <100 or = 100), 155 (32.0%) horses had consistently high EPGs (EPG >

  5. Thermal expansion anomaly and thermal conductivity of U3O8

    International Nuclear Information System (INIS)

    Schulz, B.


    The anomaly in the thermal expansion of U 3 O 8 and results of the thermal conductivity of this compound are described. U 3 O 8 powder heat treated at 1,223 K was consolidated by pressing and sintering in air at 1,223 and 1,373 K to a density of 66% and 80.8% TD. The O/U ratio was 2.67 and 2.63 respectively, the crystal structure being orthorhombic in both cases. For UOsub(2.63) the thermal linear expansion was measured in the temperature range 293 K-1,063 K in pressing direction and normal to it, while for UOsub(2.67) measurements were done parallel to the pressing direction. The curves of the linear thermal expansion from 373 K up to 623 K show negative values and above positive for the three curves. The results are related to known data of phase-transition-temperatures of the orthorhombic U 3 O 8 . Measurements of the thermal conductivity were done on UOsub(2.67). Because of the high porosity of the samples, known relationships for the porosity correction of the thermal conductivity were proved on alumina with 34 % porosity. The values of the thermal conductivity of UOsub(2.67) (corrected to zero porosity) show a very slight temperature dependence, they are about three times lower than those of the stoichiometric uranium dioxide in the same temperature range

  6. The prevalence of gastrointestinal nematode infection and their ...

    African Journals Online (AJOL)

    Republic of Kenya, Government Printers, Nairobi. First schedule: article 6 (1). Thrusfield M. (2007). Veterinary epidemiology, third edition. Blackwell publishers, London. pp 267- 304. Urquhart G. M., Armour J., Duncan J. L., Dunn A. M., Jennings F. W. (1996). Veterinary. Parasitology 2nd edition, Blackwell science, pp 4 -10.

  7. Information needs and seeking behaviour of distance learning ...

    African Journals Online (AJOL)

    The data collected shows that 26.7% of the respondents accessed information on financial matters, 20.7% accessed information on education matters and 16.0% of the respondents accessed information on sports. Also, 54.9% of the respondents had been using the library as source of information for the past five years and ...

  8. Cervical cancer in South Africa: An over- view of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per year and 273 505 die from the disease.1. Globally it is the second most common cancer in women and the most common in developing countries. In Africa, which has a population of 267.9 million women aged 15 years or greater, it is.

  9. Outbreak of tinea capitis by Trichophyton tonsurans and Microsporum canis in Niterói, RJ, Brazil. (United States)

    Towersey, L; Hay, R J; Monteiro, M H; Lago, M B; Martins, E de C; Estrella, R R


    18 girls from an orphanage (Orfanato Santo Antônio) in Niterói presented tinea capitis due to Trichophyton tonsurans (15 cases-83.3%) and Microsporum canis (3 cases-26.7%). Comments are made about clinical, mycological and therapeutic aspects of this microepidemic.

  10. [Stability of orthodontic-maxillofacial surgical treatment of anterior open bite deformities

    NARCIS (Netherlands)

    Hoppenreijs, T.J.M.; Freihofer, H.P.M.; Stoelinga, P.J.W.; Tuinzing, D.B.


    A sample of 267 patients with maxillary hyperplasia, a Class I or Class II occlusion and anterior open bite, collected from three different institutions, was analysed regarding stability after Le Fort I intrusion osteotomies or bimaxillary osteotomies. Skeletal and dento-alveolar stability of the

  11. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Dinesh. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 267-272 Superconductors. Specific heat studies in Ho–Ba–CuO superconductors: Fermionic and bosonic contributions · Dinesh Varshney Sanjay Shah R K Singh · More Details Abstract ...

  12. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Charuta V Prabhu. Articles written in Journal of Earth System Science. Volume 109 Issue 2 June 2000 pp 267-277. Diurnal variability of upper ocean temperature and heat budget in the southern Bay of Bengal during October — November, 1998 (BOBMEX-Pilot).

  13. The Glycosylation of Plasminogen Activator Inhibitor-1

    DEFF Research Database (Denmark)

    Skottrup, Peter Durand; Pedersen, Katrine Egelund; Christensen, Anni

    Plasminogen activator inhibitor type-1 (PAI-1) has three potential sites for N-linked glycosylation, including Asn209Tyr210Thr211, Asn265Met266Thr267, and Asn329Glu330Ser331. Using a HEK293 expression system, we have made mutants with Asp or Gln substitutions of the Asn residue in each of these s...

  14. Communication Factors as Predictors of Relationship Quality: A National Study of Principals and School Counselors (United States)

    Duslak, Mark; Geier, Brett


    This study examined the effects of meeting frequency, structured meeting times, annual agreements, and demographic variables on school counselor perceptions of their relationship with their building principal. Results of a regression analysis indicated that meeting frequency accounted for 26.7% of the variance in school counselor-reported…

  15. CASE REPORT Hyperparathyroidism with presumed sellar ...

    African Journals Online (AJOL)

    Goswami P, Sarma PK, Sethi S, Hazarika S. Skeletal manifestations in a case of primary hyperparathyroid. -ism caused by parathyroid adenoma. Ind J Radiol Imag 2002; 12: 267-270. 2. Bone Tumours: Clinical, Radiologic and Pathologic Correlations. Philadelphia: Lea and Febiger, 2006. 3. Magu S, Mathur SK, Gulati SP, ...

  16. Sociolinguistic Bibliography of European Countries for 2008: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr


    Roč. 24, č. 1 (2010), s. 267-272 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistic s * bibliography * Czech Republic Subject RIV: AI - Linguistics

  17. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. L Sriramkumar. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  18. A stochastic differential equation model for drug dissolution and its parameters

    Czech Academy of Sciences Publication Activity Database

    Lánský, Petr; Lánská, V.; Weiss, M.


    Roč. 100, č. 2 (2004), s. 267-274 ISSN 0168-3659 R&D Projects: GA MZd NR7795 Grant - others:DE - CZ(CZ) CZE 01/034 Institutional research plan: CEZ:AV0Z5011922 Keywords : dissolution * stochastic differential equation Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.297, year: 2004

  19. Genetic parameters for male fertility and its relationship to skatole and androstenone in Danish Landrace boars

    DEFF Research Database (Denmark)

    Strathe, Anders Bjerring; Velander, I.H.; Mark, Thomas


    , and total number of sperm were available from 95,267 ejaculates. These ejaculates were collected between 2005 and 2012 and originated from 3,145 Landrace boars from 12 AI stations in Denmark. The traits were analyzed using single and multitrait animal models including univariate random regression models...

  20. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... University (NEOMED) 24,728 views 5:39 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society 4,267 views 3:29 Little Stars – ... views 3:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,538 views 5: ...

  1. Fulltext PDF

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    the opportunity to serve as guest editors. We hope that we have been able to do justice to the objec- tives of this special issue. Samarendra Bhattacharya. Indian Statistical Institute, Calcutta, India. Jibamitra Ganguly. University of Arizona, USA. Proc. Indian Acad. Sci. (Earth Planet. Sci.), 110, No. 4, December 2001, p. 267.

  2. Tolerance to acute ischemia in adult male and female spontaneously hypertensive rats

    Czech Academy of Sciences Publication Activity Database

    Bešík, J.; Szárszoi, Ondrej; Kuneš, Jaroslav; Netuka, I.; Malý, J.; Kolář, František; Pirk, J.; Ošťádal, Bohuslav


    Roč. 56, č. 3 (2007), s. 267-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510; GA MZd ND7607 Institutional research plan: CEZ:AV0Z50110509 Keywords : cardiac tolerance * ischemia injury * gender differences Subject RIV: ED - Physiology Impact factor: 1.505, year: 2007

  3. Selected topics related to the transport and superconductivity in boron-doped diamond

    Czech Academy of Sciences Publication Activity Database

    Mareš, Jiří J.; Hubík, Pavel; Krištofik, Jozef; Nesládek, Miloš


    Roč. 9, č. 4 (2008), 044101/1-044101/6 ISSN 1468-6996 R&D Projects: GA AV ČR IAA1010404; GA ČR(CZ) GA202/06/0040 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystalline diamond * temperature Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.267, year: 2008

  4. The effects of body thermal state on manual performance. (United States)


    Thirty-six young men were exposed for 2 hours to environmental temperatures of 10, 26.7, or 46C. Measurements of rectal and skin temperature, heart rate and respiratory rate were made, and average skin and average body temperatures were calculated. M...

  5. The Effects of Subthreshold Visual Cues on Flight Performance in the NUH-60FS Black Hawk Research Simulator (United States)


    influenced your opinion of subthreshold priming/ subliminal messaging ...0%) Table 9. Has participating in this experiment influenced your opinion of subthreshold priming/ subliminal messaging ? Yes No Other...priming/ subliminal messaging ? Positive Negative Other Frequency (%) 14 (46.7%) 8 (26.7%) 8 (26.7%)5 Table 11. In your opinion, do you

  6. Crystal growth and luminescence properties of Li.sub.2./sub.B.sub.4./sub.O.sub.7./sub. single crystals doped with Ce, In, Ni, Cu and Ti ions

    Czech Academy of Sciences Publication Activity Database

    Senguttuvan, N.; Ishii, M.; Shimoyama, M.; Kobayashi, M.; Tsutsui, N.; Nikl, Martin; Dušek, Michal; Shimizu, H. M.; Oku, T.; Adachi, T.; Sakai, K.; Suzuki, J.


    Roč. 486, - (2002), s. 264-267 ISSN 0168-9002 R&D Projects: GA MŠk ME 462 Institutional research plan: CEZ:AV0Z1010914 Keywords : lithium tetraborate * crystal growth * neutron detection * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.167, year: 2002

  7. Ploštice (Heteroptera) Chráněné krajinné oblasti Kokořínsko

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Kment, P.


    Roč. 27, - (2006), s. 267-294 ISSN 0231-5807 Institutional research plan: CEZ:AV0Z60930519 Keywords : Heteroptera * faunistics * nature conservation Subject RIV: EG - Zoology

  8. Optical detection of toluene in water by using an IGI optical fiber with a short sensing region

    Czech Academy of Sciences Publication Activity Database

    Chomát, Miroslav; Berková, Daniela; Matějec, Vlastimil; Kašík, Ivan; Kuncová, Gabriela; Hayer, Miloš

    B87, č. 2 (2002), s. 258-267 ISSN 0925-4005 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : optical fibres * fibre optic sensors * chemical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.893, year: 2002

  9. Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size

    Czech Academy of Sciences Publication Activity Database

    Martínková, Natália; Moravec, J.


    Roč. 61, 3-4 (2012), s. 254-267 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  10. Genetic and clonal diversity of the endemic ant-plant Humboldtia ...

    Indian Academy of Sciences (India)


    [Dev S A, Shenoy M and Borges R M 2010 Genetic and clonal diversity of the endemic ant-plant Humboldtia brunonis (Fabaceae) in the Western. Ghats of India; J. Biosci. 35 267–279] DOI 10.1007/s12038-010-0031-5. Keywords. Caesalpinioideae; clonality; Detarieae; myrmecophyte; inter simple sequence repeats; spatial ...

  11. Purification and partial characterization of peroxidase from lettuce ...

    African Journals Online (AJOL)

    Peroxidase (EC1.11.1.7) was purified to homogeneity from lettuce (Lactuca sativa L.) stems by means of 40 to 80% ammonium sulfate precipitation, Sephadex G-100 gel filtration and affinity chromatography with concanavalin A. Peroxidase was purified 17.92-fold with 2.67% recovery and its molecular mass was 35 kDa on ...

  12. Degradation of polycyclic aromatic hydrocarbons by hydrogen peroxide catalyzed by heterogeneous polymeric metal chelates

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr; Cajthaml, Tomáš; Merhautová, Věra; Gabriel, Jiří; Nerud, František; Stopka, P.; Hrubý, Martin; Beneš, Milan J.


    Roč. 59, - (2005), s. 267-274 ISSN 0926-3373 R&D Projects: GA AV ČR IBS5020306; GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z7090911 Keywords : degradation * polycyclic aromatic hydrocarbon * hydrogen peroxide Subject RIV: EE - Microbiology, Virology Impact factor: 3.809, year: 2005

  13. 77 FR 77001 - Comprehensive Review of Licensing and Operating Rules for Satellite Services (United States)


    ...] Comprehensive Review of Licensing and Operating Rules for Satellite Services AGENCY: Federal Communications... summary of the Order in IB Docket No. 12-267, Comprehensive Review of Licensing and Operating Rules for... for public inspection and copying during regular business hours at the FCC Reference Information...

  14. 1936-IJBCS-Article-Benjamin Ebeshi

    African Journals Online (AJOL)


    Robinson TJ, Mulligan TO. 1977. Cimetidine and mental confusion. Lancet, 11: 719. Shinn AF. 1992. Clinical relevance of cimetidine drug interaction: Drug safety,. 7: 245-267. Somogyi A, Gugler R. 1983. Clinical pharmacokinetic of cimetidine. Clin. Pharmacokinet, 8: 463-495. USP (United States Pharmacopeia). 2006.

  15. Lymphocyte activation receptors:new structural paradigms in group V of C-type animal lectins

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, J.; Kavan, Daniel; Pompach, Petr; Novák, Petr; Lukšan, Ondřej; Bezouška, Karel


    Roč. 32, č. 6 (2004), s. 1124-1126 ISSN 0300-5127 R&D Projects: GA AV ČR IAA5020403 Institutional research plan: CEZ:AV0Z5020903 Keywords : lectin-type receptor * ligand identification * lymphocyte Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004

  16. Tuning emergent magnetism in a Hund's impurity

    Czech Academy of Sciences Publication Activity Database

    Khajetoorians, A.A.; Valentyuk, M.; Steinbrecher, M.; Schlenk, T.; Shick, Alexander; Kolorenč, Jindřich; Lichtenstein, A.I.; Wehling, T.O.; Wiesendanger, R.; Wiebe, J.


    Roč. 10, č. 11 (2015), s. 958-U195 ISSN 1748-3387 R&D Projects: GA ČR GC15-05872J Institutional support: RVO:68378271 Keywords : magnetic anisotropy * Kondo effect * strong electron correlations * scanning tunnelling microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 35.267, year: 2015

  17. Respiratory metabolism of salivary glands during the late larval and prepupal development of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Farkaš, R.; Sláma, Karel


    Roč. 81, October 01 (2015), s. 109-117 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : salivary glands * in vitro culture * metamorphosis Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015

  18. Policy Implication of the Awareness and Use of Biotechnology ...

    African Journals Online (AJOL)


    was observed that genetically modified cassava variety is the most used biotech product in the study area as it scored a mean of 3.25 followed by biotech maize and tree crops which scored means of 2.68 and 2.67 respectively. It was also revealed that genetically modified cassava varieties was the most available biotech ...

  19. Data of evolutionary structure change: 1AIGN-1AIJS [Confc[Archive

    Lifescience Database Archive (English)


  20. 76 FR 2708 - Porcelain-on-Steel Cooking Ware From Taiwan; Top-of-the-Stove Stainless Steel Cooking Ware From... (United States)


    .... 701- TA-267 and 731-TA-304 (Third Review)] Porcelain-on-Steel Cooking Ware From Taiwan; Top-of-the-Stove Stainless Steel Cooking Ware From Korea AGENCY: United States International Trade Commission...-steel cooking ware from Taiwan and the antidumping and countervailing duty orders on imports of top-of...

  1. 75 FR 62144 - Porcelain-on-Steel Cooking Ware From China and Taiwan; Top-of-the-Stove Stainless Steel Cooking... (United States)


    ...); (Investigation Nos. 701-TA-267 and 731-TA-304 (Third Review))] Porcelain-on-Steel Cooking Ware From China and Taiwan; Top-of- the-Stove Stainless Steel Cooking Ware From Korea AGENCY: United States International... porcelain-on-steel cooking ware from China and Taiwan and the antidumping and countervailing duty orders on...

  2. Localization of the small CAB-like proteins in photosystem II

    Czech Academy of Sciences Publication Activity Database

    Yao, D.; Kieselbach, T.; Komenda, Josef; Promnares, Kamoltip; Prieto, M. A. H.; Tichý, Martin; Vermaas, W.; Funk, C.


    Roč. 282, č. 1 (2007), s. 267-276 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z50200510 Keywords : photosystem II * cab-like proteins * mass spectrometry Subject RIV: EE - Microbiology, Virology Impact factor: 5.581, year: 2007

  3. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ylmethionine-dependent methltransferase ... [Clostridium perfringens str. 13] ref|NP_563159.1| ... ... ... probable S-adenosylmethionine-dependent methltransferase ... [Clostridium perfringens str. 13] ... ...NKIYDLFDEKGFSQEE Sbjct: 121 DRIRILENCMRILKPGGIILIAYINSLGVLKVGLSDFPQEYKDINKIYDLFDEKGFSQEE 180 ... Query: 247 EKCEDERFR...DSTEHLIIVAKK 267 ... EKCEDERFRDSTEHLIIVAKK Sbjct: 241 EKCEDERFRDSTEHLIIVAKK 261

  4. Isotopic effects of fragment-yields in proton induced reactions on Sn isotopes

    Czech Academy of Sciences Publication Activity Database

    Balabekyan, A. R.; Danagulyan, A. S.; Drnoyan, J. R.; Demekhina, N. A.; Adam, Jindřich; Kalinnikov, V. G.; Musulmanbekov, G.


    Roč. 735, - (2004), s. 267-276 ISSN 0375-9474 R&D Projects: GA MŠk(CZ) ME 134 Keywords : absolute cross-section * isotopis yield * multifragmentation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.108, year: 2004

  5. A periodic basis system of the smooth approximation space

    Czech Academy of Sciences Publication Activity Database

    Segeth, Karel


    Roč. 267, 15 September (2015), s. 436-444 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : smooth approximation * data approximation * data interpolation * Fourier transform Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015

  6. Maternal Mortality in a Nigerian Maternity Hospital | Olopade ...

    African Journals Online (AJOL)

    It is necessary to improve the quality of emergency obstetric service as well as reduce the cost and to educate women of reproductive age in Ibadan on the importance of booking for antenatal care and family planning. (Afr. J. Biomed. Res. 11: 267 - 273). Key words: Maternal mortality, case-control study, maternal death, ...

  7. Age, size and regeneration of old growth white pine at Dividing Lake Nature Reserve, Algonquin Park, Ontario (United States)

    Richard P. Guyette; Daniel C. Dey


    The age, mode of regeneration and diameter growth of white pine were determined in an old growth stand near Dividing Lake, Algonquin Provincial Park. The white pine ranged in age from 267 to 486 years. There was no significant relationship between white pine age and diameter (DBH). The distribution of tree ages indicated that the white pine component in this mixed...

  8. Influence of UV and Ozonised Water Treatment on Trans-resveratrol Content in Berry Skins and Juices of Franc and Green Veltliner Grapes

    Czech Academy of Sciences Publication Activity Database

    Landfeld, A.; Tříska, Jan; Balík, J.; Strohalm, J.; Novotná, P.; Vrchotová, Naděžda; Totušek, J.; Lefnerová, D.; Híc, P.; Tománková, E.; Halama, R.; Houška, M.


    Roč. 33, č. 3 (2015), s. 267-276 ISSN 1212-1800 R&D Projects: GA MZe QI91B094 Institutional support: RVO:67179843 Keywords : grape juices * stilbens content * UV irradiation * ozonisation Subject RIV: GM - Food Processing Impact factor: 0.728, year: 2015

  9. 78 FR 57927 - Credit Risk Retention (United States)


    ..., Collateral B. Proposed General Definitions III. General Risk Retention Requirement A. Minimum Risk Retention... Commercial Real Estate Loans 1. Ability To Repay 2. Loan-to-Value Requirement 3. Collateral Valuation 4. Risk... 43, 244, 373, et al. 17 CFR Part 246 24 CFR Part 267 Credit Risk Retention; Proposed Rule #0;#0...

  10. Mikromechanistické aspekty vlivu délky trhliny na lomovou houževnatost a tranzitní chování ocelí

    Czech Academy of Sciences Publication Activity Database

    Chlup, Zdeněk; Dlouhý, Ivo


    Roč. 40, č. 4 (2002), s. 254-267 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041003; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : fracture toughness * transition behaviour * constraint Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.493, year: 2002

  11. Zidovudine-cyclodextrin inclusion complex and its permeability ...

    African Journals Online (AJOL)

    The permeability of zidovudine in zidovudine-cyclodextrin inclusion complex across stomach and intestinal compartments of rat was investigated spectrophotometrically. The absorption maximum ( ) for zidovudine in HCl max buffer (pH 1.2) and in phosphate buffer (pH 7.4) were 267 and 268 nm respectively. The inclusion ...

  12. Paediatric malaria: a ten-year retrospective study at the national ...

    African Journals Online (AJOL)

    comprising of 13 435 male children and 10 854 female children), 8668 (35·7%) were positive for malaria parasites. 267 (3·1%) had parasite density of > 5000 parasites/Zl of blood; 382 (4·4%) had between 500 - 5000 parasites/Zl of blood; ...

  13. Abdim\\'s Stork Ciconia abdimii in Niger: population size, breeding ...

    African Journals Online (AJOL)

    –4, n = 36), suggesting a total post-fledging population of c. 83 500 birds (95% CL ± 51 267), excluding any non-breeding (sub)adults. The home range of six satellite-tagged breeders in 2003 was 10–120 km2 (median 36 km2); birds adjacent ...

  14. 47 CFR 73.840 - Operating power and mode tolerances. (United States)


    ... tolerances. The transmitter power output (TPO) of an LPFM station must be determined by the procedures set forth in § 73.267 of this part. The operating TPO of an LPFM station with an authorized TPO of more than ten watts must be maintained as near as practicable to its authorized TPO and may not be less than 90...

  15. Fulltext PDF

    Indian Academy of Sciences (India)

    solanacearum and its comparative analysis with ribosomal DNA sequences. 267. Kumar P see Bagga D. 905. Kumar Rajesh see Tripathi Ratnesh Kumar. 373. Kumari Priyanka. Lower incidence of nonsyndromic cleft lip with or without cleft palate in females: Is homocysteine a factor? 21. Lakic Nada see Radakovic Milena.

  16. Deposition conditions and composition and structure relationships for nitride carbon films obtained by ECR plasma-assisted CVD and reactive rf magnetron sputtering

    Czech Academy of Sciences Publication Activity Database

    Jastrabík, Lubomír; Soukup, Ladislav; Shaginyan, L. R.; Onoprienko, A. A.


    Roč. 123, - (2000), s. 261-267 ISSN 0257-8972 R&D Projects: GA AV ČR IAA1010827 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.002, year: 2000

  17. Exploring the Influence of Nature Relatedness and Perceived Science Knowledge on Proenvironmental Behavior (United States)

    Obery, Amanda; Bangert, Arthur


    This study was undertaken to investigate the factors influencing proenvironmental behavior of individuals residing in the Northern Rocky Mountains (N = 267). Measures of relatedness to nature and perceived science knowledge were collected through a convenience sample approach using multiple avenues such as city email lists, organizational…

  18. Interaction of extrinsic chemical factors affecting photodegradation of dissolved organic matter in aquatic ecosystems

    Czech Academy of Sciences Publication Activity Database

    Porcal, Petr; Dillon, P. J.; Molot, L. A.


    Roč. 13, č. 5 (2014), s. 799-812 ISSN 1474-905X R&D Projects: GA ČR(CZ) GAP503/12/0781 Institutional support: RVO:60077344 Keywords : photodegradation * dissolved organic matter * calcium * nitrate * iron * pH Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.267, year: 2014


    NARCIS (Netherlands)

    Dijkstra, P.U.; DEBONT, L.G.M.; VANDERWEELE, L.T.; Boering, G.

    The purpose of this paper was to study the relationship between temporomandibular joint (TMJ) mobility and mobility of joints and to study the general character of joint mobility in 83 subjects, 55 females and 28 males (mean age 26.7, range 13-46 years). The subjects were recruited from the

  20. On the internal radioactivity in quartz

    Czech Academy of Sciences Publication Activity Database

    Vandenberghe, D.; De Corte, F.; Buylaert, J.P.; Kučera, Jan; Van den haute, P.


    Roč. 43, 2-6 (2008), s. 771-775 ISSN 1350-4487 Institutional research plan: CEZ:AV0Z10480505 Keywords : neutron activation * k0-method * quartz, dose rate Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2008

  1. A comparative study of atenolol, nifedipine and their combination in ...

    African Journals Online (AJOL)


    Jan 5, 1991 ... related target organ damage by average day-time blood pressure. Clin Exp. Hypertens [A] 1985; 7: 267-278. 22. Mann S, Millar-Craig MW, Raftery EB. Superiority of 24 hour measurement of blood pressure over clinic values in determining prognosis in hypertension. Clin Erp Hypertens [A] 1985; 7: 279-282.

  2. CERN: Digital image analysis in the world's largest research center for particle physics

    CERN Multimedia


    Those interested in researching into the smallest building blocks that matter is made up of need the largest instruments. CERN, near Geneva, Switzerland is where the most powerful circular accelerator in the world is being built: the Large Hadron Collider (LHC) for proton collisions. It has a circumference of 26.7 km (4 pages)

  3. Assessing the Marine Corps Mentorship Program: Planned vs. Actual Use and Perceived Effectiveness (United States)


    book should be there strictly as a guide, but not gospel . It should cease being an inspectable item where Marines are held accountable if they do not...2006). Perceived support for mentoring: A multiple perspectives approach. Journal of Vocational Behavior, 68, 267–291. 104 General John A

  4. Empirical estimates in stochastic programs with probability and second order stochastic dominance constraints

    Czech Academy of Sciences Publication Activity Database

    Omelchenko, Vadym; Kaňková, Vlasta


    Roč. 84, č. 2 (2015), s. 267-281 ISSN 0862-9544 R&D Projects: GA ČR GA13-14445S Institutional support: RVO:67985556 Keywords : Stochastic programming problems * empirical estimates * light and heavy tailed distributions * quantiles Subject RIV: BB - Applied Statistics, Operational Research

  5. influence of molding water content on shear strength characteristic

    African Journals Online (AJOL)


    INFLUENCE OF MOLDING WATER CONTENT ON SHEAR STRENGTH OF COMPACTED CEMENT KILN DUST, K. J. Osinub. K. J. Osinub. K. J. Osinubi, et al. Nigerian Journal of Technology,. Vol. 34, No. 2, April 2015 267 pavements or as waste containment materials. Therefore, recent studies have been geared towards.

  6. Characterization of the interaction between glazes and ceramic bodies

    Czech Academy of Sciences Publication Activity Database

    Kavanová, M.; Kloužková, A.; Kloužek, Jaroslav


    Roč. 61, č. 3 (2017), s. 267-275 ISSN 0862-5468 Institutional support: RVO:67985891 Keywords : glazes * ceramics * thermal analysis * coefficients of the thermal expansion * dilatometry Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 0.439, year: 2016

  7. 77 FR 65823 - Control of Air Pollution From Aircraft and Aircraft Engines; Emission Standards and Test Procedures (United States)


    ... Control of Air Pollution From Aircraft and Aircraft Engines; Emission Standards and Test Procedures... titled ``Table 3 to Sec. 87.23--Tier 6 NO X Standards for New Subsonic Turbofan or Turbojet Engines with... for New Subsonic Turbofan or Turbojet Engines With Rated Output Above 26.7 kN and the rated output (in...

  8. System of Antioxidant Protection of Corn Roots in Case of Adaptation to Combined Action of Herbicides and Soil Drought

    Directory of Open Access Journals (Sweden)

    G. S. Rossihina


    Full Text Available Reaction of antioxidant enzymes in the maize root (Kadr 267 MVhybrid to the combined action of herbicides and soil drought was studied. These conditions activated superoxide dismutase (SOD and peroxidase and coused oscillation in the catalase enzymatic activity.

  9. 77 FR 13385 - Petition for Exemption; Summary of Petition Received (United States)


    ... Federal holidays. Privacy: We will post all comments we receive, without change, to http://www.regulations..., except Federal holidays. FOR FURTHER INFORMATION CONTACT: Frances Shaver, ARM-207, (202) 267- 4059, FAA... Petitioner: Bell Helicopter Textron Canada Limited Section of 14 CFR Affected: Sec. 27.1 Description of...

  10. 75 FR 14483 - Petition for Exemption; Summary of Petition Received (United States)


    ... Federal holidays. Privacy: We will post all comments we receive, without change, to http://www.regulations..., except Federal holidays. FOR FURTHER INFORMATION CONTACT: Laverne Brunache (202) 267-3133 or Tyneka....: FAA-2010-0101. Petitioner: Air Canada. Section of 14 CFR Affected: 14 CFR 93.123(a). Description of...

  11. Electrolyte penetration into high energy ion irradiated polymers

    Czech Academy of Sciences Publication Activity Database

    Fink, D.; Petrov, A.; Müller, M.; Asmus, T.; Hnatowicz, Vladimír; Vacík, Jiří; Červená, Jarmila

    158/159 (2002), s. 228-233 ISSN 0257-8972 R&D Projects: GA AV ČR KSK1010104; GA ČR GA102/01/1324 Keywords : polymers * ion bombardment * defects * diffusion * nanostructrure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2002


    African Journals Online (AJOL)


    10% methanol (300ml each). Both the n-hexane soluble fraction (E004) and the methanol soluble fraction (E003) were evaporated to dryness using rotary evaporator to yield 1.27g and 2.67g respectively. The extract and fractions were stored in a refrigerator at - 4°C. RESULTS. Physical Properties. The physical properties ...

  13. Subscriptions

    African Journals Online (AJOL)

    3552629 (267-91. Email: Annual subscription rates: Nigeria (Individuals, N6000; Institutions, N8000), Africa (Individuals, £40; Institutions £60), United Kingdom and the rest of the world (Individuals, £48; Institutions ...

  14. Dicty_cDB: Contig-U12088-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0951 |pid:none) Synechococcus sp. PCC 7002, comp... 267 2e-69 CP001614_789( CP001614 |pid:none) Teredinibacter turner...utropha C91, comp... 244 2e-62 CP001614_790( CP001614 |pid:none) Teredinibacter turner

  15. A Comparison of Evidential Networks and Compositional Models

    Czech Academy of Sciences Publication Activity Database

    Vejnarová, Jiřina


    Roč. 50, č. 2 (2014), s. 246-267 ISSN 0023-5954 R&D Projects: GA ČR GA13-20012S Institutional support: RVO:67985556 Keywords : evidence theory * graphical models * conditional independence Subject RIV: BA - General Mathematics Impact factor: 0.541, year: 2014

  16. Necessary and sufficient conditions for consistency of M-estimates in regression models with general errors

    Czech Academy of Sciences Publication Activity Database

    Berlinet, A.; Liese, F.; Vajda, Igor


    Roč. 89, 1/2 (2000), s. 243-267 ISSN 0378-3758 R&D Projects: GA ČR GA102/99/1137 Institutional research plan: AV0Z1075907 Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.276, year: 2000

  17. Search for weakly decaying (Lambda n)over-bar and Lambda Lambda exotic bound states in central Pb-Pb collisions at root S-NN=2.76 TeV

    Czech Academy of Sciences Publication Activity Database

    Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Brož, M.; Čepila, J.; Contreras, J. G.; Eyyubova, G.; Ferencei, Jozef; Křelina, M.; Křížek, Filip; Kučera, Vít; Kushpil, Svetlana; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Schulc, M.; Špaček, M.; Šumbera, Michal; Vajzer, Michal; Vaňát, Tomáš; Závada, Petr


    Roč. 752, JAN (2016), s. 267-277 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13031 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * matter Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 4.807, year: 2016

  18. Book Review: The Printmaker | Louw | Tydskrif vir letterkunde

    African Journals Online (AJOL)

    Book Title: The Printmaker. Book Author: Bronwyn Law-Viljoen. Cape Town: Umuzi, 2016. 267 pp. ISBN 9781415209127. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  19. Sensitivity and specificity of the bioassay of estrogenicity in mammary gland and seminal vesicles of male mice

    Czech Academy of Sciences Publication Activity Database

    Škarda, Josef


    Roč. 51, č. 3 (2002), s. 267-276 ISSN 0862-8408 R&D Projects: GA ČR GA523/99/0843; GA AV ČR KSK5020115 Keywords : bioassay * estrogenicity * mammary gland Subject RIV: ED - Physiology Impact factor: 0.984, year: 2002

  20. Creep in ODS copper reinforced with alumina short fibres - DRS copper

    Czech Academy of Sciences Publication Activity Database

    Kuchařová, Květa; Zhu, S. J.; Čadek, Josef


    Roč. 355, 1-2 (2003), s. 267-276 ISSN 0921-5093 R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Creep * ODS copper * Load transfer Subject RIV: JI - Composite Materials Impact factor: 1.365, year: 2003

  1. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Nautiyal. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  2. 2012 Year-End Report on Neurotechnologies for In-Vehicle Applications (United States)


    Chris Stachowiak , and Kaleb McDowell ARL-SR-267 June 2013 Approved for public release...J. Lance, W. David Hairston, Greg Apker, Keith W. Whitaker, Scott E. Kerick, Chris Stachowiak , and Kaleb McDowell Human Research and Engineering...Kerick, Jason Metcalfe, * Christopher Manteuffel, * Matthew Jaswa, * Jonroy Canady, * Victor Paul, † Jennifer Ammori, † Chris Stachowiak , and

  3. Kalivodův zápas o marxismus bez pověr a iluzí

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef


    Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marxism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  4. 75 FR 32857 - State Vocational Rehabilitation Services Program (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF EDUCATION 34 CFR Part 361 State Vocational Rehabilitation Services Program CFR Correction In Title 34 of the Code of Federal Regulations, Parts 300 to 399, revised as of July 1, 2009, on page 267, in Sec. 361.42, in...

  5. Anion exchange nanofiber materials activated by daylight with a dual antibacterial effect

    Czech Academy of Sciences Publication Activity Database

    Plištil, L.; Henke, P.; Kubát, Pavel; Mosinger, Jiří


    Roč. 13, č. 9 (2014), s. 1321-1329 ISSN 1474-905X R&D Projects: GA ČR GA13-12496S Institutional support: RVO:61388955 ; RVO:61388980 Keywords : SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES * POLYSTYRENE Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.267, year: 2014

  6. Emotional Intelligence as a Predictor of Student Success in First-Year Master of Social Work Students (United States)

    Horne, Dana Meredith


    Emotional intelligence has been defined as "the ability to recognize the meanings of emotions and their relationships, and to reason and problem-solve on the basis of them" (Mayer, Caruso, & Salovey, 1999, p. 267). Despite the relevance of emotional intelligence to social work education, limited research has focused on the assessment…

  7. Thermally Induced Structural Transformations of Fe40Ni40P14B6 Amorphous Alloy

    Czech Academy of Sciences Publication Activity Database

    Vasić, M.; Roupcová, Pavla; Pizúrová, Naděžda; Stevanović, S.; Blagojević, V. A.; Žák, Tomáš; Minić, Dragica M.

    47A, č. 1 (2016), s. 260-267 ISSN 1073-5623 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Fe-Ni-P * soft-magnetic properties * metallic glasses * corrosion resistance * supercooled liquid * crystallization * phase * temperature * Mossbauer Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.874, year: 2016

  8. Association analysis of PRKAG3 gene variants with carcass and ...

    African Journals Online (AJOL)

    In this study, we detected four single nucleotide polymorphisms (SNPs) at the PRKAG3 gene (DQ082736) in 267 beef cattle. The SNP marker association analysis indicated that the SNP markers T2885C was significantly associated with tenderness trait. Animals with the TT genotype had lower Warner-Bratzler shear force ...

  9. In the past two decades, research interest has focused on the eddy ...

    African Journals Online (AJOL)


    400 m. 1 000 m. 2 267. ✶. Cape Columbine. Saldanha Bay. CAPE TOWN. Cape. Peninsula. Cape Point. 17°. 18°. E. 34°. S. ✶ Weather stations at ... 2) aided planning the ship's track. RESULTS OF THE FIELD MEASUREMENTS. Currents obtained from the ADCP. A schematic of the 8–72 m depth-averaged current patterns ...

  10. Recommendations of the International Medical Informatics Association (IMIA) on Education in Health and Medical Informatics

    Czech Academy of Sciences Publication Activity Database

    Arokiasamy, J.; Ball, M.; Barnett, D.; Bearman, M.; Bemmel van, J.; Douglas, J.; Fisher, P.; Garrie, R.; Gatewood, L.; Goossen, W.; Grant, A.; Hales, J.; Hasman, A.; Haux, R.; Hovenga, E.; Johns, M.; Knaup, P.; Leven, F. J.; Lorenzi, N.; Murray, P.; Neame, R.; Protti, D.; Power, M.; Richard, J.; Schuster, E.; Swinkels, W.; Yang, J.; Zelmer, L.; Zvárová, Jana


    Roč. 40, č. 5 (2001), s. 267-277 ISSN 0026-1270 Institutional research plan: AV0Z1030915 Keywords : health informatics * medical informatics * education * recommendations * International Medical Informatics Association * IMIA Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.254, year: 2001

  11. Cervical cancer in South Africa: An overview of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per year and 273 505 die from the disease.1. Globally it is the second most common cancer in women and the most common in developing countries. In Africa, which has a population of 267.9 million women aged 15 years or greater, it is

  12. Bibliography of Soviet Laser Developments. Number 42, July-August 1979. (United States)


    RZhRadiot, 8/79, 8Ye267) 469. Hajto, J., and P.J.S. Even (NS). Natural optical activity and related phenomena in AsS lass Kozponti fizikai kutate...and Yu.A. Yanayt (2). Measuring ligtht flux brightness using vacuum fluctuations as a reference. DAN SSSR, v. 247, no. 3, 1979, 586-590. 473. Linnik

  13. Bioenergetic Defects and Oxidative Damage in Transgenic Mouse Models of Neurodegenerative Disorders (United States)


    dehydrogenase; 5, aconitase; 6, succinate dehyrogenase; 7. cytochrome oxidase. found to be conserved throughout the brain in late encephalopathies ...Neurochem. (2003) 86, 267-272. Huntington’s disease (HD) is an autosomal dominant stereotypic movements, resting tremors and epileptic sei

  14. Two new species of Philometra (Nematoda: Philometridae) from needlefishes (Belonidae) in Iraq, with a key to Philometra spp. parasitic in the host’s subcutaneous tissue, fins and musculature

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.


    Roč. 52, č. 3 (2005), s. 267-273 ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005

  15. A highly diverse spectrum of naphthoquinone derivatives produced by the endophytic fungus Biatriospora sp CCF 4378

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav


    Roč. 60, č. 3 (2015), s. 259-267 ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.335, year: 2015

  16. Structural study of Pr.sub.0.8./sub.Na.sub.0.2./sub.MnO.sub.3./sub. at high pressure

    Czech Academy of Sciences Publication Activity Database

    Kozlenko, D. P.; Glazkov, V. P.; Jirák, Zdeněk; Savenko, B. N.


    Roč. 267, - (2003), s. 120-126 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : manganites * high pressures * crystal and magnetic structure * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

  17. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

  18. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal


    Roč. 267, 15 September (2015), s. 397-408 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sum s * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015

  19. 2,3-Dehydrosilybin A/B as a pro-longevity and anti-aggregation compound

    Czech Academy of Sciences Publication Activity Database

    Filippopoulou, K.; Papaevgeniou, N.; Lefakia, M.; Paraskevopoulou, A.; Biedermann, David; Křen, Vladimír; Chondrogianni, N.


    Roč. 103, FEB 2017 (2017), s. 256-267 ISSN 0891-5849 R&D Projects: GA MŠk(CZ) LD15081 Institutional support: RVO:61388971 Keywords : 2,3-dehydrosilybin A/B * Anti-aging * Anti-aggregation Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 5.606, year: 2016

  20. Raphidascaris (Ichthyascaris) arii sp n. (Nematoda: Anisakidae), a new ascaridoid nematode from marine catfishes in the Gulf of Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.


    Roč. 48, č. 4 (2011), 262-267 ISSN 0440-6605 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Raphidascaris * Ichthyascaris * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  1. Synthesis and characterization of super-microporous material with ...

    Indian Academy of Sciences (India)


    2001 J. Am. Chem. Soc. 123 1650. Serrano D P, Aguado J, Escola J M and Garagorri E 2000. Chem. Commun. 2041. Shpeizer B G, Clearfoeld A and Heising J M 2005 Chem. Commun. 2396. Shpeizer B G, Bakhmutov V I and Clearfield A 2006 Micro. Meso. Mater. 90 81. Tanev P T and Pinnavaia T J 1995 Science 267 865.

  2. Influence of diethyldithiocarbamate on cadmium and copper toxicity ...

    African Journals Online (AJOL)


    Daphnia magna. Environ. Technol. Lett. 5 109-120. ROBERT W (1984) The toxicity and bioaccumulation of cadmium and copper as affected by humic acid. Aquat. Toxicol. 5 267-274. WHITTON B and SHEHATA F (1982) Influence of cobalt, nickel, copper and cadmium on blue green alga Anacystis nidulans. Environ. Pollut.

  3. FAA Aviation Forecast Conference Proceedings (16th) (United States)


    Du Bois Prescott Pellston Franklin Sedona Brainerd Johnstown Chico Duluth Lancaster Concord Grand Rapids MN Latrobe El Centro /Imperial Hibbing Reading... Administrativo 800 Independence Ave., S.W. Paul D. Tuck Washington, DC 20591 Consultant (202) 267-7038 Consultant 5320 S. 5th Street Juergen Tooren

  4. Fabric transpositions in granite plutons - an insight from non-scaled analogue modelling

    Czech Academy of Sciences Publication Activity Database

    Kratinová, Zuzana; Machek, Matěj; Kusbach, V.


    Roč. 75, č. 1 (2010), s. 267-277 ISSN 0016-7622 R&D Projects: GA AV ČR KJB300120702 Institutional research plan: CEZ:AV0Z30120515 Keywords : analogue modelling * magmatic fabrics * granite intrusions * rheology * AMS Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.396, year: 2010

  5. Positive Behavior Support as Character Education: A Non-Experimental, Explanatory, Cross-Sectional Study (United States)

    O'Connell, Erin B.


    This study examined the impact of Positive Behavior Support (PBS) on office discipline referrals (Category 1), suspensions (Category 2), and absence of infractions (Category 3) in an urban public elementary school in New Jersey. A sample of 267 second, third, fourth, and fifth grade students provided the data for the research. A chi-square…

  6. Doubly-doped BaY.sub.2./sub.F.sub.8./sub.:Er,Nd VUV scintillator

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Nikl, Martin; Fukuda, K.; Kawaguchi, N.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Babin, V.


    Roč. 45, 3-6 (2010), s. 265-267 ISSN 1350-4487 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : energy transfer * luminescence * rare-earth fluorides * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.019, year: 2010

  7. Tectonic phase separation applied to the Sudetic Marginal Fault Zone (NE part of the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Nováková, Lucie


    Roč. 12, č. 2 (2015), s. 251-267 ISSN 1672-6316 R&D Projects: GA ČR GA205/09/1244 Institutional support: RVO:67985891 Keywords : Sudetic Marginal Fault Zone * paleostress reconstruction * active tectonics * frequency analysis Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.017, year: 2015

  8. KCTCCA, a peptide-based facilitator for bioelectrochemistry

    Indian Academy of Sciences (India)


    Department of Biological Sciences and Bioengineering, Indian Institute of Technology Kanpur,. Kanpur 208 016, India ... Ala) is an important addition to this group of biological facilitators. The sequence of ..... 347 267–275. Figure 4. Peptide array with a cross-sectional diagram (It = 0⋅7 nA; Vb = – 800 mV; scan range = 66 ×.

  9. Incidence of bovine cysticercosis in kano state, northwestern, Nigeria

    African Journals Online (AJOL)

    The incidence of infection due to Cysticercus bovis in Kano abattoir located in Fagge local government area (LGA) of Kano state, Nigeria was studied. Out of the 11,804 cattle which were examined, 315 (2.67%) were found to be infected. The tongue, cardiac and masseter muscles were the main predilection sites of the cysts ...

  10. Volné radikály v lidských vlasech

    Czech Academy of Sciences Publication Activity Database

    Stopka, Pavel; Křížová, Jana; Navrátilová, E.


    Roč. 10, č. 4 (2002), s. 262-267 ISSN 1210-7921 R&D Projects: GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z4032918 Keywords : human hair * melanin * EPR spectroscopy Subject RIV: CA - Inorganic Chemistry

  11. Survey of ectoparasite and ectoparasitic conditions, their ...

    African Journals Online (AJOL)

    A total of 112 goats were examined for ectoparasites and ectoparasitic conditions in December 2009 and January 2010 in Bukuru Livestock Market. Out of this figure, 7.14% were positive for Amblyomma variegatum, 0.89% and 2.67% were positive for Sarcoptes scabiei and nits (lice eggs) respectively. However, fleas were ...

  12. Do cyanobacterial Lipids contain Fatty Acids Longer Than 18 Carbon Atoms?

    Czech Academy of Sciences Publication Activity Database

    Iliev, I.; Petkov, G.; Lukavský, Jaromír; Furnadzhieva, S.; Andreeva, R.


    Roč. 66, 5-6 (2011), 267-276 ISSN 0939-5075 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chemotaxonomy * Cyanobacteria * Fatty Acids Subject RIV: EF - Botanics Impact factor: 0.772, year: 2011

  13. Introduction to special issue on the ecology of clonal plants

    Czech Academy of Sciences Publication Activity Database

    Gross, K. L.; Herben, T.; Klimešová, Jitka


    Roč. 52, 3-4 (2017), s. 265-267 ISSN 1211-9520 Institutional support: RVO:67985939 Keywords : Introduction to special issue * clonal plants * clonal meeting Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.017, year: 2016

  14. Cigarette smoking and Khat chewing among college students in ...

    African Journals Online (AJOL)

    Results: The study revealed 13.1 % life time prevalence rate of cigarette smoking and 26.7 % life time prevalence rate of khat chewing. ... Teachers in the high schools and colleges, parents, mass media and other concerned people should teach students about the health and social problems associated with cigarette ...

  15. Effect of in-situ TiC particulate on the wear resistance of spray-deposited 7075 Al matrix composite

    International Nuclear Information System (INIS)

    Wang Feng; Liu Huimin; Yang Bin


    TiC reinforced 7075 Al matrix composites have been fabricated by a melt in-situ reaction spray deposition. The microstructures of spray-deposited alloys were studied using scanning electron microscopy (SEM) and X-ray diffraction (XRD). The dry sliding wear behavior of the alloys was investigated using a pin-on-disc machine under four loads, namely 8.9, 17.8, 26.7 and 35.6 N. It has been found that the wear behavior of the alloys was dependent on the TiC content in the microstructure and the applied load. At a lower load (8.9 N), with increasing TiC content, the wear rate of the alloy was decreased. At a higher loads (26.7, 35.6 N), a spray-deposited 7075 Al alloy exhibited superior wear resistance to the 7075/TiC composites

  16. Note: Deep UV-pump THz-probe spectroscopy of the excess electron in water. (United States)

    Berger, Arian; Savolainen, Janne; Shalit, Andrey; Hamm, Peter


    In the work of Savolainen et al. [Nat. Chem. 6, 697 (2014)], we studied the excess (hydrated) electron in water with the help of transient THz spectroscopy, which is a sensitive probe of its delocalization length. In that work, we used laser pulses at 800 nm, 400 nm, and 267 nm for photoionization. While the detachment mechanism for 400 nm and 267 nm is complicated and requires a concerted nuclear rearrangement, we provided evidence that 800 nm pumping excites the excess electron directly and vertically into the conduction band, despite a highly nonlinear field-ionization process. In the present note, we extend that work to 200 nm pumping, which provides a much cleaner way to reach the conduction band. We show that the detachment pathways upon 200 nm and 800 nm pumping are in essence the same, as indicated by the same initial size of the electron wavefunction and the same time scales for the collapse of the wavefunction and geminate recombination.

  17. A cross-sectional survey of dental caries, oral hygiene, and Helicobacter pylori infection in adults. (United States)

    Liu, Peng; Yue, Ji; Han, Shufang; Deng, Tianzheng; Fu, Chongjian; Zhu, Guoxiong; Chen, Dong


    We explored the epidemiological risk factors for dental caries to help explain differences in the prevalence of adult dental caries. We examined 841 people for the presence of Helicobacter pylori in their dental plaque and for dental caries. Of the 841 subjects, 574 (68.25%) were infected with H pylori, and 516 (61.36%) were diagnosed with dental caries. Among the 574 subjects with H pylori, the prevalence of dental caries was 73.52% (422/574), while the prevalence among the 267 cases without H pylori was 35.21% (94/267). A correlation existed between the presence of H pylori and the occurrence of dental caries (χ(2) = 112.8, P oral cavity is associated with dental caries and poor dental hygiene.

  18. C Br bond fission dynamics in ultraviolet photodissociation of 1,2-dibromoethane (United States)

    Wang, Yanmei; Zhang, Song; Zheng, Qiusha; Zhang, Bing


    The photodissociation of 1,2-dibromoethane was studied at 234 and 267 nm using velocity map imaging technique. The speed distributions for the Br( 2P 3/2) and Br ∗( 2P 1/2) were determined and mostly fitted by two Gaussian curves indicating different product channels. The direct C-Br bond fission dominates the process and the recoil anisotropies suggest a transition mainly parallel to the C-Br bond. Vibrational structures are shown with ˜550 cm -1 spacing originating from C-Br stretching excitation of C 2H 4Br photofragment. The three-body dissociation channel is also found. The total product quantum yields were Φ234nm(Br ∗) = 0.14 and Φ267 nm (Br ∗) = 0.17, respectively.

  19. New prenylated carbazole alkaloids from Zanthoxylum armatum. (United States)

    Samad, Abdul; Badshah, Syed; Khan, Dilfaraz; Ali, Farman; Amanullah, Malik; Hanrahan, Jane


    A phytochemical investigation on the ethyl acetate soluble fraction of Zanthoxylum armatum led in the isolation of two new prenylated alkaloids 2,6,7-trimethoxy-8-(3-methyl-2-butenyl)carbazole-3-carbaldehyde (1) and methyl-2,6,7-trimethoxy-8-(3-methyl-2-butenyl)carbazole-3-carboxylate (2), along with three known lignans cisamin (3), methyl pirpirtol (4), and fargesin (5) and one known alkaloid dictamine (6). Their structures were established on the basis of spectroscopic and crystallographic analysis and by comparison of the data with those in the literature. All the isolated compounds were screened for the DPPH free radical scavenging activity. Compounds 1, 2, and 6 showed profound activity while compounds 3-5 showed moderate activity.

  20. Electron transfer mechanism and photochemistry of ferrioxalate induced by excitation in the charge transfer band. (United States)

    Chen, Jie; Zhang, Hua; Tomov, Ivan V; Rentzepis, Peter M


    The photoredox reaction of ferrioxalate after 266/267 nm excitation in the charge transfer band has been studied by means of ultrafast extended X-ray absorption fine structure (EXAFS) analysis, optical transient spectroscopy, and quantum chemistry calculations. The Fe-O bond length changes combined with the transient spectra and kinetics have been measured and in combination with ultrahigh frequency density functional theory (UHF/DFT) calculations are used to determine the photochemical mechanism for the Fe(III) to Fe(II) redox reaction. The present data and the results obtained with 266/267 nm excitations strongly suggest that the primary reaction is the dissociation of the Fe-O bond before intramolecular electron transfer occurs. Low quantum yield electron photodetachment from ferrioxalate has also been observed.