WorldWideScience

Sample records for bohrium 265

  1. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  2. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  4. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  5. PSY 265 Course Tutorial / Snaptutorial

    OpenAIRE

    Aster

    2015-01-01

    PSY 265 Week 1 Checkpoint  Sexuality and Value Systems PSY 265 Week 1 CheckPoint Critical Thinking and Sexual Decision Making PSY 265 Week 1 Assignment The Sperm and the Egg PSY 265 Week 2 DQ 1 and DQ 2 PSY 265 Week 2 CheckPoint The Sexual Response Cycle Questions (Appendix B) PSY 265 Week 3 CheckPoint Sexual Dysfunction PSY 265 Week 3 Assignment Gender Identity PSY 265 Week 4 DQ 1 and DQ 2 PSY 265 Week 4 checkpoint style of love set PSY 265 Week 5 che...

  6. New isotope 265Bh

    International Nuclear Information System (INIS)

    A new isotope 265Bh was produced and identified at the Sector Focus Cyclotron of the Heavy Ion Research Facility in Lanzhou. This experiment was performed via the reaction of an 243Am target with 168 MeV 26Mg ions. Identification was made by observation of correlated α -particle decays between the new isotope 265Bh and its 261Db and 257Lr daughter nuclei using a set of rotating-wheels system. A total of 8 correlated decay events of 265Bh and 4 decay events of 264Bh were observed. 265Bh decays with a 0.94 -0.31+0.70 s half-life by emission of α-particles with an average energy of 9.24 ±0.05 MeV. The half-life and α decay energy of 265Bh from this experiment are in agreement with theoretical predictions. (orig.)

  7. PSY 265 UOP Courses / uoptutorial

    OpenAIRE

    jain

    2015-01-01

    For more course tutorials visit www.uoptutorial.com     PSY 265 Week 1 Checkpoint  Sexuality and Value Systems PSY 265 Week 1 CheckPoint Critical Thinking and Sexual Decision Making PSY 265 Week 1 Assignment The Sperm and the Egg PSY 265 Week 2 DQ 1 and DQ 2 PSY 265 Week 2 CheckPoint The Sexual Response Cycle Questions (Appendix B) PSY 265 Week 3 CheckPoint Sexual Dysfunction PSY 265 Week 3 Assignment Gender Identity PSY 265 Week 4 DQ...

  8. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  9. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  10. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  11. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  12. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  13. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  14. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  15. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  16. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  17. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  18. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  19. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  20. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  1. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  2. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  3. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  4. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  5. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  6. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  7. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  8. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  9. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  10. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  11. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  12. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  13. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  14. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  15. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  16. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  17. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  18. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  19. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  20. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  1. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  2. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  3. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  4. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  5. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  6. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  7. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  8. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  9. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  10. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  11. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  12. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  13. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  14. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  15. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  16. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  17. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  18. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  19. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  20. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  1. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  2. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  3. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  4. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  5. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  6. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  7. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  8. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  9. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  10. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  11. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  12. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  13. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  14. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  15. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  16. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  17. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  18. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  19. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  20. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  1. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  2. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  3. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  4. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  5. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  6. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  7. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  8. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  9. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  10. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  11. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  12. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  13. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  14. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  15. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  16. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  17. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  18. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  19. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  20. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  1. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  2. 40 CFR 265.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and...

  3. 40 CFR 265.252 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.252 Section 265... FACILITIES Waste Piles § 265.252 Waste analysis. In addition to the waste analyses required by § 265.13, the... in the pile to which it is to be added. The analysis conducted must be capable of...

  4. 40 CFR 265.375 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.375 Section 265... FACILITIES Thermal Treatment § 265.375 Waste analysis. In addition to the waste analyses required by § 265.13... of pollutants which might be emitted. At a minimum, the analysis must determine: (a) Heating value...

  5. New isotope {sup 265}Bh

    Energy Technology Data Exchange (ETDEWEB)

    Gan, Z.G.; Guo, J.S.; Wu, X.L.; Qin, Z.; Fan, H.M.; Lei, X.G.; Liu, H.Y.; Guo, B.; Xu, H.G.; Chen, R.F.; Dong, C.F.; Zhang, F.M.; Wang, H.L.; Xie, C.Y.; Feng, Z.Q.; Zhen, Y.; Song, L.T.; Luo, P.; Xu, H.S.; Zhou, X.H. [Institute of Modern Physics, Chinese Academy of Sciences, 730000, Lanzhou (China); Jin, G.M.; Ren, Zhongzhou

    2004-06-01

    A new isotope {sup 265}Bh was produced and identified at the Sector Focus Cyclotron of the Heavy Ion Research Facility in Lanzhou. This experiment was performed via the reaction of an {sup 243}Am target with 168 MeV {sup 26}Mg ions. Identification was made by observation of correlated {alpha} -particle decays between the new isotope {sup 265}Bh and its {sup 261}Db and {sup 257}Lr daughter nuclei using a set of rotating-wheels system. A total of 8 correlated decay events of {sup 265}Bh and 4 decay events of {sup 264}Bh were observed. {sup 265}Bh decays with a 0.94 {sub -0.31}{sup +} {sup 0.70} s half-life by emission of {alpha}-particles with an average energy of 9.24 {+-}0.05 MeV. The half-life and {alpha} decay energy of {sup 265}Bh from this experiment are in agreement with theoretical predictions. (orig.)

  6. 40 CFR 1065.265 - Nonmethane cutter.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Nonmethane cutter. 1065.265 Section 1065.265 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Hydrocarbon Measurements § 1065.265 Nonmethane...

  7. 40 CFR 265.14 - Security.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Security. 265.14 Section 265.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS... Facility Standards § 265.14 Security. (a) The owner or operator must prevent the unknowing entry,...

  8. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265.273 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by §...

  9. 40 CFR 265.16 - Personnel training.

    Science.gov (United States)

    2010-07-01

    ... Administration (OSHA) regulations 29 CFR 1910.120(p)(8) and 1910.120(q), the facility is not required to provide... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Personnel training. 265.16 Section 265... FACILITIES General Facility Standards § 265.16 Personnel training. (a)(1) Facility personnel...

  10. 15 CFR 265.41 - Gambling.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Gambling. 265.41 Section 265.41..., GAITHERSBURG, MARYLAND, AND BOULDER AND FORT COLLINS, COLORADO Buildings and Grounds § 265.41 Gambling. No... gambling devices, the conduct of lotteries or pools, or in the selling or purchasing of numbers tickets,...

  11. 40 CFR 265.223 - Containment system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Containment system. 265.223 Section 265.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Surface Impoundments § 265.223 Containment system. All earthen dikes must have a protective...

  12. 40 CFR 265.18 - Location standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Location standards. 265.18 Section 265...) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES General Facility Standards § 265.18 Location standards. The placement of any hazardous waste in...

  13. 40 CFR 265.253 - Containment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Containment. 265.253 Section 265.253 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS... Piles § 265.253 Containment. If leachate or run-off from a pile is a hazardous waste, then either:...

  14. 40 CFR 265.1053 - Standards: Compressors.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Standards: Compressors. 265.1053... DISPOSAL FACILITIES Air Emission Standards for Equipment Leaks § 265.1053 Standards: Compressors. (a) Each compressor shall be equipped with a seal system that includes a barrier fluid system and that...

  15. 40 CFR 265.11 - Identification number.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Identification number. 265.11 Section... FACILITIES General Facility Standards § 265.11 Identification number. Every facility owner or operator must apply to EPA for an EPA identification number in accordance with the EPA notification procedures (45...

  16. 25 CFR 265.3 - Roads prohibited.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Roads prohibited. 265.3 Section 265.3 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HERITAGE PRESERVATION ESTABLISHMENT OF ROADLESS AND WILD AREAS..., unless the requirements of fire protection, commercial use for the Indians' benefit or actual needs...

  17. 39 CFR 265.10 - Annual report.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Annual report. 265.10 Section 265.10 Postal... Annual report. A report concerning the administration of the Freedom of Information Act and this part..., with the first such report, for fiscal year 1998, due on or before February 1, 1999. Data for...

  18. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  19. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  20. Dicty_cDB: SSA265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA265 (Link to dictyBase) - - - Contig-U15010-1 SSA265F (Link to Original site) SSA...265F 355 - - - - - - Show SSA265 Library SS (Link to library) Clone ID SSA265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA265Q.Seq.d/ Representative seq. ID SSA26...5F (Link to Original site) Representative DNA sequence >SSA265 (SSA265Q) /CSM/SS/SSA2-C/SSA265Q.Seq.d/ CAAAG...SM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA265 (SSA265Q) /CSM/SS/SSA2-C/SSA

  1. 46 CFR 28.265 - Emergency instructions.

    Science.gov (United States)

    2010-10-01

    ... Than 16 Individuals On Board, or for Fish Tender Vessels Engaged in the Aleutian Trade § 28.265... directing them to their appointed stations. (vi) Manning of fire parties assigned to deal with fires....

  2. 40 CFR 265.1200 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Hazardous Waste Munitions and Explosives Storage § 265.1200 Applicability. The requirements of... 40 CFR 266.205 for storage of waste military munitions)....

  3. Dicty_cDB: SLB265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB265 (Link to dictyBase) - - - Contig-U16455-1 SLB265Z (Link... to Original site) - - SLB265Z 632 - - - - Show SLB265 Library SL (Link to library) Clone ID SLB265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-C/SLB265Q.Seq.d/ Representative seq. ID SLB26...5Z (Link to Original site) Representative DNA sequence >SLB265 (SLB265Q) /CSM/SL/SLB2-C/SLB265Q.Seq.d/ XXXXX...AY643816 |pid:none) Lycogala epidendrum elongation fac... 261 2e-68 AY582829_1( AY582829 |pid:none) Acanthamoeba culb

  4. 43 CFR 26.5 - Administrative requirements.

    Science.gov (United States)

    2010-10-01

    ..., disadvantaged, non-public school youth, and youth having left school before graduation; (2) That selections will... that enrollment will not interfere with the established educational systems. (e) The enrollee is an... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Administrative requirements. 26.5...

  5. 40 CFR 265.404 - Closure.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Chemical, Physical, and Biological Treatment § 265.404 Closure. At closure, all hazardous waste and hazardous...

  6. 40 CFR 265.381 - Closure.

    Science.gov (United States)

    2010-07-01

    ... STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Thermal Treatment § 265.381 Closure. At closure, the owner or operator must remove all hazardous waste and hazardous waste residues (including, but not limited to, ash) from the thermal treatment process or equipment....

  7. 40 CFR 265.4 - Imminent hazard action.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Imminent hazard action. 265.4 Section 265.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES General § 265.4 Imminent hazard action. Notwithstanding any other provisions of these...

  8. 45 CFR 265.1 - What does this part cover?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What does this part cover? 265.1 Section 265.1 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES DATA COLLECTION AND REPORTING REQUIREMENTS § 265.1 What does...

  9. 40 CFR 265.150 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false State assumption of responsibility. 265.150 Section 265.150 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID..., STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.150 State assumption of responsibility....

  10. 25 CFR 265.1 - Definition of roadless area.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Definition of roadless area. 265.1 Section 265.1 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HERITAGE PRESERVATION ESTABLISHMENT OF ROADLESS AND WILD AREAS ON INDIAN RESERVATIONS § 265.1 Definition of roadless area. A roadless area has been...

  11. 40 CFR 265.370 - Other thermal treatment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Other thermal treatment. 265.370... DISPOSAL FACILITIES Thermal Treatment § 265.370 Other thermal treatment. The regulations in this subpart... enclosed devices using controlled flame combustion, except as § 265.1 provides otherwise. Thermal...

  12. 18 CFR 284.265 - Cost recovery by interstate pipeline.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cost recovery by interstate pipeline. 284.265 Section 284.265 Conservation of Power and Water Resources FEDERAL ENERGY... § 284.265 Cost recovery by interstate pipeline. (a) Except as provided in paragraph (b), an...

  13. 40 CFR 265.276 - Food chain crops.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Food chain crops. 265.276 Section 265... FACILITIES Land Treatment § 265.276 Food chain crops. (a) An owner or operator of a hazardous waste land treatment facility on which food chain crops are being grown, or have been grown and will be grown in...

  14. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  15. 21 CFR 26.5 - Length of transition period.

    Science.gov (United States)

    2010-04-01

    ... RECOGNITION OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE QUALITY SYSTEM AUDIT REPORTS... Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.5 Length of...

  16. Dicty_cDB: VFG265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFG265 (Link to dictyBase) - - - Contig-U15354-1 VFG265Z (Link to Original ... yairsnssny*sigkewsh*rsn*si*n**slcicsfrlekgiky*fr*n*skw ... wcnrtwssircnwlysyd*ngk*irkik*kirtsnnvywfwssncnny*k ...

  17. 39 CFR 265.5 - Public reading rooms.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Public reading rooms. 265.5 Section 265.5 Postal... reading rooms. The Library of the Postal Service Headquarters, 475 L'Enfant Plaza SW, Washington, DC 20260-1641, serves as public reading room for the materials which are listed in paragraphs (a)(2), (3),...

  18. 40 CFR 265.142 - Cost estimate for closure.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Cost estimate for closure. 265.142... DISPOSAL FACILITIES Financial Requirements § 265.142 Cost estimate for closure. (a) The owner or operator must have a detailed written estimate, in current dollars, of the cost of closing the facility...

  19. 24 CFR 241.265 - Insurance of property against flood.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of property against flood. 241.265 Section 241.265 Housing and Urban Development Regulations Relating to Housing and Urban... Insurance of property against flood. The mortgaged property shall be insured against flood as stipulated...

  20. 40 CFR 265.92 - Sampling and analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Sampling and analysis. 265.92 Section... FACILITIES Ground-Water Monitoring § 265.92 Sampling and analysis. (a) The owner or operator must obtain and... follow a ground-water sampling and analysis plan. He must keep this plan at the facility. The plan...

  1. 40 CFR 265.35 - Required aisle space.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Required aisle space. 265.35 Section... FACILITIES Preparedness and Prevention § 265.35 Required aisle space. The owner or operator must maintain aisle space to allow the unobstructed movement of personnel, fire protection equipment, spill...

  2. 40 CFR 265.173 - Management of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Management of containers. 265.173... DISPOSAL FACILITIES Use and Management of Containers § 265.173 Management of containers. (a) A container... waste. (b) A container holding hazardous waste must not be opened, handled, or stored in a manner...

  3. 40 CFR 265.171 - Condition of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 265.171... DISPOSAL FACILITIES Use and Management of Containers § 265.171 Condition of containers. If a container... transfer the hazardous waste from this container to a container that is in good condition, or manage...

  4. 27 CFR 28.265 - Evidence of fraud.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Evidence of fraud. 28.265 Section 28.265 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT... fraud. If the customs inspection discloses evidence of fraud, the customs officer shall detain...

  5. 30 CFR 206.265 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.265... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.265 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed...

  6. 40 CFR 265.53 - Copies of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Copies of contingency plan. 265.53... DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.53 Copies of contingency plan. A copy of the contingency plan and all revisions to the plan must be: (a) Maintained at the facility; and...

  7. 40 CFR 265.54 - Amendment of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Amendment of contingency plan. 265.54... DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.54 Amendment of contingency plan. The contingency plan must be reviewed, and immediately amended, if necessary, whenever: (a) Applicable...

  8. Dicty_cDB: SFI265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI265 (Link to dictyBase) - - - Contig-U15579-1 SFI265P (Link to Original ... XXXXXXXXXTTAGTANAATCTTGTGAAATAGGTTTTGGTTGTCT TGCAATTCC AAAAAATTGTAATGATAATGATCC ATGTACCACTGATCATTGTGATCC AGC ... TTGTGATGCATGTAATGCTGTAGATACTTG TATTACAAATGATTTATGCTTCC CAAGGGAATGTAATCC AAGAGGGAACCCACCTTGTTT AATAAACCCTATT ... AATTGTACAAGCACTGATCC ATGCATTTTTTCATATTGTGAAAATGG TGTATGTATTCC AACATACATTT ... GTACTCC AACTCC ATCTGTAACTCC AACTGTTACCCC AACTGTTACTCC AACTGTTA ...

  9. Evidence for isotope 265Bh(Z=107)

    International Nuclear Information System (INIS)

    New isotope 265Bh (Z=107) was produced in bombardment of a 243Am target with 135 MeV 26Mg ions at HIRFL. Identification was made by observation of correlated α-particle decays between the new isotope 265Bh and its 261Db and 257Lr daughters with four pairs of detectors. The experimental results show that the half-life of 265Bh is 0.94-0.31+0.70 s and its α energy is (9.24 ± 0.05) MeV. (authors)

  10. 27 CFR 26.265 - Determination of tax on articles.

    Science.gov (United States)

    2010-04-01

    ... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Procedure at Port of Entry From the Virgin Islands § 26.265 Determination of tax on articles. Where...

  11. Dicty_cDB: CFJ265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ265 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv*ekviy*elkiffhlqevllnvvykv fqifilninhyymif*ivf *rtn*kkplihtyqqlnqerdhkm*lylwlvvslmkrh*pf tllil*ilv ...

  12. 15 CFR 265.43 - Pets and other animals.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Pets and other animals. 265.43 Section... animals. Except in connection with the conduct of official business on the site or with the approval of... person shall bring upon the site any cat, dog, or other animal, provided, however, that blind persons...

  13. 40 CFR 265.315 - Special requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for containers..., STORAGE, AND DISPOSAL FACILITIES Landfills § 265.315 Special requirements for containers. Unless they are very small, such as an ampule, containers must be either: (a) At least 90 percent full when placed...

  14. 40 CFR 421.265 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... Metals Subcategory § 421.265 Pretreatment standards for existing sources. Except as provided in 40 CFR... publicly owned treatment works must comply with 40 CFR part 403 and achieve the following pretreatment... alkaline wet air pollution control scrubbers. If both acid and alkaline wet air pollution control...

  15. 40 CFR 265.401 - General operating requirements.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND.... (a) Chemical, physical, or biological treatment of hazardous waste must comply with § 265.17(b). (b) Hazardous wastes or treatment reagents must not be placed in the treatment process or equipment if...

  16. 40 CFR 265.1201 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Hazardous Waste Munitions and Explosives Storage § 265.1201 Design and operating standards. (a) Hazardous waste munitions and explosives storage units must be designed...

  17. 40 CFR 265.373 - General operating requirements.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Thermal Treatment § 265.373 General operating requirements. Before adding hazardous waste, the owner or operator must bring his thermal treatment process to steady state...

  18. 40 CFR 265.225 - Waste analysis and trial tests.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND... the different process: (i) Conduct waste analyses and trial treatment tests (e.g., bench scale or... waste under similar operating conditions; to show that this treatment will comply with § 265.17(b). (b)...

  19. 15 CFR 265.37 - Narcotics and other drugs.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Narcotics and other drugs. 265.37... other drugs. The possession, sale, consumption, or use on the site of narcotic or other drugs illegal... with respect to the possession, sale, consumption, or use of narcotic or other drugs....

  20. 27 CFR 20.265 - Retention of invoices.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Retention of invoices. 20....265 Retention of invoices. (a) Any person required to keep records under this part shall retain copies of invoices which will enable appropriate TTB officers to readily obtain the details regarding:...

  1. 40 CFR 265.52 - Content of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... Section 265.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND... incorporate hazardous waste management provisions that are sufficient to comply with the requirements of...

  2. 40 CFR 265.112 - Closure plan; amendment of plan.

    Science.gov (United States)

    2010-07-01

    ... closure plan must include, at least: (1) A description of how each hazardous waste management unit at the....112 Section 265.112 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... to provisions of this section, the owner or operator of a hazardous waste management facility...

  3. 41 CFR 102-38.265 - Must we keep records on administrative determinations?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must we keep records on administrative determinations? 102-38.265 Section 102-38.265 Public Contracts and Property Management Federal... OF PERSONAL PROPERTY Bids Mistakes in Bids § 102-38.265 Must we keep records on...

  4. 45 CFR 265.2 - What definitions apply to this part?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What definitions apply to this part? 265.2 Section 265.2 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES DATA COLLECTION AND REPORTING REQUIREMENTS § 265.2...

  5. 40 CFR Appendix V to Part 265 - Examples of Potentially Incompatible Waste

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Examples of Potentially Incompatible Waste V Appendix V to Part 265 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED..., STORAGE, AND DISPOSAL FACILITIES Pt. 265, App. V Appendix V to Part 265—Examples of...

  6. 40 CFR 265.278 - Unsaturated zone (zone of aeration) monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Unsaturated zone (zone of aeration) monitoring. 265.278 Section 265.278 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED..., STORAGE, AND DISPOSAL FACILITIES Land Treatment § 265.278 Unsaturated zone (zone of aeration)...

  7. 40 CFR 265.51 - Purpose and implementation of contingency plan.

    Science.gov (United States)

    2010-07-01

    ... contingency plan. 265.51 Section 265.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED..., STORAGE, AND DISPOSAL FACILITIES Contingency Plan and Emergency Procedures § 265.51 Purpose and implementation of contingency plan. (a) Each owner or operator must have a contingency plan for his facility....

  8. 40 CFR 265.352 - Interim status incinerators burning particular hazardous wastes.

    Science.gov (United States)

    2010-07-01

    ... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Incinerators § 265.352 Interim status incinerators burning particular hazardous wastes. (a) Owners or operators of incinerators subject to this... particular hazardous wastes. 265.352 Section 265.352 Protection of Environment ENVIRONMENTAL...

  9. 15 CFR 265.42 - Photography for advertising or commercial purposes; advertising and soliciting.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Photography for advertising or commercial purposes; advertising and soliciting. 265.42 Section 265.42 Commerce and Foreign Trade Regulations... COLLINS, COLORADO Buildings and Grounds § 265.42 Photography for advertising or commercial...

  10. 21 CFR 1271.265 - Receipt, predistribution shipment, and distribution of an HCT/P.

    Science.gov (United States)

    2010-04-01

    ... distribution of an HCT/P. 1271.265 Section 1271.265 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... Practice § 1271.265 Receipt, predistribution shipment, and distribution of an HCT/P. (a) Receipt. You must evaluate each incoming HCT/P for the presence and significance of microorganisms and inspect for damage...

  11. Dicty_cDB: SSM265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 |BB233380.1 Mus musculus 3 days neonate thymus cDNA, RIKEN full-length enriched library, clone:A630043E17, 3' end partial..._1( AF084426 |pid:none) Synthetic construct calmodulin mut... 97 2e-19 DQ122882_1( DQ122882 |pid:none) Chlamydomonas incerta cal... : 0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 40.0 %: cytoplasmic 28.0 %: nuclear 12.0 %: cytoskeletal 4.0...SS (Link to library) SSM265 (Link to dictyBase) - - - Contig-U14946-1 SSM265E (Link to Original...GDYLSTAEVDELF KEISVDSTTGAVSYASLVNTIVSGYPLGGF*iiii*kkkkkkkmkfifkls*nr Homology vs CSM-cDNA Score E Sequences producing significant ali

  12. Theoretical Study on Properties of New Isotope 265Bh

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  13. Dicty_cDB: VSF265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwxxc*sp lsx Trans...DMTIKIADFGLSKIFG TGXALXTSCGTPDYVAPEVLTGGSYDNAVDMWSIGVITYILLCGFPPFLCFISXLII*kn fxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw...m... 134 2e-43 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... 135 6e-43 (Q8BW96) RecName: Full=Calcium/cal...e-42 AB076903_1( AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 132 4e-42 protein update 2009. 7....VS (Link to library) VSF265 (Link to dictyBase) - - - Contig-U11996-1 VSF265Z (Link to Original

  14. Theoretical Study on Properties of New Isotope 265Bh

    International Nuclear Information System (INIS)

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blocked BCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265Bh is studied and some new magic numbers are found, while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The α-decay lifetimes in the 265Bh decay chain are evaluated by different formulae, and compared with experimental data. The methods which give good agreement with the data are selected.

  15. Research of Video Steganalysis Algorithm Based on H265 Protocol

    Directory of Open Access Journals (Sweden)

    Wu Kaicheng

    2015-01-01

    This paper researches LSB matching VSA based on H265 protocol with the research background of 26 original Video sequences, it firstly extracts classification features out from training samples as input of SVM, and trains in SVM to obtain high-quality category classification model, and then tests whether there is suspicious information in the video sample. The experimental results show that VSA algorithm based on LSB matching can be more practical to obtain all frame embedded secret information and carrier and video of local frame embedded. In addition, VSA adopts the method of frame by frame with a strong robustness in resisting attack in the corresponding time domain.

  16. 40 CFR 265.441 - Assessment of existing drip pad integrity.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Assessment of existing drip pad..., STORAGE, AND DISPOSAL FACILITIES Drip Pads § 265.441 Assessment of existing drip pad integrity. (a) For each existing drip pad as defined in § 265.440, the owner or operator must evaluate the drip pad...

  17. 40 CFR 265.144 - Cost estimate for post-closure care.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Cost estimate for post-closure care..., STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.144 Cost estimate for post-closure care. (a....280, and 265.310. (1) The post-closure cost estimate must be based on the costs to the owner...

  18. 39 CFR Appendix A to Part 265 - Fees for Computer Searches

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Fees for Computer Searches A Appendix A to Part... Pt. 265, App. A Appendix A to Part 265—Fees for Computer Searches When requested information must be retrieved by computer, fees charged to the requester are based on rates for personnel and computer...

  19. 40 CFR 265.114 - Disposal or decontamination of equipment, structures and soils.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Disposal or decontamination of equipment, structures and soils. 265.114 Section 265.114 Protection of Environment ENVIRONMENTAL PROTECTION... decontamination of equipment, structures and soils. During the partial and final closure periods, all...

  20. 40 CFR 265.1033 - Standards: Closed-vent systems and control devices.

    Science.gov (United States)

    2010-07-01

    ... 40 CFR part 264 subpart X; or (ii) The unit is equipped with and operating air emission controls in... sealed (e.g., a welded joint between two sections of hard piping or a bolted and gasketed ducting flange... control devices. 265.1033 Section 265.1033 Protection of Environment ENVIRONMENTAL PROTECTION...

  1. 15 CFR 265.5 - Laws of Maryland and Colorado applicable.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Laws of Maryland and Colorado applicable. 265.5 Section 265.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade... States. The applicability of State laws shall not, however, affect or abrogate any other Federal law...

  2. 40 CFR 265.316 - Disposal of small containers of hazardous waste in overpacked drums (lab packs).

    Science.gov (United States)

    2010-07-01

    ... OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Landfills § 265.316 Disposal of small containers of hazardous waste in overpacked drums (lab packs). Small containers of hazardous waste... hazardous waste in overpacked drums (lab packs). 265.316 Section 265.316 Protection of...

  3. A long-duration dihydroorotate dehydrogenase inhibitor (DSM265) for prevention and treatment of malaria.

    Science.gov (United States)

    Phillips, Margaret A; Lotharius, Julie; Marsh, Kennan; White, John; Dayan, Anthony; White, Karen L; Njoroge, Jacqueline W; El Mazouni, Farah; Lao, Yanbin; Kokkonda, Sreekanth; Tomchick, Diana R; Deng, Xiaoyi; Laird, Trevor; Bhatia, Sangeeta N; March, Sandra; Ng, Caroline L; Fidock, David A; Wittlin, Sergio; Lafuente-Monasterio, Maria; Benito, Francisco Javier Gamo; Alonso, Laura Maria Sanz; Martinez, Maria Santos; Jimenez-Diaz, Maria Belen; Bazaga, Santiago Ferrer; Angulo-Barturen, Iñigo; Haselden, John N; Louttit, James; Cui, Yi; Sridhar, Arun; Zeeman, Anna-Marie; Kocken, Clemens; Sauerwein, Robert; Dechering, Koen; Avery, Vicky M; Duffy, Sandra; Delves, Michael; Sinden, Robert; Ruecker, Andrea; Wickham, Kristina S; Rochford, Rosemary; Gahagen, Janet; Iyer, Lalitha; Riccio, Ed; Mirsalis, Jon; Bathhurst, Ian; Rueckle, Thomas; Ding, Xavier; Campo, Brice; Leroy, Didier; Rogers, M John; Rathod, Pradipsinh K; Burrows, Jeremy N; Charman, Susan A

    2015-07-15

    Malaria is one of the most significant causes of childhood mortality, but disease control efforts are threatened by resistance of the Plasmodium parasite to current therapies. Continued progress in combating malaria requires development of new, easy to administer drug combinations with broad-ranging activity against all manifestations of the disease. DSM265, a triazolopyrimidine-based inhibitor of the pyrimidine biosynthetic enzyme dihydroorotate dehydrogenase (DHODH), is the first DHODH inhibitor to reach clinical development for treatment of malaria. We describe studies profiling the biological activity, pharmacological and pharmacokinetic properties, and safety of DSM265, which supported its advancement to human trials. DSM265 is highly selective toward DHODH of the malaria parasite Plasmodium, efficacious against both blood and liver stages of P. falciparum, and active against drug-resistant parasite isolates. Favorable pharmacokinetic properties of DSM265 are predicted to provide therapeutic concentrations for more than 8 days after a single oral dose in the range of 200 to 400 mg. DSM265 was well tolerated in repeat-dose and cardiovascular safety studies in mice and dogs, was not mutagenic, and was inactive against panels of human enzymes/receptors. The excellent safety profile, blood- and liver-stage activity, and predicted long half-life in humans position DSM265 as a new potential drug combination partner for either single-dose treatment or once-weekly chemoprevention. DSM265 has advantages over current treatment options that are dosed daily or are inactive against the parasite liver stage. PMID:26180101

  4. OPERATING PRACTICE OF 265M2 SINTERING MACHINE WITHOUT H~)T SCREEN IN TANGSHAN I&S CO.%唐钢265m2烧结机无热筛生产实践

    Institute of Scientific and Technical Information of China (English)

    张义明

    2001-01-01

    简要介绍了唐钢265m2烧结机无热筛工艺的设计特点,国内外无热筛烧结生产现状及265m2烧结机投产后,生产组织、岗位操作及指标的完成情况。%In this paper, the design characteristics of 265m2 sintering machinc without hot screen in Tangshan I&SCo. , the present production state without hot screen at home and abroad, the technicoecnomic indices since 265m2 sintering machine commissioning were presented

  5. Ground state properties of the newly discovered nucleus 265Bh and it's alpha decay chain

    International Nuclear Information System (INIS)

    The properties of the nuclei belonging to the newly discovered alpha-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean field (RMF) calculation with the force TMA and NL-Z2 has been performed in the blocked BCS approximation. Some ground state properties such as the binding energies, deformations, spins and parties, as well as Q-values of the alpha decay for this decay chain have been calculated and compared with known experimental data. Good agreement is observed. The single-particle spectrum of the nucleus 265Bh has been studied. (authors)

  6. Atomic Mass and NuclearBinding Energy for Uup-265(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-265 (Ununpentium, atomic number Z = 115, mass number A = 265).

  7. 12 CFR 265.8 - Functions delegated to the Staff Director of the Division of International Finance.

    Science.gov (United States)

    2010-01-01

    ... the Division of International Finance. 265.8 Section 265.8 Banks and Banking FEDERAL RESERVE SYSTEM... Functions delegated to the Staff Director of the Division of International Finance. The Board's Staff Director of the Division of International Finance (or the Director's delegee) is authorized:...

  8. 40 CFR Appendix Vi to Part 265 - Compounds With Henry's Law Constant Less Than 0.1 Y/X

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Compounds With Henry's Law Constant... TREATMENT, STORAGE, AND DISPOSAL FACILITIES Pt. 265, App. VI Appendix VI to Part 265—Compounds With Henry's Law Constant Less Than 0.1 Y/X Compound name CAS No. Acetaldol 107-89-1 Acetamide 60-35-5...

  9. 20 CFR 416.265 - Requirements for the special SSI eligibility status.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Requirements for the special SSI eligibility... Disabling Impairment § 416.265 Requirements for the special SSI eligibility status. In order to be eligible for the special SSI eligibility status, you must have been eligible to receive a regular SSI...

  10. 40 CFR 265.310 - Closure and post-closure care.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL FACILITIES Landfills § 265.310 Closure and post-closure care. (a) At final closure of the landfill or upon closure of any cell, the owner or operator must cover the landfill or cell with a final cover... landfill; (2) Function with minimum maintenance; (3) Promote drainage and minimize erosion or abrasion...

  11. 40 CFR 265.1202 - Closure and post-closure care.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Hazardous Waste Munitions and Explosives Storage § 265.1202 Closure and post-closure care. (a) At closure of a magazine or unit which stored hazardous waste under this...

  12. 40 CFR 265.383 - Interim status thermal treatment devices burning particular hazardous waste.

    Science.gov (United States)

    2010-07-01

    ... OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Thermal Treatment § 265.383 Interim status thermal treatment devices burning particular hazardous waste. (a) Owners or operators of thermal treatment devices subject to this subpart may burn EPA Hazardous Wastes FO20, FO21, FO22, FO23, FO26,...

  13. 20 CFR 645.265 - What safeguards are there to ensure that participants in Welfare-to-Work employment activities do...

    Science.gov (United States)

    2010-04-01

    ...) of this subpart, must not violate existing contracts for services or collective bargaining agreements... participants in Welfare-to-Work employment activities do not displace other employees? 645.265 Section 645.265...-TO-WORK GRANTS General Program and Administrative Requirements § 645.265 What safeguards are there...

  14. Production and Identification of New Isotope 265Bh(Z=107)

    Institute of Scientific and Technical Information of China (English)

    FanHongmei; WuXiaolei; GanZaiguo; GuoJunsheng; QinZhi; LeiXiangguo; LiuHongye; GuoBin; XuHuageng; ChenRuofu; DongChengfu; ZhangFuming; WangHualei; XieChengying; FengZhaoqing; ZhenYong; SongLitao; LuoPeng; XuHushan; ZhouXiaohong; JinGenmin; RenZhongzhou

    2003-01-01

    New Isotope 265Bh was produced in bombardment of a 243Am target with 168 MeV 26Mg ions. The experiment was carried out at the Sector Focus Cyclotron of Heavy Ion Research Facility in Lanzhou in 2003. The reaction products were transported and collected by using helium-jet technique and a set of rotating wheel system. Identification was made by observation of correlated a-particles between the new isotope 265Bh and its 261Db and 257Lr daughter nuclei. A parent-daughter searching mode was used to facilitate detection of α-α correlations. A total of four pairs of PIPS detector (200mm2 active area) were used to measure the kinetic energy of a particles. The a particle energy resolution was about 40 keV for the top detectors and 100 keV for the bottom detectors because of energy degradation in the polypropylene foil.

  15. Discovery of a 26.5-day optical periodicity of LSI + 61 deg 303

    International Nuclear Information System (INIS)

    We report the discovery of an optical periodic modulation of the highly variable radio binary star LSI + 610303, with a period of ∼ 26.5 d and an amplitude of ∼ 0.05 mag. The optical period and light curve are similar to those observed in the radio. The discovery is based on observations during 64 nights between 1984 December and 1987 February. Two possible interpretations are discussed. (author)

  16. 42 CFR 2.65 - Procedures and criteria for orders authorizing disclosure and use of records to criminally...

    Science.gov (United States)

    2010-10-01

    ... OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS Court Orders Authorizing Disclosure and Use § 2.65..., rape, kidnapping, armed robbery, assault with a deadly weapon, and child abuse and neglect. (2)...

  17. Žaloba na nečinnost podle článku 265 SFEU

    OpenAIRE

    Hrabalová, Jana

    2014-01-01

    This thesis deals with the action for failure to act which is governed by Art. 265 TFEU. The purpose of the action for failure to act is a defence against unlawful failure to act of institutions and bodies of the EU. I describe an action for failure to act, define the conditions of admissibility, compare the action for failure to act to the action for annulment and analyse the decisions of the CJEU. The aim of the work is based on theoretical findings and analysis relevant decisions of the CJ...

  18. Primerjava standardov video kodiranja H.264 AVC in H.265 HEVC

    OpenAIRE

    KARAMEHIĆ, BERIN

    2016-01-01

    Diplomska naloga obravnava tematiko video kodiranja. Opisani so različni video kodirni standardi in postopki zgoščevanja video vsebine. Največ poudarka sem namenil novemu kodirnemu standardu H.265/HEVC ter njegovem predhodniku H.264/AVC. Uvod dela sem začel z osnovnimi tehnikami, ki jih uporabljamo pri zgoščevanju videa, opisal pa sem tudi postopek zgoščevanja statičnih slik. Izpostavil sem najpogostejši standard JPEG. Nadaljeval sem z zgoščevanjem gibljive slike ter opisom standardov M...

  19. Substitution of valine for histidine 265 in carbon monoxide dehydrogenase from Rhodospirillum rubrum affects activity and spectroscopic states.

    Science.gov (United States)

    Spangler, N J; Meyers, M R; Gierke, K L; Kerby, R L; Roberts, G P; Ludden, P W

    1998-02-13

    In carbon monoxide dehydrogenase (CODH) from Rhodospirillum rubrum, histidine 265 was replaced with valine by site-directed mutagenesis of the cooS gene. The altered form of CODH (H265V) had a low nickel content and a dramatically reduced level of catalytic activity. Although treatment with NiCl2 and CoCl2 increased the activity of H265V CODH by severalfold, activity levels remained more than 1000-fold lower than that of wild-type CODH. Histidine 265 was not essential for the formation and stability of the Fe4S4 clusters. The Km and KD for CO as well as the KD for cyanide were relatively unchanged as a result of the amino acid substitution in CODH. The time-dependent reduction of the [Fe4S4]2+ clusters by CO occurred on a time scale of hours, suggesting that, as a consequence of the mutation, a rate-limiting step had been introduced prior to the transfer of electrons from CO to the cubanes in centers B and C. EPR spectra of H265V CODH lacked the gav = 1.86 and gav = 1.87 signals characteristic of reduced forms of the active site (center C) of wild-type CODH. This indicates that the electronic properties of center C have been modified possibly by the disruption or alteration of the ligand-mediated interaction between the nickel site and Fe4S4 chromophore. PMID:9461598

  20. Tracking the Hercules 265 marine gas well blowout in the Gulf of Mexico

    Science.gov (United States)

    Romero, Isabel C.; Özgökmen, Tamay; Snyder, Susan; Schwing, Patrick; O'Malley, Bryan J.; Beron-Vera, Francisco J.; Olascoaga, Maria J.; Zhu, Ping; Ryan, Edward; Chen, Shuyi S.; Wetzel, Dana L.; Hollander, David; Murawski, Steven A.

    2016-01-01

    On 23 July 2013, a marine gas rig (Hercules 265) ignited in the northern Gulf of Mexico. The rig burned out of control for 2 days before being extinguished. We conducted a rapid-response sampling campaign near Hercules 265 after the fire to ascertain if sediments and fishes were polluted above earlier baseline levels. A surface drifter study confirmed that surface ocean water flowed to the southeast of the Hercules site, while the atmospheric plume generated by the blowout was in eastward direction. Sediment cores were collected to the SE of the rig at a distance of ˜0.2, 8, and 18 km using a multicorer, and demersal fishes were collected from ˜0.2 to 8 km SE of the rig using a longline (508 hooks). Recently deposited sediments document that only high molecular weight (HMW) polycyclic aromatic hydrocarbon (PAH) concentrations decreased with increasing distance from the rig suggesting higher pyrogenic inputs associated with the blowout. A similar trend was observed in the foraminifera Haynesina germanica, an indicator species of pollution. In red snapper bile, only HMW PAH metabolites increased in 2013 nearly double those from 2012. Both surface sediments and fish bile analyses suggest that, in the aftermath of the blowout, increased concentration of pyrogenically derived hydrocarbons was transported and deposited in the environment. This study further emphasizes the need for an ocean observing system and coordinated rapid-response efforts from an array of scientific disciplines to effectively assess environmental impacts resulting from accidental releases of oil contaminants.

  1. Noise in waveguide between 18 GHz and 26.5 GHz

    Science.gov (United States)

    Allal, D.

    2016-01-01

    This report summarises the results of the Key Comparison CCEM.RF-K22.W on noise temperature, performed between October 2007 and February 2011. In this comparison, the available noise temperature of three noise sources was determined by six National Metrology Institutes (NMIs) in the frequency range from 18 GHz to 26.5 GHz. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  2. Combustion inputs into a terrestrial archive over 265 years as evidenced by BPCA molecular markers

    Science.gov (United States)

    Hanke, Ulrich M.; Eglinton, Timothy I.; Wiedemeier, Daniel B.; Schmidt, Michael W. I.

    2015-04-01

    Pyrogenic organic matter (PyOM) such as char and soot is produced during the incomplete combustion of biomass and fossil fuel. It is composed of condensed aromatic structures and can resist degradation processes, maybe over long periods of time. Land-use changes, industrial activity and its transport by wind and water affect the fluxes of PyOM from the source to its sedimentary archive. Investigating environmental PyOM with the molecular marker benzene polycarboxylic acid (BPCA) method provides various information about quantity, quality (BPCA distribution pattern) and about its isotopic composition (13C and 14C). Assessing PyOM quality can indicate whether it is mostly combustion condensate (soot) or combustion residue (charcoal) and potentially allow source apportionment. Our study area is the Pettaquamscutt River catchment area (35 km2), Rhode Island, U.S.A. It is located down-wind of industrial areas recording deposition of long-distance atmospheric transport as well as local catchment inputs, both from natural and anthropogenic sources. We investigated 50 samples of a sediment record over a time span of 265 years (1733-1998 AD). Previous investigations provided information on the age of deposition, the content of polycyclic aromatic hydrocarbons (PAH) as well as of the radiocarbon contents of total organic carbon (TOC) and PAH (Lima, 2004). We used the BPCA molecular marker method to quantify and characterize PyOM in the same record. First results show that quantity and quality of PyOM change over 265 years. Our investigation aims at understanding how different sources of PyOM are reflected in terrestrial archives by comparing the results of BPCA with radiocarbon-dated TOC and PAH records. Among other aspects, the PAH record reflects the Great Depression and the 1970s oil embargo in North America. We interpret the BPCA distribution patterns regarding the simultaneous shift of dominant fuels including wood, coal, petroleum and gas. Future work will include

  3. Comparison of compression efficiency between HEVC/H.265 and VP9 based on subjective assessments

    Science.gov (United States)

    Řeřábek, Martin; Ebrahimi, Touradj

    2014-09-01

    Current increasing effort of broadcast providers to transmit UHD (Ultra High Definition) content is likely to increase demand for ultra high definition televisions (UHDTVs). To compress UHDTV content, several alternative encoding mechanisms exist. In addition to internationally recognized standards, open access proprietary options, such as VP9 video encoding scheme, have recently appeared and are gaining popularity. One of the main goals of these encoders is to efficiently compress video sequences beyond HDTV resolution for various scenarios, such as broadcasting or internet streaming. In this paper, a broadcast scenario rate-distortion performance analysis and mutual comparison of one of the latest video coding standards H.265/HEVC with recently released proprietary video coding scheme VP9 is presented. Also, currently one of the most popular and widely spread encoder H.264/AVC has been included into the evaluation to serve as a comparison baseline. The comparison is performed by means of subjective evaluations showing actual differences between encoding algorithms in terms of perceived quality. The results indicate a general dominance of HEVC based encoding algorithm in comparison to other alternatives, while VP9 and AVC showing similar performance.

  4. IMMOBILIZATION AND CHARACTERIZATION OF A THERMOSTABLE β-GLUCOSIDASE FROM ASPERGILLUS TERREUS NRRL 265

    Directory of Open Access Journals (Sweden)

    Dina H. El-Ghonemy

    2015-02-01

    Full Text Available Partially purified β-glucosidase from Aspergillus terreus NRRL 265 was immobilized by entrapment in calcium-alginate beads. The activity of the free and immobilized enzymes as a function of pH, temperature, and periodic use were compared. Whey permeate, a by-product of cheese industry, was served as an inexpensive medium, which made the process economical and reduced the cost of enzyme production and also reduced the environmental pollution. The results indicated that, the immobilized β-glucosidase was retained about 73 % of the original activity exhibited by the free enzyme. The optimum temperature for the enzyme activity was improved by 5ºC after immobilization. Immobilized β-glucosidase was exhibited great thermal stability, whereas, at 70ºC, the free enzyme lost its activity after 30 min of incubation, while the immobilized enzyme showed more stability in comparison to the free form as it retained about 13.4 % of its initial activity under the same conditions. Moreover, the pH stability was improved following immobilization, whereas, the immobilized enzyme was stable in pH ranging from 4.0 to 7.0 with no change in activity, while its stability slightly decreases for more alkaline or acidic conditions (retaining 82.4 % and 67.4 % of the initial activity at pH 8.0 and 3.5, after 1 h of incubation. The results also indicated the possibility of reusing Ca alginate-immobilized β-glucosidase in industrial applications for 10 cycles with 53.7 % retained activity.

  5. Activation of TAK1 by MYD88 L265P drives malignant B-cell Growth in non-Hodgkin lymphoma

    International Nuclear Information System (INIS)

    Massively parallel sequencing analyses have revealed a common mutation within the MYD88 gene (MYD88L265P) occurring at high frequencies in many non-Hodgkin lymphomas (NHLs) including the rare lymphoplasmacytic lymphoma, Waldenström's macroglobulinemia (WM). Using whole-exome sequencing, Sanger sequencing and allele-specific PCR, we validate the initial studies and detect the MYD88L265P mutation in the tumor genome of 97% of WM patients analyzed (n=39). Due to the high frequency of MYD88 mutation in WM and other NHL, and its known effects on malignant B-cell survival, therapeutic targeting of MYD88 signaling pathways may be clinically useful. However, we are lacking a thorough characterization of the role of intermediary signaling proteins on the biology of MYD88L265P-expressing B cells. We report here that MYD88L265P signaling is constitutively active in both WM and diffuse large B-cell lymphoma cells leading to heightened MYD88L265P, IRAK and TRAF6 oligomerization and NF-κB activation. Furthermore, we have identified the signaling protein, TAK1, to be an essential mediator of MYD88L265P-driven signaling, cellular proliferation and cytokine secretion in malignant B cells. Our studies highlight the biological significance of MYD88L265P in NHL and reveal TAK1 inhibition to be a potential therapeutic strategy for the treatment of WM and other diseases characterized by MYD88L265P

  6. Production metallic 26Mg from 26MgO and the synthesis new isotope of 265Bh

    International Nuclear Information System (INIS)

    The metallicion beam is of importance for production of heavy elements by heavy-ion fusion evaporation reactions. In order to try to synthese a new superheavy nuclide 265Bh (Z=107), a reaction of 243Am target with 26Mg ion beam is selected to produce new isotope 265Bh. The preparation and production of this rare and extremely expensive isotope 26Mg used for ion beam substance will be the key problem in synthesizing experiment of 265Bh. The available chemical form of isotope 26Mg in commercial product usually is oxide or other compound, which are not required in our experiment. They need to be transformed to metal form as a proper working substance in ion source. There is a lot of technique to prepare metallic 26Mg from its oxide. Pidgeon method of them is the most common technique. Its basic principle is that the metallic 26Mg could be reduced from 26MgO with FeSi (Ferro-Silicon): 226MgO + 2CaO + FeSi→226Mg + Ca2SiO4 + Fe The set-up for producing 26Mg consists of a tubal electric oven, a sealed stainless steel tube connected with a vacuum pump, and a tantalum foil put in inner wall of the tube and used to collect 26Mg sample. The bottom of the tube is filled with the mixture of 26MgO, CaO and FeSi powder. It is heated at 1200 degree C for the reduction. The top part of the tube is cooled by circular water. In this case, temperature grads are formed along the tube. So the magnesium vapour produced from the reaction will be condensed to crystal on the surface of tantalum collection foil where the temperature is suitable for the condensation of 26Mg vapour (∼400-600 degree C). In the experiment, several conditions such as temperature, reduction. time, proportion of the mixture component etc are investigated, and-the optimal conditions are obtained. At 1200 degree C, the production rate of metallic 26Mg is ∼0.5 g/h. The reduction efficiency is larger than 90% and the chemistry purity of magnesium is 99.9%. In conclusion, 26Mg with a good quality has been obtained

  7. Mitotic inhibition of ICR 2A frog cells exposed to 265-313 nm monochromatic ultraviolet wavelengths and photoreactivating light

    International Nuclear Information System (INIS)

    Exposure of ICR 2A frog cells to 265, 289, 302 or 313 nm U.V. radiation caused a decrease in the MI of the irradiated cells in a fluence-dependent fashion. Treatment of cells with PRL immediately after U.V.-irradiation resulted in a smaller decrease in the MI, demonstrating that pyrimidine dimers played a role in the mitotic inhibition induced by these U.V. wavelengths. The effect of PRL on 313 nm-irradiated cells was much smaller than for the other wavelengths tested, indicating that non-dimer photoproducts were of importance in the mitotic inhibition induced by this U.V. wavelength. (author)

  8. Rare Circulating Cells in Familial Waldenstrom Macroglobulinemia Displaying the MYD88 L265P Mutation Are Enriched by Epstein-Barr Virus Immortalization.

    Directory of Open Access Journals (Sweden)

    Maroulio Pertesi

    Full Text Available The MYD88 L265P is a recurrent somatic mutation in neoplastic cells from patients with Waldenström Macroglobulinemia (WM. We identified the MYD88 L265P mutation in three individuals from unrelated families, but its presence did not explain the disease segregation within these WM pedigrees. We observed the mutation in these three individuals at high allele fractions in DNA extracted from EBV-immortalized Lymphoblastoid cell lines established from peripheral blood (LCL, but at much lower allele fractions in DNA extracted directly from peripheral blood, suggesting that this mutation is present in a clonal cell subpopulation rather than of germ-line origin. Furthermore, we observed that the MYD88 L265P mutation is enriched in WM families, detected in 40.5% of patients with familial WM or MGUS (10/22 WM, 5/15 MGUS, compared to 3.5% of patients with familial MM or MGUS (0/72 MM, 4/41 MGUS (p = 10-7. The mutant allele frequency increased with passages in vitro after immortalization with Epstein-Barr virus (EBV consistent with the MYD88 L265P described gain-of-function proposed for this mutation. The MYD88 L265P mutation appears to be frequently present in circulating cells in patients with WM, and MGUS, and these cells are amenable to immortalization by EBV.

  9. Observed and simulated estimates of the meridional overturning circulation at 26.5° N in the Atlantic

    Directory of Open Access Journals (Sweden)

    P. Heimbach

    2009-07-01

    Full Text Available Daily timeseries of the meridional overturning circulation (MOC estimated from the UK/US RAPID/MOCHA array at 26.5° N in the Atlantic are used to evaluate the MOC as simulated in two global circulation models: (i an 8-member ensemble of the coupled climate model ECHAM5/MPI-OM, and (ii the ECCO-GODAE state estimate. In ECHAM5/MPI-OM, we find that the observed and simulated MOC have a similar variability and time-mean within the 99 percent confidence interval. In ECCO-GODAE, we find that the observed and simulated MOC show a significant correlation within the 99 percent confidence interval. To investigate the contribution of the different transport components, the MOC is decomposed into Florida Current, Ekman and upper mid-ocean geostrophic transports. In both models, the mid-ocean transport is closely approximated by the residual of the MOC minus Florida Current and Ekman transports. As the models conserve volume by definition, future comparisons of the RAPID/MOCHA mid-ocean transport should be done against the residual transport in the models. The similarity in the variance and the correlation between the RAPID/MOCHA, and respectively ECHAM5/MPI-OM and ECCO-GODAE MOC estimates at 26.5° N is encouraging in the context of estimating (natural variability in climate simulations and its use in climate change signal-to-noise detection analyses. Enhanced confidence in simulated hydrographic and transport variability will require longer observational time series.

  10. 40 CFR 265.201 - Special requirements for generators of between 100 and 1,000 kg/mo that accumulate hazardous...

    Science.gov (United States)

    2010-07-01

    ... STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Tank... kg/mo hazardous waste must comply with the following general operating requirements: (1) Treatment or storage of hazardous waste in tanks must comply with § 265.17(b). (2) Hazardous wastes or...

  11. Expression of IL-1α, IL-6, TGF-β, FasL and ZNF265 During Sertoli Cell Infection by Ureaplasma Urealyficum

    Institute of Scientific and Technical Information of China (English)

    Rongping Li; Yebin Xi; Xiuzhi Liu; Guangjie Chen; Baoguo Wang; Lihua Jiang; Weiyi Li

    2009-01-01

    To investigate immunoregulatory mechanisms of Sertoli cells in the testis in vitro and in vivo, we utilized our well-characterized Ureaplasma Urealyticum (UU)-induced model. We investigated the expressions of IL-1α, IL-6,TGF-[3, FasL and ZNF265 at the first, second and third weeks post-infection. During recovery from inflammation and with the help of negative regulators TGF-[3 and FasL, the high levels of IL-1α and IL-6 expressions were observed in the early stages of the infection, and decreased gradually in the later weeks both in vitro and in vivo.The trend of varied expression of ZNF265 was similar to those of TGF-β and FasL in vitro and in vivo for Sertoli cells infected with UU. Cellular & Molecular Immunology. 2009;6(3):215-221.

  12. Measurement of the reaction γp→K0Σ+ for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA

    International Nuclear Information System (INIS)

    The reaction γp → K0Σ+ was measured with the SAPHIR-detector at ELSA during the run periods 1997 and 1998. Results were obtained for cross sections in the photon energy range from threshold up to 2.65 GeV for all production angles and for the Σ+-polarization. Emphasis has been put on the determination and reduction of the contributions of background reactions and the comparison with other measurements and theoretical predictions. (orig.)

  13. 2006-2010年呼市地区265例孕妇梅毒流行病学分析%Epidemiological analysis of 265 syphilis gravidas in Huhhot during 2006 to 2010

    Institute of Scientific and Technical Information of China (English)

    李铁华; 乙晓蒙; 王丽环; 师邱涛

    2011-01-01

    目的 了解呼市地区孕妇梅毒流行状况,为制订防治策略提供科学依据.方法 对2006- 2010年呼市地区265例孕妇梅毒病例资料进行流行病学分析.结果 孕妇梅毒的发病呈逐年上升趋势,以潜伏梅毒为主.一期梅毒发病率高于二期梅毒;孕妇梅毒感染者主要在20~ 39岁年龄段,占65.05%,40岁以上占1.75%;职业以个体、待业居多,工人、农民次之,干部职员比例也有所增高,分别占23.44%、18.19%、11.57%、8.52%、7.22%.结论 孕妇梅毒是危害围产儿的严重合并症,围产期应常规开展孕妇梅毒血清学的产前筛查工作.在梅毒高流行区或高危人群,尚需在孕28周和分娩时分别作血清学检查.一旦确诊,应尽早、足量、正规给与青霉素治疗,并加强新生儿随访.孕期梅毒有效的青霉素治疗,将降低围产儿死亡率及先天梅毒的发生.%Objective To understand the prevalence status of gravida with syphilis in Huhhot, and provide scientific evidences for formulating prevention and cure stratagem. Method Adopting epidemiological analysis to 265 cases of syphilis gravidas in Huhhot during 2006 to 2010. Results Syphilis gravidas numbers increased year by year, latent syphilis was more than others. The incidence rate of primary syphilis was higher than secondary syphilis. Infected person were at the age of 20 to 39, it accounted for 65.05% , while 1.75% was above 40. Most of the patients were self - employed and job -waiting women, workers and farmers as follow, the proportion of cadre and officer workers increased, them were 23.44% , 18. 19% , 11. 57% , 8. 52% and 7. 22% , respectively. Conclusions Syphilis in circumnatal period severe hazarded to perinatal infants. So we should routine develop antepartum syphilis serological screening to gravidas. In highly outbreak syphilis regions or among high - risk crowds, it needed to take 2 serological examinations in 28th week of pregnancy and when

  14. Physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN265 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2011-05-28 to 2011-06-24 (NODC Accession 0104364)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104364 includes physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN265 in the Coastal Waters of SE Alaska and North...

  15. Numerical Evaluation of Mode 1 Stress Intensity Factor as a Function of Material Orientation For BX-265 Foam Insulation Material

    Science.gov (United States)

    Knudsen, Erik; Arakere, Nagaraj K.

    2006-01-01

    Foam; a cellular material, is found all around us. Bone and cork are examples of biological cell materials. Many forms of man-made foam have found practical applications as insulating materials. NASA uses the BX-265 foam insulation material on the external tank (ET) for the Space Shuttle. This is a type of Spray-on Foam Insulation (SOFI), similar to the material used to insulate attics in residential construction. This foam material is a good insulator and is very lightweight, making it suitable for space applications. Breakup of segments of this foam insulation on the shuttle ET impacting the shuttle thermal protection tiles during liftoff is believed to have caused the space shuttle Columbia failure during re-entry. NASA engineers are very interested in understanding the processes that govern the breakup/fracture of this complex material from the shuttle ET. The foam is anisotropic in nature and the required stress and fracture mechanics analysis must include the effects of the direction dependence on material properties. Material testing at NASA MSFC has indicated that the foam can be modeled as a transversely isotropic material. As a first step toward understanding the fracture mechanics of this material, we present a general theoretical and numerical framework for computing stress intensity factors (SIFs), under mixed-mode loading conditions, taking into account the material anisotropy. We present mode I SIFs for middle tension - M(T) - test specimens, using 3D finite element stress analysis (ANSYS) and FRANC3D fracture analysis software, developed by the Cornel1 Fracture Group. Mode I SIF values are presented for a range of foam material orientations. Also, NASA has recorded the failure load for various M(T) specimens. For a linear analysis, the mode I SIF will scale with the far-field load. This allows us to numerically estimate the mode I fracture toughness for this material. The results represent a quantitative basis for evaluating the strength and

  16. Empirical evaluation of H.265/HEVC-based dynamic adaptive video streaming over HTTP (HEVC-DASH)

    Science.gov (United States)

    Irondi, Iheanyi; Wang, Qi; Grecos, Christos

    2014-05-01

    Real-time HTTP streaming has gained global popularity for delivering video content over Internet. In particular, the recent MPEG-DASH (Dynamic Adaptive Streaming over HTTP) standard enables on-demand, live, and adaptive Internet streaming in response to network bandwidth fluctuations. Meanwhile, emerging is the new-generation video coding standard, H.265/HEVC (High Efficiency Video Coding) promises to reduce the bandwidth requirement by 50% at the same video quality when compared with the current H.264/AVC standard. However, little existing work has addressed the integration of the DASH and HEVC standards, let alone empirical performance evaluation of such systems. This paper presents an experimental HEVC-DASH system, which is a pull-based adaptive streaming solution that delivers HEVC-coded video content through conventional HTTP servers where the client switches to its desired quality, resolution or bitrate based on the available network bandwidth. Previous studies in DASH have focused on H.264/AVC, whereas we present an empirical evaluation of the HEVC-DASH system by implementing a real-world test bed, which consists of an Apache HTTP Server with GPAC, an MP4Client (GPAC) with open HEVC-based DASH client and a NETEM box in the middle emulating different network conditions. We investigate and analyze the performance of HEVC-DASH by exploring the impact of various network conditions such as packet loss, bandwidth and delay on video quality. Furthermore, we compare the Intra and Random Access profiles of HEVC coding with the Intra profile of H.264/AVC when the correspondingly encoded video is streamed with DASH. Finally, we explore the correlation among the quality metrics and network conditions, and empirically establish under which conditions the different codecs can provide satisfactory performance.

  17. Discovery of SXP 265, a Be/X-ray binary pulsar in the Wing of the Small Magellanic Cloud

    Science.gov (United States)

    Sturm, R.; Haberl, F.; Vasilopoulos, G.; Bartlett, E. S.; Maggi, P.; Rau, A.; Greiner, J.; Udalski, A.

    2014-11-01

    We identify a new candidate for a Be/X-ray binary in the XMM-Newton slew survey and archival Swift observations that is located in the transition region of the Wing of the Small Magellanic Cloud and the Magellanic Bridge. We investigated and classified this source with follow-up XMM-Newton and optical observations. We model the X-ray spectra and search for periodicities and variability in the X-ray observations and the Optical Gravitational Lensing Experiment I-band light curve. The optical counterpart has been classified spectroscopically, with data obtained at the South African Astronomical Observatory 1.9 m telescope, and photometrically, with data obtained using the Gamma-ray Burst Optical Near-ir Detector at the MPG 2.2 m telescope. The X-ray spectrum is typical of a high-mass X-ray binary with an accreting neutron star. We detect X-ray pulsations, which reveal a neutron-star spin period of Ps = (264.516 ± 0.014) s. The source likely shows a persistent X-ray luminosity of a few 1035 erg s-1 and in addition type-I outbursts that indicate an orbital period of ˜146 d. A periodicity of 0.867 d, found in the optical light curve, can be explained by non-radial pulsations of the Be star. We identify the optical counterpart and classify it as a B1-2II-IVe star. This confirms SXP 265 as a new Be/X-ray binary pulsar originating in the tidal structure between the Magellanic Clouds.

  18. The contribution of eastern-boundary density variations to the Atlantic meridional overturning circulation at 26.5° N

    Directory of Open Access Journals (Sweden)

    M. P. Chidichimo

    2009-11-01

    Full Text Available We study the contribution of eastern-boundary density variations to sub-seasonal and seasonal anomalies of the strength and vertical structure of the Atlantic Meridional Overturning Circulation (AMOC at 26.5° N, by means of the RAPID/MOCHA mooring array between April 2004 and October 2007. The major density anomalies are found in the upper 500 m, and they are often coherent down to 1400 m. The densities have 13-day fluctuations that are apparent down to 3500 m. The two strategies for measuring eastern-boundary density – a tall offshore mooring (EB1 and an array of moorings on the continental slope (EBH – show little correspondence in terms of amplitude, vertical structure, and frequency distribution of the resulting basin-wide integrated transport fluctuations, implying that there are significant transport contributions between EB1 and EBH. Contrary to the original planning, measurements from EB1 cannot serve as backup or replacement for EBH: density needs to be measured directly at the continental slope to compute the full-basin density gradient. Fluctuations in density at EBH generate transport variability of 2 Sv rms in the AMOC, while the overall AMOC variability is 4.9 Sv rms. There is a pronounced deep-reaching seasonal cycle in density at the eastern boundary, which is apparent between 100 m and 1400 m, with maximum positive anomalies in spring and maximum negative anomalies in autumn. These changes drive anomalous southward upper mid-ocean flow in spring, implying maximum reduction of the AMOC, and vice-versa in autumn. The amplitude of the seasonal cycle of the AMOC arising from the eastern-boundary densities is 5.2 Sv peak-to-peak, dominating the 7.0 Sv peak-to-peak seasonal cycle of the total AMOC. Our analysis suggests that the seasonal cycle in density may be forced by the strong near-coastal seasonal cycle in wind stress curl.

  19. Pharmacologic Therapy of Diabetes and Overall Cancer Risk and Mortality: A Meta-Analysis of 265 Studies

    Science.gov (United States)

    Wu, Lang; Zhu, Jingjing; Prokop, Larry J.; Hassan Murad, Mohammad

    2015-01-01

    Different anti-diabetic medications (ADMs) may modify cancer risk and mortality in patients with diabetes. We conducted a systematic review and meta-analysis to estimate the magnitude of association and quality of supporting evidence for each ADM. A total of 265 studies (44 cohort studies, 39 case-control studies, and 182 randomized controlled trials (RCT)) were identified, involving approximately 7.6 million and 137,540 patients with diabetes for observational studies and RCTs, respectively. The risk of bias overall was moderate. Meta-analysis demonstrated that the use of metformin or thiazolidinediones was associated with a lower risk of cancer incidence (RR = 0.86, 95% CI 0.83-0.90, I2 = 88.61%; RR = 0.93, 95% CI 0.91-0.96, I2 = 0.00% respectively). On the other hand, insulin, sulfonylureas and alpha glucosidase inhibitor use was associated with an increased risk of cancer incidence (RR = 1.21, 95% CI 1.08-1.36, I2 = 96.31%; RR = 1.20, 95% CI 1.13-1.27, I2 = 95.02%; RR = 1.10, 95% CI 1.05-1.15, I2 = 0.00% respectively). Use of other types of ADMs was not significantly associated with cancer risk. This study indicates that some ADMs may modify the risk of cancer in individuals with diabetes. Knowledge of this risk may affect the choice of ADM in individuals concerned about cancer or at increased risk for cancer. PMID:26076034

  20. FeynHiggs: A program for the calculation of MSSM Higgs-boson observables - Version 2.6.5

    Science.gov (United States)

    Hahn, T.; Heinemeyer, S.; Hollik, W.; Rzehak, H.; Weiglein, G.

    2009-08-01

    FeynHiggs is a Fortran code for the calculation of physical observables in the field of high-energy physics. FeynHiggs calculates various observables in the Higgs sector of the Minimal Supersymmetric Standard Model (MSSM) for real or complex parameters. These observables comprise Higgs-boson masses, mixing angles, couplings, Tevatron/LHC production cross-sections, branching ratios, as well as some additional observables such as Δ ρ, M, the effective leptonic weak mixing angle, (, BR( b→sγ), electric dipole moments. New version program summaryProgram title: FeynHiggs v2.6.5 Catalogue identifier: ADKT_v2_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADKT_v2_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GPL No. of lines in distributed program, including test data, etc.: 156 455 No. of bytes in distributed program, including test data, etc.: 1 058 758 Distribution format: tar.gz Programming language: Fortran 77, C, Mathematica Computer: Intel/AMD, PowerPC, Alpha Operating system: Linux, Windows (Cygwin), Mac OS, Tru64 Unix RAM: insignificant (typically a few MB) Classification: 11.5 Catalogue identifier of previous version: ADKT_v1_0 Journal reference of previous version: Comput. Phys. Comm. 124 (2000) 76 Does the new version supersede the previous version?: Yes Nature of problem: The experimental searches for Higgs bosons have to be compared with theory predictions at a high level of accuracy. Radiative corrections are especially important in the Minimal Supersymmetric Standard Model (MSSM). Solution method: High-precision calculations (mostly based on the Feynman-diagrammatic approach) for various Higgs-boson observables in the MSSM are implemented. The program takes the basic model parameters as input and evaluates many MSSM Higgs-boson observables relevant for experimental Higgs-boson physics. Reasons for new version: Existing calculations have been refined (e.g., by the inclusion

  1. Fission properties of actinide nuclei from proton-induced fission at 26.5 and 62.9 MeV incident proton energies

    OpenAIRE

    Demetriou, P.; Keutgen, Thomas; Prieels, René; El Masri, Youssef

    2010-01-01

    Fission properties of proton-induced fission on Th232, Np237, U238, Pu239, and Am241 targets, measured at the Louvain-la-Neuve cyclotron facility at proton energies of 26.5 and 62.9 MeV, are compared with the predictions of the state-of-the-art nuclear reaction code talys. The code couples the multimodal random neck-rupture model with the pre-equilibrium exciton and statistical models to predict fission fragment mass yields, pre- and post-scission neutron multiplicities, and total fission cro...

  2. Comparative assessment of H.265/MPEG-HEVC, VP9, and H.264/MPEG-AVC encoders for low-delay video applications

    Science.gov (United States)

    Grois, Dan; Marpe, Detlev; Nguyen, Tung; Hadar, Ofer

    2014-09-01

    The popularity of low-delay video applications dramatically increased over the last years due to a rising demand for realtime video content (such as video conferencing or video surveillance), and also due to the increasing availability of relatively inexpensive heterogeneous devices (such as smartphones and tablets). To this end, this work presents a comparative assessment of the two latest video coding standards: H.265/MPEG-HEVC (High-Efficiency Video Coding), H.264/MPEG-AVC (Advanced Video Coding), and also of the VP9 proprietary video coding scheme. For evaluating H.264/MPEG-AVC, an open-source x264 encoder was selected, which has a multi-pass encoding mode, similarly to VP9. According to experimental results, which were obtained by using similar low-delay configurations for all three examined representative encoders, it was observed that H.265/MPEG-HEVC provides significant average bit-rate savings of 32.5%, and 40.8%, relative to VP9 and x264 for the 1-pass encoding, and average bit-rate savings of 32.6%, and 42.2% for the 2-pass encoding, respectively. On the other hand, compared to the x264 encoder, typical low-delay encoding times of the VP9 encoder, are about 2,000 times higher for the 1-pass encoding, and are about 400 times higher for the 2-pass encoding.

  3. THE CENTRAL ENGINES OF TWO UNUSUAL RADIO-INTERMEDIATE/QUIET ACTIVE GALACTIC NUCLEI: III Zw 2 AND PG 1407+265

    International Nuclear Information System (INIS)

    We use the accretion disk/corona+jet model to fit the multi-band spectral energy distributions (SEDs) of two unusual radio-intermediate/quiet quasars. It is found that the optical/UV emission of III Zw 2 is probably dominated by the emission from the accretion disk. The X-ray emission should be dominated by the radiation from the jet, while the contribution of the disk corona is negligible. The optical/UV component in the SED of PG 1407+265 can be well modeled as the emission from the accretion disk, while the IR component is attributed to the thermal radiation from the dust torus with an opening angle of ∼50°. If the X-ray continuum emission is dominated by the synchrotron emission of the jet, the source should be a 'high peak frequency blazar', which obviously deviates from the normal blazar sequence. The observed SED can also be fitted quite well by the accretion disk/corona model with the viscosity parameter α = 0.5. The spectrum of the accretion disk/corona in PG 1407+265 satisfies the weak-line quasar criterion suggested in Laor and Davis.

  4. Experimental measurements and equation of state modeling of liquid densities for long-chain n-alkanes at pressures to 265 MPa and temperatures to 523 K

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Yue; Bamgbade, Babatunde; Liu, Kun; McHugh, Mark A.; Baled, Hseen; Enick, Robert M.; Burgess, Ward A.; Tapriyal, Deepak; Morreale, Bryan D.

    2011-12-01

    Experimental densities are reported for n-hexadecane, n-octadecane, and n-eicosane at pressures to ~265 MPa and temperatures of 323.15, 423.15, and 523.15 K. The reported densities are in good agreement with the available literature data that cover limited pressure and temperature ranges. The Peng–Robinson equation of state (PR EOS), a new high-temperature high-pressure volume-translated Soave–Redlich–Kwong equation of state (HTHP-VT SRK EOS), and the perturbed-chain statistical associating fluid theory (PC-SAFT) are used to predict the reported densities. Finally, both the HTHP-VT SRK and PC-SAFT equations exhibit mean absolute percent deviation (MAPD) values of 2.4–1.3% for the densities of all three hydrocarbons while the MAPD values for the PR EOS are all near 16%.

  5. Measurement of the reaction {gamma}p{yields}K{sup 0}{sigma}{sup +} for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA; Messung der Reaktion {gamma}p {yields} K{sup 0}{sigma}{sup +} fuer Photonenergien bis 2.65 GeV mit dem SAPHIR-Detektor an ELSA

    Energy Technology Data Exchange (ETDEWEB)

    Lawall, R.

    2004-01-01

    The reaction {gamma}p {yields} K{sup 0}{sigma}{sup +} was measured with the SAPHIR-detector at ELSA during the run periods 1997 and 1998. Results were obtained for cross sections in the photon energy range from threshold up to 2.65 GeV for all production angles and for the {sigma}{sup +}-polarization. Emphasis has been put on the determination and reduction of the contributions of background reactions and the comparison with other measurements and theoretical predictions. (orig.)

  6. High-Power Single-Mode 2.65-micron InGaAsSb/AlInGaAsSb Diode Lasers

    Science.gov (United States)

    Frez, Clifford F.; Briggs, Ryan M.; Forouhar, Siamak; Borgentun, Carl E.; Gupta, James

    2013-01-01

    Central to the advancement of both satellite and in-situ science are improvements in continuous-wave and pulsed infrared laser systems coupled with integrated miniaturized optics and electronics, allowing for the use of powerful, single-mode light sources aboard both satellite and unmanned aerial vehicle platforms. There is a technological gap in supplying adequate laser sources to address the mid-infrared spectral window for spectroscopic characterization of important atmospheric gases. For high-power applications between 2 to 3 micron, commercial laser technologies are unsuitable because of limitations in output power. For instance, existing InP-based laser systems developed for fiber-based telecommunications cannot be extended to wavelengths longer than 2 micron. For emission wavelengths shorter than 3 micron, intersubband devices, such as infrared quantum cascade lasers, become inefficient due to band-offset limitations. To date, successfully demonstrated singlemode GaSb-based laser diodes emitting between 2 and 3 micron have employed lossy metal Bragg gratings for distributed- feedback coupling, which limits output power due to optical absorption. By optimizing both the quantum well design and the grating fabrication process, index-coupled distributed-feedback 2.65-micron lasers capable of emitting in excess of 25 mW at room temperature have been demonstrated. Specifically, lasers at 3,777/cm (2.65 micron) have been realized to interact with strong absorption lines of HDO and other isotopologues of H2O. With minor modifications of the optical cavity and quantum well designs, lasers can be fabricated at any wavelength within the 2-to-3-micron spectral window with similar performance. At the time of this reporting, lasers with this output power and wavelength accuracy are not commercially available. Monolithic ridge-waveguide GaSb lasers were fabricated that utilize secondorder lateral Bragg gratings to generate single-mode emission from InGaAsSb/ Al

  7. HST/COS detection of a Ne VIII absorber towards PG 1407+265: An unambiguous tracer of collisionally ionized hot gas?

    CERN Document Server

    Hussain, Tanvir; Narayanan, Anand; Srianand, Raghunathan; Wakker, Bart P; Charlton, Jane C; Pathak, Amit

    2014-01-01

    We report the detection of Ne VIII in a z_abs = 0.59961 absorber towards the QSO PG 1407+265 (z_em = 0.94). Besides Ne VIII, absorption from HI Lyman series lines (HI 1025 - 915), several other low (C II, N II, O II, and S II), intermediate (C III, N III, N IV, O III, S IV, and S V) and high (S VI, O VI, and Ne VIII) ionization metal lines are detected. Disparity in the absorption line kinematics between different ions implies that the absorbing gas comprises of multiple ionization phases. The low and the intermediate ions (except S V) trace a compact (~ 410 pc), metal-rich (Z ~ Z_sun) and over-dense (log n_H ~ -2.6) photoionized region that sustained star-formation for a prolonged period. The high ions, Ne VIII and O VI, can be explained as arising in a low density (-5.3 Z_sun) and diffuse (~ 180 kpc) photoionized gas. The S V, S VI and C IV (detected in the FOS spectrum) require an intermediate photoionization phase with -4.2 < log n_H < -3.5. Alternatively, a pure collisional ionization model, as us...

  8. Intra-cavity frequency-doubled Cr:LiCAF laser with 265 mW continuous-wave blue (395-405 nm) output

    Science.gov (United States)

    Demirbas, Umit; Uecker, Reinhard; Klimm, Detlef; Sumpf, Bernd; Erbert, Götz

    2014-06-01

    We describe continuous-wave (cw) intracavity frequency-doubling experiments performed with a Cr:LiCAF laser. The Cr:LiCAF crystal is home-grown and had passive losses below 0.15% per cm. The laser is pumped by two recently-developed high-brightness tapered diodes, providing a total pump power of 2 W at 680 nm. The Cr:LiCAF laser generated up to 585 mW of cw output power around 800 nm with 43% slope efficiency at an absorbed pump power of 1.4 W. The low passive losses of the crystal enabled storage of up to 380 W of intracavity laser power using a 0.07% transmitting output coupler, demonstrating suitability of Cr:LiCAF gain media for intracavity nonlinear conversion experiments. By performing intracavity frequency doubling with a BBO crystal, cw second-harmonic powers as high as 265 mW around 400 nm have been realized with optical-to-optical conversion efficiencies as high as 13.3%. To our knowledge, these are the highest cw frequency-doubled laser powers and conversion efficiencies obtained from Cr:Colquiriites to date. Moreover, obtained efficiencies are superior compared to what have been achieved with similar Ti:Sapphire systems, due to lower passive losses of Cr:LiCAF crystal. These results demonstrate the appropriateness of Cr:LiCAF gain media as a high-power tunable cw radiation generator in 375-435 nm region.

  9. Application of Motoring Test Method for Determining TDC to Dynamic Pressure Trial System of ZTY265 Natural Gas Compressor Set%"倒拖法"求上止点在ZTY265天然气压缩机动态压力测试系统中的应用

    Institute of Scientific and Technical Information of China (English)

    邹喜红; 袁冬梅; 杨英

    2003-01-01

    在进行内燃机燃烧分析时,上止点相位对分析结果影响很大,正确确定内燃机动态上止点相位显得非常重要.本文详细介绍了用"倒拖法"确定内燃机动态上止点的方法及具体过程,设计了其计算机算法,并在ZTY265天然气压缩机动态压力测试系统中加以应用,得到了较精确的结果.

  10. Study of the reaction {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA; Untersuchung der Reaktion {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} fuer Photonenenergien bis 2.65 GeV mit dem SAPHIR-Detektor an ELSA

    Energy Technology Data Exchange (ETDEWEB)

    Schulday, I.

    2004-10-01

    The reaction {gamma}p{yields}K{sup +}{sigma}{sup -}{pi}{sup +} was measured in the photon energy range from threshold up to 2.65 GeV. The cross section is dominated by the production of the resonances {sigma}(1385), {lambda}(1405) and {lambda}(1520) which decay into {sigma}{sup -}{pi}{sup +}. Cross sections were obtained as a function of the photon energy and the K{sup +} production angle for the reaction and the resonance production. The cross section for {lambda}(1520) rises up to (0.230{+-}0.029) {mu}b in the photon energy range 1.80

  11. 46 CFR 154.625 - Design temperature below 0 °C (32 °F) and down to −165 °C (−265 °F).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Design temperature below 0 °C (32 °F) and down to â165... LIQUEFIED GASES Design, Construction and Equipment Materials § 154.625 Design temperature below 0 °C (32 °F... process piping for a design temperature below 0 °C (32 °F) and down to −165 °C (−265 °F) must meet §...

  12. 46 CFR 154.620 - Design temperature below −55 °C (−67 °F) and down to −165 °C (−265 °F).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Design temperature below â55 °C (â67 °F) and down to... LIQUEFIED GASES Design, Construction and Equipment Materials § 154.620 Design temperature below −55 °C (−67... design temperature below −55 °C (−67 °F) and down to −165 °C (−265 °F) must: (a) Meet §...

  13. Effects of Si and Ce on the microstructure and hydrogen storage property of Ti26.5Cr20V45Fe8.5Ce0.5 alloy

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    In this paper, the effects of Si and Ce on the microstructure and hydrogen storage property of Ti26.5 Cr20V45Fe8.5Ce0.5 alloy were studied, respectively. First of all, effects of Si on the microstructure and hydrogen storage properties of Ti26.5Cr20(V45Fe8.5)1?xSixCe0.5 (x = 0, 0.5, 1.0, 1.5 and 2.0 at%) alloys were studied by X-ray diffraction, scanning electron microscopy and P-C isotherm measurements. As the Si addition increases, the hydrogen absorption capacities of alloys decrease but the equilibrium pressure increases, due to the formation of Laves phase. Secondly, the effect of Ce on Ti26.5Cr20 (V45Fe8.5)0.98Si2 alloy was studied. It was found that Ce addition is an effective way to eliminate the effect of Si on the hydrogen storage properties of the alloy.

  14. Neoplasmas oculares e de anexos em cães e gatos no Rio Grande do Sul: 265 casos (2009 -2014

    Directory of Open Access Journals (Sweden)

    Kivia L. Hesse

    2015-01-01

    Full Text Available Neoplasias oculares causam desconforto, problemas de visão e podem refletir doenças sistêmicas. Um estudo retrospectivo foi realizado para identificar e analisar neoplasmas oculares e de anexos obtidos por biópsias enviadas ao Setor de Patologia Veterinária (SPV da Universidade Federal do Rio Grande do Sul (UFRGS. Durante o período de janeiro de 2009 a dezembro de 2014 realizou-se 265 diagnósticos de neoplasmas oculares e de anexos, destes 87,5% na espécie canina e em 12,5% na espécie felina. As neoplasias ocorreram mais em animais com idade superior a 12 meses e idosos, e os cães (52/232 e gatos (21/33 sem raça definida foram os mais acometidos. A pálpebra foi o local mais acometido na espécie canina (164/232 e felina (20/33, seguida pela terceira pálpebra em cães (20/232 e órbita nos felinos (5/33. O tumor mais diagnosticado nos cães foi o adenoma meibomiano (82/232 e nos gatos o carcinoma de células escamosas (10/33, ambos em pálpebras. Foram identificados nos cães 24 tipos tumorais e nos gatos 16. Em caninos as neoplasias benignas representaram o maior número de diagnósticos (56% sendo que em felinos o maior número de casos foi de neoplasias malignas (75,8%.

  15. Evaluation of used methodology/methods in Aespoe HRL. Sections 0/700-1/475 and 1/475-2/265

    International Nuclear Information System (INIS)

    Some of the main objectives with the Aespoe Hard Rock Laboratory is reviewing and verifying the suitability of different investigations methods regarding bedrock characterization, test methods for detailed site investigations and to evaluate factors of importance for safety in realistic conditions. The SKB evaluation will result in a strategy planned to be used in the forthcoming site selection of a repository for high level radioactive waste. This report presents an evaluation of the methods used by SKB in the prediction of the bedrock prior to excavation. The prediction was based on the pre investigations carried out during 1986-1990. The review has followed the SKB classification of issue areas: geological/structural model, groundwater flow, groundwater chemistry, transport of solutes and mechanical stability. The review concerns SKB's objectives with the prediction and the different criteria for selection of variables - considering the demands of the performance assessment. This report includes evaluation of two tunnel sections, 0/700 - 1/475 and 1/475 - 2/265, comprising used data, prediction methods and prediction accuracy. By way of comparing predictions before excavation and outcome in the tunnel, a strict validation was performed. Based on the results from the validation, the applicability of different methods was estimated and the predictability of different subjects was assessed. It should be emphasised that the Aespoe predictions have not been directly intended for performance assessment purposes. However, it is of interest to see how the predictions relate to the information needs of performance assessment. By this it is possible to identify areas where more work needs to be done in the future, either in the operational phases at Aespoe or in other parts of the SKB program, thereby setting the predictions in an overall perspective from the point of view of performance assessment

  16. The 26.5 ka Oruanui eruption, New Zealand : a review of the roles of volcanism and climate in the post-eruptive sedimentary response

    International Nuclear Information System (INIS)

    The landscape response to large explosive pyroclastic volcanic eruptions is one of the most dramatic processes in sedimentology and geomorphology. Processes of post-eruptive erosion and resedimentation are maximised by large erupted volumes, abundant unconsolidated ash-sized material, destruction of the vegetation cover (particularly by burial by ignimbrite), and inhibition of vegetation regrowth (e.g., by harsh climatic conditions). The 26.5 ka Oruanui eruption from Taupo volcano in the central North Island of New Zealand created optimal conditions for a large-scale sedimentary response that was influenced and prolonged by the succeeding climatic nadir of the Last Glacial Maximum. About 530 km3 of rhyolitic magma was erupted as 420 km3 of fall deposits, 320 km3 of pyroclastic density current deposits (mostly non-welded ignimbrite), and 430 km3 of primary intracaldera fill. The eruption, and formation of the Oruanui caldera, destroyed one major lake but created the forerunner to modern Lake Taupo. This lake initially stably overflowed to the northwest before breaking out in a catastrophic flood during establishment of a northeasterly outlet along the line of the modern Waikato River. Suppression of revegetation by the contemporaneous harsh periglacial climate contributed to intense erosion and remobilisation of Oruanui pyroclastic units, triggering massive downstream fluvial aggradation in impacted catchments. In particular, aggradation caused the lower 180 km of the Waikato River to avulse from its long-established route via the Hauraki Plains into the Hamilton Basin where it was subsequently trapped. Aeolian reworking created localised dune fields, while generation of tephric loess formed deposits over much of the central North Island. The initial perturbation to fluvial sedimentary systems created by the eruption was generally sustained by climatic conditions until c. 17 ka. Climatic amelioration eventually stabilised primary sediment sources through the re

  17. Technical complications during veno-venous extracorporeal membrane oxygenation and their relevance predicting a system-exchange--retrospective analysis of 265 cases.

    Directory of Open Access Journals (Sweden)

    Matthias Lubnow

    Full Text Available OBJECTIVES: Technical complications are a known hazard in veno-venous extracorporeal membrane oxygenation (vvECMO. Identifying these complications and predictive factors indicating a developing system-exchange was the goal of the study. METHODS: Retrospective study on prospectively collected data of technical complications including 265 adult patients (Regensburg ECMO Registry, 2009-2013 with acute respiratory failure treated with vvECMO. Alterations in blood flow resistance, gas transfer capability, hemolysis, coagulation and hemostasis parameters were evaluated in conjunction with a system-exchange in all patients with at least one exchange (n = 83. RESULTS: Values presented as median (interquartile range. Patient age was 50(36-60 years, the SOFA score 11(8-14.3 and the Murray lung injury Score 3.33(3.3-3.7. Cumulative ECMO support time 3411 days, 9(6-15 days per patient. Mechanical failure of the blood pump (n = 5, MO (n = 2 or cannula (n = 1 accounted for 10% of the exchanges. Acute clot formation within the pump head (visible clots, increase in plasma free hemoglobin (frHb, serum lactate dehydrogenase (LDH, n = 13 and MO (increase in pressure drop across the MO, n = 16 required an urgent system-exchange, of which nearly 50% could be foreseen by measuring the parameters mentioned below. Reasons for an elective system-exchange were worsening of gas transfer capability (n = 10 and device-related coagulation disorders (n = 32, either local fibrinolysis in the MO due to clot formation (increased D-dimers [DD], decreased platelet count; n = 24, or device-induced hyperfibrinolysis (increased DD, decreased fibrinogen [FG], decreased platelet count, diffuse bleeding tendency; n = 8, which could be reversed after system-exchange. Four MOs were exchanged due to suspicion of infection. CONCLUSIONS: The majority of ECMO system-exchanges could be predicted by regular inspection of the complete ECMO circuit, evaluation of gas exchange, pressure drop

  18. 50 MHz – 26,5 GHz Aralığında Çalışan Toplam Güç Radyometrenin Gerçekleştirilmesi ve Test Edilmesi - Realization and Test of The Total Power Radiometer Working Between 50MHz and 26.5 GHz Frequency Range

    OpenAIRE

    Celep, Murat; Yaran, Şenel; Hayırlı, Cem; Dolma, Arif

    2013-01-01

    Bu çalışmada, yarı iletken bir gürültü kaynağının “excess noise source” (ENR) değerini izlenebilir şekilde ölçmek için bir toplam güç radyometre kurulmuştur. Oldukça geniş olarak kabul edilen 50 MHz – 26,5 GHz frekans aralığında, gürültü kaynağını tek seferde ölçebilen bu sistemin testi, nominal 15 dB ENR değerine sahip standart gürültü kaynakları kullanılarak yapılmıştır. Geliştirilen toplam güç radyometre kullanılarak, değeri bilinen bir gürültü kaynağının hesaplanan ENR değerleri ile gerçe...

  19. 我市增城区265例成人精神病患者残疾评定结果分析%Analysis of disability evaluation results in 265 patients with adult psy-chosis in Zengcheng district of our city

    Institute of Scientific and Technical Information of China (English)

    高云; 李雪晶; 林杰; 胡建平; 朴轶峰

    2015-01-01

    Objective To explore the main reasons in disabled with adult psychosis in Zengcheng district of our city, and to propose corresponding suggestions on prevention and treatment. Methods Materials of 341 patients with adult psychosis from 11 towns in Zengcheng district of our city in July 2014 were collected.The disabled grade was evaluated by WHO-DASIIscale(265 cases were evaluated in practice),and were statistically analyzed according to different dis-ability diagnoses,degrees,disease courses and ages.The main causes of disability of these patients were examine. Re-sults Of all the causes of disability,schizophrenia was the leading cause (82.6%),followed by mood disorder (4.5%). 48.3% of these patients were middle-aded,37.7% were young,and 14.0% were old age. Conclusion In order to reduce and relieve psychic disabilities,should strengthen the social psychological health education,enlarge the service area of psychological consulting,strengthen the supervision of drugs and food hygiene,reduce the abuse of active substances,pay attention to prevention and treatment of mental disease,at the same time to enhance rural medical care input,and to im-prove the diagnosis rate and improvement rate of psychic disability in rural areas.%目的:了解我市增城区成人精神病的主要致残原因,并提出有针对性的预防和治疗建议。方法2014年7月,收集我市增城区11个镇的341例成人精神病患者的相关资料,采用世界卫生组织残疾评定量表(WHO-DAS域)进行残疾等级评定(实际完成精神病残疾评定265例),按照残疾诊断、程度、病程及年龄的不同进行分组统计和分析,考查其主要致残原因。结果所有致残原因中,精神分裂症是最主要的致残原因,占82.6豫,其次是心境障碍,占4.5豫。精神残疾的年龄段分布情况为中年占48.3豫,其次是青年(37.7豫),老年(14.0%)紧跟其后。结论为减少和减轻精神残疾,应

  20. Study of the photoproduction of the vector meson Φ(1020) and the hyperon Λ(1520) from the production threshold up to a photon energy of 2.65 GeV with SAPHIR

    International Nuclear Information System (INIS)

    The photoproduction of the vector meson φ(1020) and the hyperon Λ(1520) have been measured in the finale state pK+K- from their thresholds up to 2.65 GeV using the high duty-factor electron accelerator ELSA and the 4π-detectorsystem SAPHIR. The t-dependence of φ(1020)-production shows an exponential behavior as expected from diffractive production. s-channel helicity conservation can be seen in the decay angular distribution in the helicity frame. The decay angular distribution in the Gottfried-Jackson frame is not conformable with the exchange of a Pomeron in the t-channel. For the first time, differential cross sections of the Λ(1520) photoproduction from the threshold are measured. The production angular distribution and the decay angular distribution in the Gottfried-Jackson frame show a K* exchange in the t-channel. (orig.)

  1. Light extraction enhancement of 265 nm deep-ultraviolet light-emitting diodes with over 90 mW output power via an AlN hybrid nanostructure

    International Nuclear Information System (INIS)

    Deep-ultraviolet (DUV) aluminum gallium nitride-based light-emitting diodes (LEDs) on transparent aluminum nitride (AlN) substrates with high light extraction efficiency and high power are proposed and demonstrated. The AlN bottom side surface configuration, which is composed of a hybrid structure of photonic crystals and subwavelength nanostructures, has been designed using finite-difference time-domain calculations to enhance light extraction. We have experimentally demonstrated an output power improvement of up to 196% as a result of the use of the embedded high-light-extraction hybrid nanophotonic structure. The DUV-LEDs produced have demonstrated output power as high as 90 mW in DC operation at a peak emission wavelength of 265 nm

  2. Angular correlations of fission fragments from the reactions 232Th(p,p'f) and 236U(p,p'f) at a projectile energy of 26.5 MeV

    International Nuclear Information System (INIS)

    Angular correlations of fission fragments from the reactions 232Th(p,p'f) and 236U(p,p'f) have been measured at a projectile energy of Ep=26.5 MeV and excitation energies up to the second chance fission. The scattered protons have been detected by a semiconductor telescope positioned at two different angles (vTel=90 and vTel=60 ). The fission fragments have been measured by a parallel plate avalanche detector, which was position sensitive in two dimensions. The data continuously cover the angular ranges of about -15 up to +95 for vTel=90 and about -5 up to +50 for vTel=60 with respect to the kinematical recoil axis. It succeeded to describe the changes of the angular distribution with increasing excitation energy in terms of the Transition State Model by a uniform increase of the contributions with K≠0 for both compound systems and both excitation reactions. (orig./DG)

  3. Cryptococcal transmigration across a model brain blood-barrier: evidence of the Trojan horse mechanism and differences between Cryptococcus neoformans var. grubii strain H99 and Cryptococcus gattii strain R265.

    Science.gov (United States)

    Sorrell, Tania C; Juillard, Pierre-Georges; Djordjevic, Julianne T; Kaufman-Francis, Keren; Dietmann, Anelia; Milonig, Alban; Combes, Valery; Grau, Georges E R

    2016-01-01

    Cryptococcus neoformans (Cn) and Cryptococcus gattii (Cg) cause neurological disease and cross the BBB as free cells or in mononuclear phagocytes via the Trojan horse mechanism, although evidence for the latter is indirect. There is emerging evidence that Cn and the North American outbreak Cg strain (R265) more commonly cause neurological and lung disease, respectively. We have employed a widely validated in vitro model of the BBB, which utilizes the hCMEC/D3 cell line derived from human brain endothelial cells (HBEC) and the human macrophage-like cell line, THP-1, to investigate whether transport of dual fluorescence-labelled Cn and Cg across the BBB occurs within macrophages. We showed that phagocytosis of Cn by non-interferon (IFN)-γ stimulated THP-1 cells was higher than that of Cg. Although Cn and Cg-loaded THP-1 bound similarly to TNF-activated HBECs under shear stress, more Cn-loaded macrophages were transported across an intact HBEC monolayer, consistent with the predilection of Cn for CNS infection. Furthermore, Cn exhibited a higher rate of expulsion from transmigrated THP-1 compared with Cg. Our results therefore provide further evidence for transmigration of both Cn and Cg via the Trojan horse mechanism and a potential explanation for the predilection of Cn to cause CNS infection. PMID:26369713

  4. New layer borate (Nd0.925Na0.075)Nd[B9O15(OH)2]Cl0.85 . 2.65H2O and its place in the structural systematics

    International Nuclear Information System (INIS)

    Crystals of a new aqueous rare-earth borate-(Nd0.925Na0.075)Nd[B9O15(OH)2]Cl0.85 . 2.65H2O, space group P2/n-are obtained under hydrothermal conditions. The crystal structure is determined by the heavy-atom method without preliminary knowledge of the chemical formula. The independent anionic radical is a new corrugated layer related to layer pentaborates. Layers related by centers of inversion form sheets. Nd and Cl atoms are located in the intersheet space and in the large voids of the sheet. One of the positions of both Nd and Cl atoms is isomorphously shared with Na atoms and H2O molecules, respectively. The new borate is characterized as a polyborate (megaborate) containing the {(4:3[2T + Δ] + 1[Δ])∞ + (5[3T + 2Δ])∞}∞∞ complex anionic radical. The topological variants of the completion of the layer by additional triangles and the connection of layers into a framework are considered. The relationship between the new borate and the earlier studied LaB5O8(OH)2 . 1.5H2O framework borate is revealed.

  5. Etomidate blocks LTP and impairs learning but does not enhance tonic inhibition in mice carrying the N265M point mutation in the beta3 subunit of the GABA(A) receptor.

    Science.gov (United States)

    Zarnowska, E D; Rodgers, F C; Oh, I; Rau, V; Lor, C; Laha, K T; Jurd, R; Rudolph, U; Eger, E I; Pearce, R A

    2015-06-01

    Enhancement of tonic inhibition mediated by extrasynaptic α5-subunit containing GABAA receptors (GABAARs) has been proposed as the mechanism by which a variety of anesthetics, including the general anesthetic etomidate, impair learning and memory. Since α5 subunits preferentially partner with β3 subunits, we tested the hypothesis that etomidate acts through β3-subunit containing GABAARs to enhance tonic inhibition, block LTP, and impair memory. We measured the effects of etomidate in wild type mice and in mice carrying a point mutation in the GABAAR β3-subunit (β3-N265M) that renders these receptors insensitive to etomidate. Etomidate enhanced tonic inhibition in CA1 pyramidal cells of the hippocampus in wild type but not in mutant mice, demonstrating that tonic inhibition is mediated by β3-subunit containing GABAARs. However, despite its inability to enhance tonic inhibition, etomidate did block LTP in brain slices from mutant mice as well as in those from wild type mice. Etomidate also impaired fear conditioning to context, with no differences between genotypes. In studies of recombinant receptors expressed in HEK293 cells, α5β1γ2L GABAARs were insensitive to amnestic concentrations of etomidate (1 μM and below), whereas α5β2γ2L and α5β3γ2L GABAARs were enhanced. We conclude that etomidate enhances tonic inhibition in pyramidal cells through its action on α5β3-containing GABAA receptors, but blocks LTP and impairs learning by other means - most likely by modulating α5β2-containing GABAA receptors. The critical anesthetic targets underlying amnesia might include other forms of inhibition imposed on pyramidal neurons (e.g. slow phasic inhibition), or inhibitory processes on non-pyramidal cells (e.g. interneurons). PMID:25680234

  6. 10 CFR 26.5 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... entire shift cycle. Transporter means a general licensee, under 10 CFR 70.20(a), who is authorized to... that could result in potential offsite exposure comparable to the guidelines in 10 CFR 50.34(a)(1... and cognitive/motor functioning caused by human physiological processes (e.g., body...

  7. 40 CFR 265.116 - Survey plat.

    Science.gov (United States)

    2010-07-01

    ... professional land surveyor. The plat filed with the local zoning authority, or the authority with jurisdiction... of each hazardous waste disposal unit, an owner or operator must submit to the local zoning authority, or the authority with jurisdiction over local land use, and to the Regional Administrator, a...

  8. 40 CFR 265.1087 - Standards: Containers.

    Science.gov (United States)

    2010-07-01

    ... the conditions to be an empty container as defined in 40 CFR 261.7(b), the owner or operator shall... conditions for an empty container as specified in 40 CFR 261.7(b)), the owner or operator shall visually...) For the purpose of meeting the requirements of this section, an empty container as defined in 40...

  9. 21 CFR 558.265 - Halofuginone hydrobromide.

    Science.gov (United States)

    2010-04-01

    ... lakes, ponds, or streams. (ii) Amount per ton. Halofuginone 2.72 grams (0.0003 percent) plus... arsenic; do not feed to layers; avoid contact with skin, eyes, or clothing; keep out of lakes, ponds, or... layers; avoid contact with skin, eyes, or clothing; keep out of lakes, ponds, or streams. (vii)...

  10. 40 CFR 265.56 - Emergency procedures.

    Science.gov (United States)

    2010-07-01

    ... manifests and, if necessary, by chemical analysis. (c) Concurrently, the emergency coordinator must assess... hazardous surface water run-offs from water or chemical agents used to control fire and heat-induced..., or disposing of recovered waste, contaminated soil or surface water, or any other material...

  11. 40 CFR 265.1080 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... with the requirements contained in a Clean Air Act permit issued pursuant to 40 CFR 52.2454. The... applicable regulations under the authority of the Atomic Energy Act and the Nuclear Waste Policy Act. (7) A... under 40 CFR part 60, part 61, or part 63. For the purpose of complying with this paragraph, a tank...

  12. 29 CFR 1910.265 - Sawmills.

    Science.gov (United States)

    2010-07-01

    ... (see: 46 CFR 160.099 and 46 CFR 160.050) with line attached and maintained to retain buoyancy shall be... beams and other mechanical members; ratio of breaking load to safe load. (35) Saw guide. The term saw... to a minimum. (10) (11) Hazard marking. Physical hazard marking shall be as specified in §...

  13. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  14. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  15. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  16. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. II. Changes in progression rate and cell sequence between the stage irradiated and nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Portions of embryos of the grasshopper, Chortophaga viridifasciata (DeGeer), were cultured in hanging drops under quartz cover slips. Immediately after exposure to 225, 265, or 280 nm radiation, microscope observations at 380C were begun. The morphologically identified stage and the time after treatment of selected neuroblasts were recorded at short-time intervals until prometaphase was reached. Mitotic retardation induced by irradiation of prereplication stages (metaphase, anaphase, or early telophase) or S phase (middle or late telophase, interphase, or very early prophase) is greatest in postreplication stages (early, middle, and late prophase) and absent or minimal in stages morphologically identified as parts of S phase. Ultraviolet irradiation superimposes on the normal diversity of progression rates an additional variation factor, so that cells do not necessarily reach prometaphase in the order of their sequence at the time of treatment. This suggests the need for caution in ascribing particular radiosensitivities to substages of limited duration on the basis of the order in which they attain a subsequent stage

  17. 40 CFR Appendix IV to Part 265 - Tests for Significance

    Science.gov (United States)

    2010-07-01

    ... introductory statistics texts. ... student's t-test involves calculation of the value of a t-statistic for each comparison of the mean... parameter with its initial background concentration or value. The calculated value of the t-statistic...

  18. 40 CFR 265.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... requirements of 40 CFR part 302. (d) Secondary containment for tanks must include one or more of the following... section or an internal inspection or other tank integrity examination by a qualified Professional Engineer... to be assessed. Note: The practices described in the American Petroleum Institute (API)...

  19. 40 CFR Appendix I to Part 265 - Recordkeeping Instructions

    Science.gov (United States)

    2010-07-01

    ... Industrial Furnaces Listed in 40 CFR 260.10 (specify) (f)Other Treatment T94Containment Building (Treatment... Hectares Q Hectare-meter F Btu's per Hour I Pounds P Short tons T Kilograms K Tons M 1 Single digit symbols... Impoundment (to be closed as a landfill) D99Other Disposal (specify) 4. Miscellaneous X01Open...

  20. 7 CFR 2.65 - Administrator, Agricultural Research Service.

    Science.gov (United States)

    2010-01-01

    ... pollution control standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter... CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive Environmental Response... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Agricultural Research Service....

  1. 40 CFR 265.1063 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ... Method 21 in 40 CFR part 60. (2) The detection instrument shall meet the performance criteria of... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND... procedures specified in Reference Method 21. (4) Calibration gases shall be: (i) Zero air (less than 10...

  2. Dicty_cDB: SSE265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAAATATAAAATGAGAGTATTATTATCATTAGTTGTAATTTTATT CATTATAAATTCAGCCTTTGCTGTAAAGATTAATATTGGTCGTCCAACCAAATCACATA...A AACTATCCATCACGAAACTTGGGTAGAAGAACAAACTGATCAATTCGATAATATTAAAGT TGGCCAATTATTA...CTACCATTAGTCAGATTCAAAATCAAGCAAGATGTGGTTCTTGTTGGGCTTTTGGTGC TACAGAATCAGCTACTGATCGTTTATGTATTCACAATAATGAAAAT...GTTCAATTAAGTTT TATGGATATGGTTACTTGTGATGAAACTGATAACGGTTGTGAAGGTGGTGATGCCTTCTC TGCATGGAAT...GTGTCAATCAAATTCCTCTTTAA TTTATTCTCAAGACAAACATAAAATGGCTAAAATTTATTCTTTNGACTCTGATGAAGCAA TCATGCAAGAAATTGTTACTAAT

  3. 40 CFR 265.1101 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... industry such as the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM... wear surface). (2) A liquid collection and removal system to prevent the accumulation of liquid on the... conducted must be designed to prevent the release of liquids, wet materials, or liquid aerosols to...

  4. 40 CFR 265.301 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... defined in 40 CFR 270.2); and (C) The monofill is in compliance with generally applicable ground-water... cover or otherwise manage the landfill so that wind dispersal of the hazardous waste is controlled. ... each new landfill unit, each lateral expansion of a landfill unit, and each replacement of an...

  5. 40 CFR 265.443 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... pads must be sealed, coated, or covered with a surface material with a hydraulic conductivity of less... below the liner to prevent failure of the liner due to settlement, compression or uplift; and...

  6. 40 CFR 265.200 - Waste analysis and trial tests.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND... information on similar waste under similar operating conditions to show that the proposed treatment or storage... treat chemically or to store a hazardous waste that is substantially different from waste...

  7. 40 CFR 265.76 - Unmanifested waste report.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND...) If a facility accepts for treatment, storage, or disposal any hazardous waste from an off-site source...) The method of treatment, storage, or disposal for each hazardous waste; (6) The certification...

  8. 40 CFR 60.265 - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... provisions of this subpart shall install, calibrate, maintain, and operate a device to measure and continuously record the furnace power input. The furnace power input may be measured at the output or input side of the transformer. The device must have an accuracy of ±5 percent over its operating range....

  9. Dicty_cDB: SHL265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CK808839.1 Rasgsc1686 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, m...RNA sequence. 34 4e-05 3 CK808739 |CK808739.1 Rasgsc1529 Salivary Gland 4th instar 3rd period (spinning...04 1 CK808037 |CK808037.1 Rasgsc0316 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara am

  10. 14 CFR 171.265 - Glide path performance requirements.

    Science.gov (United States)

    2010-01-01

    ... least an angle equal to 1.752θ. As used in this section theta (θ), denotes the nominal glide path angle... exceed 10 percent. (m) At every half cycle of the combined 90 Hz and 150 Hz wave form, the modulation... wave forms pass through zero in the same direction within 20 degrees of phase relative to the 150...

  11. SU-E-T-265: Presage Thin Sheet Dosimeter Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Dumas, M; Rakowski, J [Wayne State University/Karmanos Cancer Institute, Detroit, MI (United States)

    2014-06-01

    Purpose: To quantify the sensitivity and stability of the Presage dosimeter in sheet form for different concentrations of chemicals and for a diverse range of clinical photon energies. Methods: Presage polymer dosimeters are formulated to investigate and optimize their sensitivity and stability. The dosimeter is composed of clear polyurethane base, leucomalachite green reporting dye, and bromoform radical initiator in 1mm thick sheets. The chemicals are well mixed together, cast in an aluminum mold, and left to cure at 60 psi for a minimum of 2 days. Dosimeter response will be characterized at multiple energies including Co-60, 6 MV, 15 MV, 50 kVp, and 250 kVp. The dosimeters are read by an Epson 10000 XL scanner at 800 dpi, 2{sup 16} bit depth. Red component images are analyzed with ImageJ. Results: Analysis of optical density verse dose for Co-60 energies indicates that the bromoform containing Presage was able to quantify dose from 0 to 300 Gy, with saturation beyond 300 Gy. Initial results show two regions of linear response, 0–100 Gy and 150–300 Gy. The 150–300 Gy region has a sensitivity of 0.0024 net OD/Gy. Further results on other energies are still in progress. Conclusions: This work shows the potential for use of thin sheets of Presage dosimeter as a dosimeter capable of being analyzed with a flatbed scanner.

  12. Dicty_cDB: VSH265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GAAGTATCAATAATT sequence update 2001. 3.22 Translated Amino Acid sequence *smgnfiqikiht*hin*qqwkennyklhhttqd...**kyq* Frame B: *smgnfiqikiht*hin*qqwkennyklhhttqdshnktklnivglttlitmvvsnitmv ttqnvklfstq*thyvqlpgfqngmnkkpli...sshqtefkyii*IINSSINNLFKKK--- ---*smgnfiqikiht*hin*qqwkennyklhhttqdshnktklnivglttl

  13. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  14. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  15. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  16. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  17. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  18. Yeast Interacting Proteins Database: YJR091C, YOR265W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available encoding membrane-associated proteins; involved in localizing the Arp2/3 complex to mitochondria; overexpression causes...ns; involved in localizing the Arp2/3 complex to mitochondria; overexpression causes increased sensitivity t

  19. Data acquisition and study of the fission of gold by 265MeV neon ions

    International Nuclear Information System (INIS)

    The aim of this work was to investigate the characteristics of fission in the interaction of 13 MeV/u Ne beams with Au targets. The results of this experiment performed on the ALICE facility at Orsay will make a low energy reference for further studies on similar systems to be developed at CERN at higher energies. At 13 MeV/u fission occurs after full momentum transfer for 90% of the observed events. Charged particles (p,α) detected in coincidence with fission exhibit the properties expected for an evaporative process taking place prior to fission. At this energy there is no hint for two-body friction resulting from elementary nucleon-nucleon collisions

  20. 40 CFR 265.141 - Definitions of terms as used in this subpart.

    Science.gov (United States)

    2010-07-01

    ... services to other entities in the future as a result of past transactions or events. Net working capital... cash or sold or consumed during the normal operating cycle of the business. Current liabilities...

  1. Doctorates Earned by Blacks Decline 26.5 Pct. in Decade.

    Science.gov (United States)

    Hirschorn, Michael W.

    1988-01-01

    The National Research Council's survey of earned doctorates found a continuing decline in the proportion of Ph.D.'s earned by U.S. citizens. Among Blacks, more than half of the doctorates were in education-related fields. Cornell University and MIT have started recruitment efforts to encourage minority groups. (MLW)

  2. 40 CFR 265.192 - Design and installation of new tank systems or components.

    Science.gov (United States)

    2010-07-01

    .... Note: The practices described in the National Association of Corrosion Engineers (NACE) standard, “Recommended Practice (RP-02-85)—Control of External Corrosion on Metallic Buried, Partially Buried, or Submerged Liquid Storage Systems,” and the American Petroleum Institute (API) Publication 1632,...

  3. 45 CFR 265.9 - What information must the State file annually?

    Science.gov (United States)

    2010-10-01

    ... in State or locality) center-based child care; (5) If the State has adopted the Family Violence... child care services made by the State through the use of disregards, by the following types of child care providers: (i) Licensed/regulated in-home child care; (ii) Licensed/regulated family child...

  4. 2K nonvolatile shadow RAM and 265K EEPROM SONOS nonvolatile memory development

    Energy Technology Data Exchange (ETDEWEB)

    Nasby, R.D.; Murray, J.R.; Habermehl, S.D.; Bennett, R.S.; Tafoya-Porras, B.C.; Mahl, P.R.; Rodriguez, J.L.; Jones, R.V.; Knoll, M.G.

    1998-07-01

    This paper describes Silicon Oxide Nitride Oxide Semiconductor (SONOS) nonvolatile memory development at Sandia National Laboratories. A 256K EEPROM nonvolatile memory and a 2K nonvolatile shadow RAM are under development using an n-channel SONOS memory technology. The technology has 1.2 {micro}m minimum features in a twin well design using shallow trench isolation.

  5. 12 CFR 265.7 - Functions delegated to Director of Division of Banking Supervision and Regulation.

    Science.gov (United States)

    2010-01-01

    ...(a)(3) of Regulation K (12 CFR 211.24(a)(3)); (B) Of a U.S. banking organization to establish a... improvement plan under subpart D of the Board's Rules of Practice for Hearings (12 CFR part 263). (4... Treasury Department regulations (17 CFR part 403) implementing the Government Securities Act of 1986,...

  6. 40 CFR 265 interim-status ground-water monitoring plan for the 2101-M pond

    International Nuclear Information System (INIS)

    This report outlines a ground-water monitoring plan for the 2101-M pond, located in the southwestern part of the 200-East Area on the Hanford Site in south-central Washington State. It has been determined that hazardous materials may have been discharged to the pond. Installation of an interim-status ground-water monitoring system is required under the Resource Conservation and Recovery Act to determine if hazardous chemicals are moving out of the pond. This plan describes the location of new wells for the monitoring system, how the wells are to be completed, the data to be collected, and how those data can be used to determine the source and extent of any ground-water contamination from the 2101-M pond. Four new wells are planned, one upgradient and three downgradient. 35 refs., 12 figs., 9 tabs

  7. 45 CFR 265.3 - What reports must the State file on a quarterly basis?

    Science.gov (United States)

    2010-10-01

    ... Territorial Financial Report). (2) Each State that claims MOE expenditures for a separate State program(s... Social Security Number and information such as the amount of assistance received, educational level... Financial Report (or Territorial Financial Report). (1) Each State must file quarterly expenditure data...

  8. Decree 2006-265/PRN of 18 August 2006 fixing the modalities of mining law application

    International Nuclear Information System (INIS)

    This decree fixes modalities of applying ordinance 93-16 of 2 march 1993 concerning mining law in Niger Republic and its subsequent modified text. Any petitioner, owner of mining title, prospecting authorization, opening and mining quarry, sub-leaser shall have an office in Niger Republic and notify it to the Minister of Mines and energy. each licence or lease is based on an agreement between the government and the society. Any change of status, capital or personnel of the company shall be noted to the Minister of Mines and energy. The company shall pay fiscal duties and respect rules and regulations concerning mines and quarries health and safety

  9. 40 CFR 265 interim-status ground-water monitoring plan for the 2101-M pond

    Energy Technology Data Exchange (ETDEWEB)

    Chamness, M.A.; Luttrell, S.P.; Dudziak, S.

    1989-03-01

    This report outlines a ground-water monitoring plan for the 2101-M pond, located in the southwestern part of the 200-East Area on the Hanford Site in south-central Washington State. It has been determined that hazardous materials may have been discharged to the pond. Installation of an interim-status ground-water monitoring system is required under the Resource Conservation and Recovery Act to determine if hazardous chemicals are moving out of the pond. This plan describes the location of new wells for the monitoring system, how the wells are to be completed, the data to be collected, and how those data can be used to determine the source and extent of any ground-water contamination from the 2101-M pond. Four new wells are planned, one upgradient and three downgradient. 35 refs., 12 figs., 9 tabs.

  10. 26 CFR 1.265-3 - Nondeductibility of interest relating to exempt-interest dividends.

    Science.gov (United States)

    2010-04-01

    ... interest relating to exempt-interest dividends. (a) In general. No deduction is allowed to a shareholder of... dividends distributed by the company to the shareholder during the shareholder's taxable year. (b) Interest... amount of exempt-interest dividends received by the shareholder. The denominator of the fraction is...

  11. 40 CFR 265.314 - Special requirements for bulk and containerized liquids.

    Science.gov (United States)

    2010-07-01

    ... carbon (e.g., aluminosilicates, clays, smectites, Fuller's earth, bentonite, calcium bentonite... of contamination of any “underground source of drinking water” (as that term is defined in 40 CFR 270... (organic free limestone); oxides/hydroxides, alumina, lime, silica (sand), diatomaceous earth;...

  12. The Class of 2010: Economic Prospects for Young Adults in the Recession. EPI Briefing Paper #265

    Science.gov (United States)

    Bivens, Josh; Edwards, Kathryn Anne; Hertel-Fernandez, Alexander; Turner, Anna

    2010-01-01

    It will take years for the labor market to recover from the damage induced by the recent recession. While monthly job losses almost surely peaked in 2009, the unemployment rate will likely peak in 2010 (CBO 2010a). In April, the unemployment rate reached 9.9% and the overall economic cause is simple: firms are not hiring quickly enough, as…

  13. 75 FR 67663 - Labeling Imported Wines With Multistate Appellations (2008R-265P)

    Science.gov (United States)

    2010-11-03

    ... predecessor agency, the Bureau of Alcohol, Tobacco and Firearms (ATF), in T.D. ATF-53 (43 FR 37675), published... Alcohol and Tobacco Tax and Trade Bureau 27 CFR Part 4 RIN 1513-AB58 Labeling Imported Wines With... the wine labeling regulations to allow the labeling of imported wines with multistate appellations...

  14. Features of radiochemical polymerization of the PEh-265 polyester lacquer on thermal insulating substrates

    International Nuclear Information System (INIS)

    The peculiarities of radiation polymerization of polyester lacquer on thermal insulating substrates have been investigated. The same features of polymerization on both pearlite and lignin substrates were studied. Physical, mechanical and thermal protective properties of the created materials were detected. It is shown that radiochemical modification of the surface layer on perlite or lignin substrates gives advanced heat-insulating materials

  15. 40 CFR 265.145 - Financial assurance for post-closure care.

    Science.gov (United States)

    2010-07-01

    ... equivalent coupon-issue yield announced by the U.S. Treasury for 26-week Treasury -securities. (11) The... he passes a financial test as specified in this paragraph. To pass this test the owner or operator...) The first payment must be made by the effective date of these regulations, except as provided...

  16. 40 CFR 265.1054 - Standards: Pressure relief devices in gas/vapor service.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Standards: Pressure relief devices in...: Pressure relief devices in gas/vapor service. (a) Except during pressure releases, each pressure relief...) After each pressure release, the pressure relief device shall be returned to a condition of...

  17. 42 CFR 423.265 - Submission of bids and related information.

    Science.gov (United States)

    2010-10-01

    ....329(b)) for all projected enrollees for purposes of risk adjusting any supplemental premium. (6... offers. Each bid must reflect a uniform benefit package, including premium (except as provided for the...) for a Part D eligible individual with a national average risk profile for the factors described...

  18. 49 CFR 26.5 - What do the terms used in this part mean?

    Science.gov (United States)

    2010-10-01

    ... Spanish or Portuguese culture or origin, regardless of race; (iii) “Native Americans,” which includes persons who are American Indians, Eskimos, Aleuts, or Native Hawaiians; (iv) “Asian-Pacific Americans...; (v) “Subcontinent Asian Americans,” which includes persons whose origins are from India,...

  19. Lahoud-Tatar Carine, Islam et politique au Koweït, Paris, PUF, 2011, 265 p.

    OpenAIRE

    Laurent Bonnefoy

    2011-01-01

    L’ouvrage de Carine Lahoud-Tatar part d’un constat simple mais évidemment judicieux : au-delà des berceaux que constituent l’Egypte, le Liban et l’Arabie Saoudite, il reste encore bien des objets islamistes à défricher dans le monde arabo-musulman. C’est ainsi que sa passionnante étude s’intéresse à un « petit pays », le Koweït, dont les pétrodollars ainsi que la proximité avec deux encombrants voisins que sont l’Iraq et l’Arabie Saoudite ont trop souvent contribué à occulter la riche histoir...

  20. Optimized adaptation algorithm for HEVC/H.265 dynamic adaptive streaming over HTTP using variable segment duration

    Science.gov (United States)

    Irondi, Iheanyi; Wang, Qi; Grecos, Christos

    2016-04-01

    Adaptive video streaming using HTTP has become popular in recent years for commercial video delivery. The recent MPEG-DASH standard allows interoperability and adaptability between servers and clients from different vendors. The delivery of the MPD (Media Presentation Description) files in DASH and the DASH client behaviours are beyond the scope of the DASH standard. However, the different adaptation algorithms employed by the clients do affect the overall performance of the system and users' QoE (Quality of Experience), hence the need for research in this field. Moreover, standard DASH delivery is based on fixed segments of the video. However, there is no standard segment duration for DASH where various fixed segment durations have been employed by different commercial solutions and researchers with their own individual merits. Most recently, the use of variable segment duration in DASH has emerged but only a few preliminary studies without practical implementation exist. In addition, such a technique requires a DASH client to be aware of segment duration variations, and this requirement and the corresponding implications on the DASH system design have not been investigated. This paper proposes a segment-duration-aware bandwidth estimation and next-segment selection adaptation strategy for DASH. Firstly, an MPD file extension scheme to support variable segment duration is proposed and implemented in a realistic hardware testbed. The scheme is tested on a DASH client, and the tests and analysis have led to an insight on the time to download next segment and the buffer behaviour when fetching and switching between segments of different playback durations. Issues like sustained buffering when switching between segments of different durations and slow response to changing network conditions are highlighted and investigated. An enhanced adaptation algorithm is then proposed to accurately estimate the bandwidth and precisely determine the time to download the next optimal segment considering the variable segment duration. Furthermore, objective metrics are employed to highlight the merits of the achieved compression efficiency using longer segment sizes for higher bitrate representations.

  1. 40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench

    International Nuclear Information System (INIS)

    This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs

  2. 39 CFR 265.13 - Compliance with subpoenas, summonses, and court orders by postal employees within the Inspection...

    Science.gov (United States)

    2010-07-01

    ...) Prevention of expenditures of government time and resources solely for private purposes. (3) If, in the... and consultative services under 5 CFR part 7001, provided that employees acting in this capacity must..., the Postal Service, or any other federal agency is not a named party. (d) Policy. (1) No current...

  3. 40 CFR 265.1058 - Standards: Pumps and valves in heavy liquid service, pressure relief devices in light liquid or...

    Science.gov (United States)

    2010-07-01

    ... liquid service, pressure relief devices in light liquid or heavy liquid service, and flanges and other... and valves in heavy liquid service, pressure relief devices in light liquid or heavy liquid service... devices in light liquid or heavy liquid service, and flanges and other connectors shall be...

  4. Discovery of SXP265, a Be/X-ray binary pulsar in the Wing of the Small Magellanic Cloud

    CERN Document Server

    Sturm, R; Vasilopoulos, G; Bartlett, E S; Maggi, P; Rau, A; Greiner, J; Udalski, A

    2014-01-01

    We identify a new candidate for a Be/X-ray binary in the XMM-Newton slew survey and archival Swift observations that is located in the transition region of the Wing of the Small Magellanic Cloud and the Magellanic Bridge. We investigated and classified this source with follow-up XMM-Newton and optical observations. We model the X-ray spectra and search for periodicities and variability in the X-ray observations and the OGLE I-band light curve. The optical counterpart has been classified spectroscopically, with data obtained at the SAAO 1.9 m telescope, and photometrically, with data obtained using GROND at the MPG 2.2 m telescope. The X-ray spectrum is typical of a high-mass X-ray binary with an accreting neutron star. We detect X-ray pulsations, which reveal a neutron-star spin period of P = (264.516+-0.014) s. The source likely shows a persistent X-ray luminosity of a few 10^35 erg/s and in addition type-I outbursts that indicate an orbital period of ~146 d. A periodicity of 0.867 d, found in the optical li...

  5. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  6. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  7. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  8. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  9. SU-E-J-265: Feasibility Study of Texture Analysis for Prognosis of Local Tumor Recurrence Within 5-Years for Pharyngeal-Laryngeal Carcinoma Patients Received Radiotherapy Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, W; Tu, S [Chang Gung University, Kwei-shan, Tao-Yuan, Taiwan (China)

    2015-06-15

    Purpose: Pharyngeal and laryngeal carcinomas (PLC) are among the top leading cancers in Asian populations. Typically the tumor may recur and progress in a short period of time if radiotherapy fails to deliver a successful treatment. Here we used image texture features extracted from images of computed tomography (CT) planning and conducted a retrospective study to evaluate whether texture analysis is a feasible approach to predict local tumor recurrence for PLC patients received radiotherapy treatment. Methods: CT planning images of 100 patients with PLC treated by radiotherapy at our facility between 2001 and 2010 are collected. These patients were received two separate CT scans, before and mid-course of the treatment delivery. Before the radiotherapy, a CT scanning was used for the first treatment planning. A total of 30 fractions were used in the treatment and patients were scanned with a second CT around the end of the fifteenth delivery for an adaptive treatment planning. Only patients who were treated with intensity modulated radiation therapy and RapidArc were selected. Treatment planning software of Eclipse was used. The changes of texture parameters between two CT acquisitions were computed to determine whether they were correlated to the local tumor recurrence. The following texture parameters were used in the preliminary assessment: mean, variance, standard deviation, skewness, kurtosis, energy, entropy, inverse difference moment, cluster shade, inertia, cluster prominence, gray-level co-occurrence matrix, and gray-level run-length matrix. The study was reviewed and approved by the committee of our institutional review board. Results: Our calculations suggested the following texture parameters were correlated with the local tumor recurrence: skewness, kurtosis, entropy, and inertia (p<0.0.05). Conclusion: The preliminary results were positive. However some works remain crucial to be completed, including addition of texture parameters for different image features, sensitivity of tumor segmentation variations, and effect of image filtering.

  10. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1)

    OpenAIRE

    Linda Paterson

    2008-01-01

    The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from ...

  11. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2008-06-01

    Full Text Available The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from his vast supply of treasure. Joan’s dream concludes with a vision of the eagle blowing out the fire, shining a great light over Montferrat, and settling in a high eyrie from which the whole world, now joyful, can be surveyed. Nicolet expounds this as the emperor’s desire for peace after vengeance, the Marquis of Montferrat’s submission, the emperor’s position of supreme command, and the prospect of appropriate rewards. The emperor is Frederick II Hohenstaufen and the author of the article proposes a new dating of the poem: it was probably composed in 1238 when the emperor, after his victory at the battle of Cortenuova in 1237 and subsequent subjection of several cities of the rebellious Lombard League, was arriving in Turin to receive the homage of Boniface II of Montferrat.

  12. Perancangan Heat Exchanger Type Shell And Tube Untuk After Cooler Kompressor Dengan Kapasitas 8000 m3/hr Pada Tekanan 26,5 Bar

    OpenAIRE

    Siregar, Franky S.

    2011-01-01

    Dalam kehidupan sehari-hari banyak terlihat fenomena perpindahan panas dari material atau fluida yang mempunyai temperatur lebih tinggi ke material atau fluida yang mempunyai temperatur lebih rendah. Dalam dunia industri fenomena perpindahan panas tersebut dimanfaatkan untuk keperluan proses dengan menggunakan suatu alat yang biasa disebut sebagai penukar panas atau heat exchanger. Heat exchanger merupakan alat yang digunakan sebagai media untuk memindahkan panas dari fluida yang bertemperatu...

  13. Millimeter wave transmission studies of YBa2Cu3O7-delta thin films in the 26.5 to 40.0 GHz frequency range

    Science.gov (United States)

    Miranda, F. A.; Gordon, W. L.; Bhasin, K. B.; Heinen, V. O.; Warner, J. D.; Valco, G. J.

    1989-01-01

    Millimeter wave transmission measurements through YBa2Cu3O(7-delta) thin films on MgO, ZrO2 and LaAlO3 substrates, are reported. The films (approx. 1 micron) were deposited by sequential evaporation and laser ablation techniques. Transition temperatures T sub c, ranging from 89.7 K for the Laser Ablated film on LaAlO3 to approximately 72 K for the sequentially evaporated film on MgO, were obtained. The values of the real and imaginary parts of the complex conductivity, sigma 1 and sigma 2, are obtained from the transmission data, assuming a two fluid model. The BCS approach is used to calculate values for an effective energy gap from the obtained values of sigma sub 1. A range of gap values from 2 DELTA o/K sub B T sub c = 4.19 to 4.35 was obtained. The magnetic penetration depth is evaluated from the deduced values of sigma 2. These results are discussed together with the frequency dependence of the normalized transmission amplitude, P/P sub c, below and above T sub c.

  14. Preliminary Results from the AIDP-2 and AIDP-3 Drill Cores Hint at Systematic Mo Enrichments in the ~2.65 Ga Roy Hill Shale

    Science.gov (United States)

    Roy, M.; Ostrander, C. M.; Lyons, T. W.; Olson, S. L.; Buick, R.; Anbar, A. D.

    2014-12-01

    In order to better understand the timing of the earliest oxygenation of Earth's surface environment, we are pursuing a multi-proxy investigation of paleoredox conditions in diamond drill cores through sedimentary rocks of the Archean Fortescue & Hamersley Groups. These cores were recovered in 2012 by the Agouron Institute from the Pilbara Craton of Western Australia. The AIDP-2 core samples a stratigraphic succession of carbonate and sulfidic, organic-rich shale in the Carawine Dolomite and Jeerinah Formation representing a shallow near-shore depositional setting. Core AIDP-3 samples a transition from BIF in the Marra Mamba Formation to organic-rich shales in the underlying Jeerinah Formation representing a deeper offshore depositional setting. We have analyzed 322 black shale samples from the Roy Hill Member of the Jeerinah Formation deposited just before the transition from the Fortescue to Hamersley Group. Roy Hill black shale units are mostly pyritic in AIDP-3, but are less so in AIDP-2. The Roy Hill Member of AIDP-3 extends from 2.629 Ga to2.676 Ga and contains the 2.632Ga Jeerinah impact layer, whereas the Roy Hill member of AIDP-2 is slightly older, lying beneath the Jeerinah impact layer, and has been dated to 2.636 Ga to >2.643 Ga [1]. Our initial findings reveal that Mo concentrations range between 0.7 and 7 ppm in the Roy Hill black shale member of AIDP-2 and AIDP-3. Corresponding Mo/Al ratios range between 1-9×10-5 ppm/ppm, indicating slight Mo enrichment relative to average continental crust. These results are consistent with a previous study by Scott et al. [2], which suggested little or no Mo enrichment. However, the higher resolution sampling in this study allows us to clearly resolve the Mo/Al depth profiles in these late Archean cores. These data suggest that the variations we see are not due to analytical scatter or sample variability, but instead represent real variations in Mo scavenged into these sediments. Ongoing work is focused on obtaining additional complementary datasets including Fe-speciation, TOC, and traditional and non-traditional isotopes. These data will provide the additional constraints needed to understand the origin and significance of Mo enrichments in these Archean sediments. [1] Rasmussen & Fletcher (2010) Geology, 38: 299-302 [2] Scott et al. (2011) Geology, 39:119-122.

  15. SU-E-J-265: Feasibility Study of Texture Analysis for Prognosis of Local Tumor Recurrence Within 5-Years for Pharyngeal-Laryngeal Carcinoma Patients Received Radiotherapy Treatment

    International Nuclear Information System (INIS)

    Purpose: Pharyngeal and laryngeal carcinomas (PLC) are among the top leading cancers in Asian populations. Typically the tumor may recur and progress in a short period of time if radiotherapy fails to deliver a successful treatment. Here we used image texture features extracted from images of computed tomography (CT) planning and conducted a retrospective study to evaluate whether texture analysis is a feasible approach to predict local tumor recurrence for PLC patients received radiotherapy treatment. Methods: CT planning images of 100 patients with PLC treated by radiotherapy at our facility between 2001 and 2010 are collected. These patients were received two separate CT scans, before and mid-course of the treatment delivery. Before the radiotherapy, a CT scanning was used for the first treatment planning. A total of 30 fractions were used in the treatment and patients were scanned with a second CT around the end of the fifteenth delivery for an adaptive treatment planning. Only patients who were treated with intensity modulated radiation therapy and RapidArc were selected. Treatment planning software of Eclipse was used. The changes of texture parameters between two CT acquisitions were computed to determine whether they were correlated to the local tumor recurrence. The following texture parameters were used in the preliminary assessment: mean, variance, standard deviation, skewness, kurtosis, energy, entropy, inverse difference moment, cluster shade, inertia, cluster prominence, gray-level co-occurrence matrix, and gray-level run-length matrix. The study was reviewed and approved by the committee of our institutional review board. Results: Our calculations suggested the following texture parameters were correlated with the local tumor recurrence: skewness, kurtosis, entropy, and inertia (p<0.0.05). Conclusion: The preliminary results were positive. However some works remain crucial to be completed, including addition of texture parameters for different image features, sensitivity of tumor segmentation variations, and effect of image filtering

  16. Microbicidal effect of the lactoferrin peptides Lactoferricin17-30, Lactoferrampin265-284, and Lactoferrin chimera on the parasite Entamoeba histolytica

    NARCIS (Netherlands)

    F. López-Soto; N. León-Sicairos; K. Nazmi; J.G. Bolscher; M. de la Garza

    2010-01-01

    Entamoeba histolytica is a parasitic protozoan that produces amoebiasis, an intestinal disease characterized by ulcerative colitis and dysentery. In some cases, trophozoites can travel to the liver leading to hepatic abscesses and death. Recently, lactoferrin and lactoferricin B have been shown to b

  17. Desenvolvimento de colônias de abelhas Apis mellifera africanizadasna região de Maringá, Estado do Paraná - DOI: 10.4025/actascianimsci.v29i1.265 Growing of Africanized honeybee colonies in Maringá region, State of Paraná - DOI: 10.4025/actascianimsci.v29i1.265

    Directory of Open Access Journals (Sweden)

    Wainer César Chiari

    2007-11-01

    Full Text Available O objetivo deste experimento foi estimar o desenvolvimento das colônias de Apis mellifera africanizadas no período de julho de 1999 a junho de 2000, na Fazenda Experimental, quanto às porcentagens de ocupações por cria, alimento e total dos favos,correlacioná-las com variáveis ambientais e determinar o teor de proteína bruta no pólenestocado pelas abelhas. Foram utilizadas cinco colônias de abelhas A. mellifera africanizadas, realizando-se mapeamentos e coletas de pólen mensalmente. Foram obtidos dados climáticos de temperatura máxima e mínima, umidade relativa máxima e mínima do ar eprecipitação pluviométrica de cada mês, coletados na própria Fazenda Experimental. As porcentagens médias de ocupação com cria (ovo-larva + pupa de operárias e zangões, com alimento (mel e pólen e da área total não foram diferentes entre as colônias (p>0,05. As abelhas africanizadas diminuíram sua população com temperaturas externas baixas (invernoe também com excesso de umidade relativa do ar (verão. O teor médio de proteína brutapresente no pólen durante o ano foi de 24,51%, sendo este valor aceitável para um bomdesenvolvimento das colônias.This research was carried out to evaluate the growing of Africanized honeybee colonies from July 1999 to June 2000, as for the percentages of occupation area with brood,food, occupied total area, to correlate them with environmental variables and to determine the tenor of crude protein in the pollen stocked in the combs by workers. Five colonies were mapped monthly, which were made the counting of the occupied area with brood, food, occupied total area and also the pollen was collected and submitted to thebromatological analysis to determine the tenor of crude protein. The medium percentages of occupation with brood (egg-larvae plus workers pupa and drones, with food (honey and pollen and of the occupied total area they were not also different among the treatments (p>0.05. The Africanized honeybee colonies reduced their population with low external temperatures (winter and also with excess of relative humidity of the air (summer. Themedium tenor of crude protein in the pollen during the year was 24.51%, and this value isacceptable for a good development of the colonies.

  18. Erratum to ``Eruption style and petrology of a new carbonatitic suite from the Mt. Vulture (Southern Italy): The Monticchio Lakes Formation'' [Journal of Volcanology and Geothermal Research 78 (1997) 251 265

    Science.gov (United States)

    Stoppa, Francesco; Principe, Claudia

    1998-01-01

    The Monticchio Lakes Formation (MLF) is a newly identified carbonatite-melilitite tuff sequence which is exposed in the southwestern sector of the Vulture volcano. It is the youngest example (ca. 0.13 m.y.) of this type of volcanism in Italy, although other carbonatites of smaller volume, but with similar characteristics, have been discovered recently. This volcanic event occurred in isolation after a 0.35 m.y. period of inactivity at Vulture. The eruption produced two maar-type vents and formed tuff aprons mainly composed of dune beds of lapilli. Depositional features suggest that a dry surge mechanism, possibly triggered by CO 2 expansion, was dominant during tuff emplacement. The MLF event involved a mixture of carbonatite and melilitite liquids which were physically separated before the eruption. Abundant mantle xenoliths are direct evidence of the deep-seated origin of the parental magma and its high velocity of propagation towards the surface. Often, these nodules form the core of lapilli composed of concentric shells of melilitite and/or porphyritic carbonatite. Coarse-ash beds alternate with lapilli beds and consist of abundant lumps and spherulae of very fine-grained calcite immersed in a welded, highly compacted carbonatite matrix. Porphyritic carbonatite shells of the lapilli and fine-grained spherulae of calcite in the tuff matrix suggest incipient crystallisation of a carbonatite liquid in subvolcanic conditions and eruption of carbonatite-spray droplets. Dark coloured juvenile fragments mainly consist of melilite, phlogopite, calcite, apatite, perovskite, and häuyne crystals in a carbonatite or melilitite matrix. The rocks have an extremely primitive, ultramafic composition with very high Mg# (> 85) and Cr and Ni content (1500 ppm). The calcite contains high SrO, BaO and REE of up to 1.5 wt.%. Similar compositions are typical of primary, magmatic carbonates which are found in both intrusive and extrusive carbonatites. The high modal Sr-Ba-REE-rich calcite, the typical mineralogy, and the high amount of Sr-group elements identify the carbonate component as a carbonatite. The very high Mg#, mantle debris and C, O, He isotope ratios in the range of mantle values indicate a near-primary character for the carbonatite which is distinctive of a restricted group of extrusive carbonatites only found in continental rift areas.

  19. Misael Arturo López Zapico. El tardofranquismo contemplado a través del periódico «The New York Times», Gijón, Ábaco Historia, 2010, 265 pp.

    Directory of Open Access Journals (Sweden)

    Antonio César Moreno Cantano

    2011-05-01

    Full Text Available La época calificada como «tardofranquismo», aquella que podemos englobar entre la designación de D. Juan Carlos como sucesor de Franco con el título de Rey (17 de julio de 1969 y la muerte del dictador (20 de noviembre de 1975, ha sido objeto preferente de atención por parte de la historiografía española en los últimos años. De igual manera, en fechas recientes, podemos localizar interesantes títulos que nos describen tan convulso periodo a través de las páginas de la prensa española. Es el caso de la obra colectiva La comunicación social durante el franquismo (2002, donde se localizan los trabajos de Bernardo Gómez Calderón, sobre el periodismo de opinión durante el final del franquismo; y el de Carlos Barrera del Barrio acerca de la apertura informativa en el tardofranquismo.

  20. Corrigendum to “Feasibility of dibromochloropropane (DBCP) and trichloroethylene (TCE) adsorption onto activated carbons made from nut shells of different almond varieties” [Ind. Crops Prod. 31 (2) (2010) 261-265

    Science.gov (United States)

    The authors would like to make the following correction in the above mentioned published article. In the Experimental Methods section, the original manuscript described an activation strategy for the pyrolyzed materials that was not accurate. The correct condition for activation was 800C for 45 m...

  1. Dynamics Explorer 1, retarding ion mass spectrometer summary spectrograms-82/230 to 82/265 spin-time spectrograms for H(+), He(+), O(+), N(+), O(++), M/Z = 2, and molecular ions

    Science.gov (United States)

    1995-01-01

    The retarding ion mass spectrometer (RIMS) experiment onboard the Dynamics Explorer 1 (DE 1) satellite was designed to perform energy and mass-per-charge analysis on low-energy ions (less than 50 eV) with mass/charge ratios ranging from 1 to 40 amu/Z. the DE 1 satellite, carrying the RIMS experiment, was launched into an elliptical polar orbit on August 3, 1981. The approximately 7.5 hour orbit has perigee of 675 km altitude and apogee of 24,875 km altitude. This document and those that follow in this series, contain summary RIMS data spectrograms for each orbit for which RIMS data are available. The RIMS instrument began returning science data on day 280 of 1981 and continued to return usable data until the end of the DE mission in March 1991. It should be noted that studies of the RIMS data set should be conducted only with a thorough awareness of the material described in the introduction section presented here, or in collaboration with a scientist familiar with RIMS data analysis.

  2. 40 CFR 262.34 - Accumulation time.

    Science.gov (United States)

    2010-07-01

    ... requirements of subparts I, AA, BB, and CC of 40 CFR part 265; and/or (ii) In tanks and the generator complies with the applicable requirements of subparts J, AA, BB, and CC of 40 CFR part 265 except §§ 265.197(c) and 265.200; and/or (iii) On drip pads and the generator complies with subpart W of 40 CFR part...

  3. 40 CFR 266.230 - What conditions must you meet for your LLMW to qualify for and maintain a storage and treatment...

    Science.gov (United States)

    2010-07-01

    ... solely to recordkeeping); (2) Store your LLMW in tanks or containers in compliance with chemical compatibility requirements of a tank or container in 40 CFR 264.177, or 264.199 or 40 CFR 265.177, or 265.199... standards found in 40 CFR 265.16(a)(3); (4) Conduct an inventory of your stored conditionally exempt LLMW...

  4. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  5. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  6. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  7. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  8. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  9. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  10. Final Report of a CRADA Between Pacific Northwest National Laboratory and the Ford Motor Company (CRADA No. PNNL/265): “Deactivation Mechanisms of Base Metal/Zeolite Urea Selective Catalytic Reduction Materials, and Development of Zeolite-Based Hydrocarbon Adsorber Materials”

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Feng; Kwak, Ja Hun; Lee, Jong H.; Tran, Diana N.; Peden, Charles HF; Howden, Ken; Cheng, Yisun; Lupescu, Jason; Cavattaio, Giovanni; Lambert, Christine; McCabe, Robert W.

    2013-02-14

    Reducing NOx emissions and particulate matter (PM) are primary concerns for diesel vehicles required to meet current LEV II and future LEV III emission standards which require 90+% NOx conversion. Currently, urea SCR as the NOx reductant and a Catalyzed Diesel Particulate Filter (CDPF) are being used for emission control system components by Ford Motor Company for 2010 and beyond diesel vehicles. Because the use of this technology for vehicle applications is new, the relative lack of experience makes it especially challenging to satisfy durability requirements. Of particular concern is being able to realistically simulate actual field aging of the catalyst systems under laboratory conditions. This is necessary both as a rapid assessment tool for verifying improved performance and certifiability of new catalyst formulations, and to develop a good understanding of deactivation mechanisms that can be used to develop improved catalyst materials. In addition to NOx and PM, the hydrocarbon (HC) emission standards are expected to become much more stringent during the next few years. Meanwhile, the engine-out HC emissions are expected to increase and/or be more difficult to remove. Since HC can be removed only when the catalyst becomes warm enough for its oxidation, three-way catalyst (TWC) and diesel oxidation catalyst (DOC) formulations often contain proprietary zeolite materials to hold the HC produced during the cold start period until the catalyst reaches its operating temperature (e.g., >200°C). Unfortunately, much of trapped HC tends to be released before the catalyst reaches the operating temperature. Among materials effective for trapping HC during the catalyst warm-up period, siliceous zeolites are commonly used because of their high surface area and high stability under typical operating conditions. However, there has been little research on the physical properties of these materials related to the adsorption and release of various hydrocarbon species found in the engine exhaust. For these reasons, automakers and engine manufacturers have difficulty improving their catalytic converters for meeting the stringent HC emission standards. In this collaborative program, scientists and engineers in the Institute for Integrated Catalysis at Pacific Northwest National Laboratory and at Ford Motor Company have investigated laboratory- and engine-aged SCR catalysts, containing mainly base metal zeolites. These studies are leading to a better understanding of various aging factors that impact the long-term performance of SCR catalysts and improve the correlation between laboratory and engine aging, saving experimental time and cost. We have also studied materials effective for the temporary storage of HC species during the cold-start period. In particular, we have examined the adsorption and desorption of various HC species produced during the combustion with different fuels (e.g., gasoline, E85, diesel) over potential HC adsorber materials, and measured the kinetic parameters to update Ford’s HC adsorption model. Since this CRADA has now been completed, in this final report we will provide brief summaries of most of the work carried out on this CRADA over the last several years.

  11. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  12. Protein (Cyanobacteria): 132072 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_16388957.1 1117:2585 1118:1325 1125:916 1126:265 1160282:588 DNA replication and...KDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRNA

  13. Protein (Cyanobacteria): 132069 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18817661.1 1117:2585 1118:1325 1125:916 1126:265 1160280:2557 DNA replication an...SKDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRN

  14. Protein (Cyanobacteria): 132068 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18832637.1 1117:2585 1118:1325 1125:916 1126:265 213618:2840 DNA replication and...KDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRNA

  15. Protein (Cyanobacteria): 132071 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18836028.1 1117:2585 1118:1325 1125:916 1126:265 1160283:2286 DNA replication an...SKDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRN

  16. Protein (Cyanobacteria): 132065 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18845491.1 1117:2585 1118:1325 1125:916 1126:265 1160285:2187 DNA replication an...SKDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRN

  17. Protein (Cyanobacteria): 132073 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18848159.1 1117:2585 1118:1325 1125:916 1126:265 721123:911 DNA replication and ...DRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRNAL

  18. Protein (Cyanobacteria): 132064 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18822167.1 1117:2585 1118:1325 1125:916 1126:265 1160286:2420 DNA replication an...SKDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRN

  19. Protein (Cyanobacteria): 132067 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_18828316.1 1117:2585 1118:1325 1125:916 1126:265 1160281:536 DNA replication and...KDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRRHLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRNA

  20. Gossudarstvo obdirajet avtovladeltsev / Viktoria Ladõnskaja

    Index Scriptorium Estoniae

    Ladõnskaja, Viktoria, 1981-

    2004-01-01

    Vaatamata autode registreerimisnumbrite omahinna langusele 265 kroonilt 62 kroonile tuleb registreerijal tasuda endiselt koos riigilõivuga 1600 krooni. Autode registreerimisnumbrite valmistamisega tegelevast firmast Number

  1. 78 FR 3877 - Radio Broadcasting Services; Peach Springs, AZ

    Science.gov (United States)

    2013-01-17

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Peach Springs, AZ AGENCY: Federal Communications... the Hualapai Tribe, proposing to amend the Table of Allotments by allotting Channel 265A at Peach... second potential service at Peach Springs. Channel 265A can be allotted at Peach Springs, Arizona,...

  2. 78 FR 25861 - Radio Broadcasting Services; Peach Springs, Arizona

    Science.gov (United States)

    2013-05-03

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Peach Springs, Arizona AGENCY: Federal Communications... Channel 265A as a first Tribal Allotment and a potential second local transmission service at Peach....) Channel 265A can be allotted at Peach Springs, consistent with the minimum distance...

  3. NCBI nr-aa BLAST: CBRC-TTRU-01-1252 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1252 ref|YP_001130163.1| O-antigen polymerase [Prosthecochloris vibrio...formis DSM 265] gb|ABP36661.1| O-antigen polymerase [Chlorobium phaeovibrioides DSM 265] YP_001130163.1 0.002 27% ...

  4. NCBI nr-aa BLAST: CBRC-DRER-07-0095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-07-0095 ref|YP_001130163.1| O-antigen polymerase [Prosthecochloris vibrio...formis DSM 265] gb|ABP36661.1| O-antigen polymerase [Prosthecochloris vibrioformis DSM 265] YP_001130163.1 0.33 27% ...

  5. NCBI nr-aa BLAST: CBRC-TGUT-25-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-25-0000 ref|YP_001130973.1| peptidase M50 [Prosthecochloris vibrioformis ...DSM 265] gb|ABP37471.1| peptidase M50 [Prosthecochloris vibrioformis DSM 265] YP_001130973.1 3.5 38% ...

  6. Unigene BLAST: CBRC-CELE-05-0840 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0840 gnl|UG|Cel#S5711503 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-265) (srh-265) mRNA, complete cds /cds=p(1,1005) /gb=NM_074433 /gi=17564021 /ug=Cel.31225 /len=1005 1e-142 73% ...

  7. Present state of the marine environment around India

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.

    stream_size 2 stream_content_type text/plain stream_name Mar_Archaeol_2_65.pdf.txt stream_source_info Mar_Archaeol_2_65.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  8. Globalization, increasing returns in component production, and the pattern of trade

    Czech Academy of Sciences Publication Activity Database

    Kovaříková Arro, Anu

    -, č. 265 (2005), s. 1-52. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : monopolistic competition * external and internal economies of scale * trade across the stages of production Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp265.pdf

  9. Drug: D03241 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03241 Drug Nitecapone (INN) C12H11NO6 265.0586 265.2188 D03241.gif catechol O-methyltransferase ... (COMT ) inhibitor [HSA:1312] [KO:K00545] hsa00140(1312) S ... Enzymes Transferases catechol O-methyltransferase (COMT ) [HSA:1312] [KO:K00545] Nitecapone D03241 Nitecapo ...

  10. Taxonomy of Late Jurassic - Early Cretaceous aptychi from Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Motchurova; Dekova, N.; Ilcheva, A.; Metodiev, L.

    2012-01-01

    Roč. 265, č. 3 (2012), s. 249-274. ISSN 0077-7749 Institutional research plan: CEZ:AV0Z30860518 Keywords : Late Jurassic * Early Cretaceous * Bulgaria * aptychi * ammonites * parataxonomy Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.923, year: 2012 http://www.schweizerbart.de/papers/njgpa/detail/265/78431/Taxonomy_of_Late_Jurassic_Early_Cretaceous_aptychi

  11. Drug: D08303 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08303 Mixture, Drug Ornithine aspartate; Hepa -Merz (TN) C4H7NO4. C5H12N2O2 265.1274 265.2637 D0 ... Ornithine [DR:D08302], L-Aspartic acid [DR:D00013] Hepa tic protectant CAS: 3230-94-2 PubChem: 96024990 Lig ...

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

  13. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  14. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  15. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  16. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  17. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  18. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  19. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  20. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  1. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  2. 77 FR 12082 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-02-28

    ... January 18, 2011. Inc., Regional Service Center, Chartis, Inc. 81,265 Seagate US LLC, Shrewsbury, MA March 6, 2011. Shrewsbury Division. 81,279 Springs Window Fashions, Montgomery, PA February 27, 2012....

  3. Helminth genome projects: all or nothing

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; Horák, Aleš; Scholz, Tomáš

    2005-01-01

    Roč. 21, č. 6 (2005), s. 265-266. ISSN 1471-4922 Institutional research plan: CEZ:AV0Z60220518 Keywords : genome project * helminth * Dracunculus Subject RIV: EG - Zoology Impact factor: 4.526, year: 2005

  4. StreamCat

    Data.gov (United States)

    U.S. Environmental Protection Agency — The StreamCat Dataset provides summaries of natural and anthropogenic landscape features for ~2.65 million streams, and their associated catchments, within the...

  5. Breast Cancer Disparities

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  6. CDC Vital Signs: Breast Cancer

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  7. Checking the Goldbach conjecture on a vector computer

    NARCIS (Netherlands)

    Granville, A.; Lune, J. van de; Riele, H.J.J. te

    1989-01-01

    bibliographical data to be processed -- Number theory and applications (Banff, AB, 1988) Pages: 423--433 Series: NATO Adv. Sci. Inst. Ser. C Math. Phys. Sci. Vol: 265 -- Kluwer Acad. Publ. (Dordrecht) -- 10

  8. How States Cooperate

    DEFF Research Database (Denmark)

    Tsingou, Eleni

    2014-01-01

    Review of: Institutional Choice and Global Commerce. By Joseph Jupille, Walter Mattli, and Duncan Snidal. New York, NY: Cambridge University Press, 2013, 265 pp., $95.00 hardcover (ISBN-13: 978-1-107-03895-0)....

  9. 2012 MDEQ-FEMA Madison-Yazoo Lidar Survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The project entails the acquisition and processing of LiDAR for approximately 1,265 square miles covering areas of Madison and Eastern Yazoo Counties. Collect and...

  10. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can...

  11. Competing for Private Banking Pie in China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ China's private banking: A big piece of the pie PricewaterhouseCoopers (PWC) released a report on the global private banking sector in 2007 after top executives from 265 companies in 43 countries answered responded to a questionnaire.

  12. Genetics Home Reference: Waldenström macroglobulinemia

    Science.gov (United States)

    ... deletions associated with B-cell lymphomagenesis. Blood. 2014 Mar 13;123(11):1637-46. doi: 10.1182/ ... SP. A mutation in MYD88 (L265P) supports the survival of lymphoplasmacytic cells by activation of Bruton tyrosine ...

  13. Performance evaluation of the intra compression in the video coding standards

    Science.gov (United States)

    Abramowski, Andrzej

    2015-09-01

    The article presents a comparison of the Intra prediction algorithms in the current state-of-the-art video coding standards, including MJPEG 2000, VP8, VP9, H.264/AVC and H.265/HEVC. The effectiveness of techniques employed by each standard is evaluated in terms of compression efficiency and average encoding time. The compression efficiency is measured using BD-PSNR and BD-RATE metrics with H.265/HEVC results as an anchor. Tests are performed on a set of video sequences, composed of sequences gathered by Joint Collaborative Team on Video Coding during the development of the H.265/HEVC standard and 4K sequences provided by Ultra Video Group. According to results, H.265/HEVC provides significant bit-rate savings at the expense of computational complexity, while VP9 may be regarded as a compromise between the efficiency and required encoding time.

  14. The Importance of Subtextual Impression Management and Business Faculty.

    Science.gov (United States)

    Chaney, Lillian H.; Lyden, Julie A.

    1998-01-01

    College students (n=265) reported their impressions of business faculty's personal appearance, body language, behavior, and office appearance. Findings indicate that impression management is useful for professors who want to convey credibility, authority, and interest in students. (JOW)

  15. V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Markl, Martin; Somer, L.

    2013-01-01

    Roč. 58, č. 4 (2013), s. 265-273. ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

  16. Risk factors for hypertension and impact of postoperative hypertension on medium survival after heart transplantation

    Institute of Scientific and Technical Information of China (English)

    柳青

    2013-01-01

    Objective To access the prevalence and risk factors for hypertension after heart transplantation(HT),and the impact of post-transplant hypertension on mediumterm survival among HT patients.Methods Data from 265 consecutive

  17. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2014-01-01

    Roč. 61, č. 6 (2014), s. 265-271. ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  18. Adjustment to Spinal Cord Injury

    Science.gov (United States)

    ... may need to work to help with family finances. All of the changes that they face can ... 2000). Goal instability and adjustment to physical disability. Journal of Counseling Psychology, 47(2). 251-265. This ...

  19. 76 FR 53453 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2011-08-26

    ...-265-5175. Revision to FR Notice Published 06/03/2011: Extending Comment Period from 09/01/2011 to 10... Otters (Enhydra lutris nereis) Translocation Program, Updated Information to the DSEIS 2005, San...

  20. Disease: H00254 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Familial isolated growth hormone deficiency: genetics and pathophysiology. Endocr J 49:265-72 (2002) PMID:9...799079 Procter AM, Phillips JA 3rd, Cooper DN The molecular genetics of growth hormone deficiency. Hum Genet

  1. Violence, Permissiveness and the Overpunished Child

    Science.gov (United States)

    Welsh, Ralph S.

    1976-01-01

    Reported are investigations into the relationship between severe parental punishment and delinquency, leading to the conclusion that physical abuse of children leads to aggressive and anti-social behavior. Available from: EC 090 265. (IM)

  2. Coat colour and chromosome variation in cetral European populations of the weasel (Mustela nivalis)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Cenevová, E.

    2002-01-01

    Roč. 51, č. 4 (2002), s. 265-274. ISSN 0139-7893 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : weasel * pelage coloration * karyotype Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/4/265-274.pdf

  3. Structural and stress analysis of mining practice in the Upper Silesian Coal Basin

    Czech Academy of Sciences Publication Activity Database

    Waclawik, Petr; Ptáček, Jiří; Grygar, R.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 255-265. ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : horizontal stress * structural analysis * mine roadway stability * coal mining * rock burst Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_15_Waclawik_255-265.pdf

  4. General binocular disorders: prevalence in a clinic population

    OpenAIRE

    Lara Lacarcel, Francisco; Cacho Martínez, Pilar; García Muñoz, Ángel; Megías, Ramón

    1999-01-01

    The purpose of this paper was to study the prevalence of nonstrabismic accommodative and binocular dysfunctions in a clinical population. We examined 265 symptomatic patients who were chosen from an optometric clinic. We performed several tests to diagnose any form of refractive, accommodative or binocular dysfunction. Of the 265 subjects examined, 59 patients (22.3%) had some form of accommodative or binocular dysfunction and required not just the correction of the refractive error but a spe...

  5. 77 FR 55808 - Certain Preserved Mushrooms From the People's Republic of China: Final Results of Antidumping...

    Science.gov (United States)

    2012-09-11

    ... Results of Antidumping Duty Administrative Review, and Rescission in Part, 77 FR 13264 (March 6, 2012... status.\\6\\ \\2\\ Id. \\3\\ See id. at 77 FR 13,264. \\4\\ See id. at 77 FR 13,265-67. \\5\\ See id. at 77 FR 13,265. \\6\\ See id. at 77 FR 13,266-67. In the Preliminary Results, we invited parties to comment.\\7\\...

  6. The Distressed (Type D) Personality Is Independently Associated With Tinnitus: A Case-Control Study

    OpenAIRE

    Bartels, Hilke; Middel, Berrie; Pedersen, Susanne S.; Staal, Michiel J; Albers, Frans W. J.

    2010-01-01

    Background: Tinnitus is a common and disturbing condition, reported by 10% to 20% of the general population. Objective: The authors sought to determine personality characteristics associated with tinnitus patients versus a control group of ear-nose-throat (ENT) patients without tinnitus. Method: Adult chronic tinnitus sufferers (N = 265) and ENT patients without tinnitus (N = 265) participated in a cross-sectional study. The authors evaluated personality characteristics with tests for distres...

  7. AcEST: DK960272 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_P11 617 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_P11. 5' end seq ... 29/168 (76%) Frame = +2 Query: 86 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 265 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 29/168 (76%) Frame = +2 Query: 86 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 265 MLVYQ ... LWEV+G WVV+GAVDVDIGANPSA Sbjct: 1 MLVYQDKLSGDELLSDSFPY RELENGVLWEVDGHWVVQGAVDVDIGANPSAEGGGEDEGV 60 Query: ...

  8. Gratings in plasmonic V-groove waveguides

    DEFF Research Database (Denmark)

    Smith, Cameron; Cuesta, Irene Fernandez; Kristensen, Anders

    2011-01-01

    We introduce visible light optical gratings to surface plasmon V-groove waveguides. Gradient e-beam dosage onto silicon stamp enables structuring V-grooves of varying depth. Nanoimprint lithography maintains a Λ=265 nm corrugation for gold surface devices.......We introduce visible light optical gratings to surface plasmon V-groove waveguides. Gradient e-beam dosage onto silicon stamp enables structuring V-grooves of varying depth. Nanoimprint lithography maintains a Λ=265 nm corrugation for gold surface devices....

  9. A new constraint on the molecular oxygen abundance at $z \\sim 0.886$

    CERN Document Server

    Kanekar, Nissim

    2015-01-01

    We report Karl G. Jansky Very Large Array (VLA) and Atacama Large Millimeter Array (ALMA) spectroscopy in the redshifted molecular oxygen (O$_2$) 56.265~GHz and 424.763~GHz transitions from the $z=0.88582$ gravitational lens towards PKS\\,1830$-$21. The ALMA non-detection of O$_2$ 424.763~GHz absorption yields the $3\\sigma$ upper limit $N({\\rm O}_2) \\leq 5.8 \\times 10^{17}$~cm$^{-2}$ on the O$_2$ column density, assuming that the O$_2$ level populations are thermalized at the gas kinetic temperature of 80~K. The VLA spectrum shows absorption by the CH$_3$CHO 56.185~GHz and 56.265~GHz lines, with the latter strongly blended with the O$_2$ 56.265~GHz line. Since the two CH$_3$CHO lines have the same equilibrium strength, we used the known CH$_3$CHO 56.185~GHz line profile to subtract out the CH$_3$CHO 56.265~GHz feature from the VLA spectrum, and then carried out a search for O$_2$ 56.265~GHz absorption in the residual spectrum. The non-detection of redshifted O$_2$ 56.265~GHz absorption in the CH$_3$CHO-subtrac...

  10. The vaccine properties of a Brazilian bovine herpesvirus 1 strain with an induced deletion of the gE gene

    International Nuclear Information System (INIS)

    Aiming at the development of a differential vaccine (DIVA) against infectious bovine rhinotracheitis (IBR), a Brazilian strain of bovine herpesvirus type 1 (BHV1) with a deletion of the glycoprotein E (gE) gene was constructed (265gE-). Here we present the experiments performed with this strain in order to evaluate its safety and efficacy as a vaccine virus in cattle. In the first experiment, a group of calves was inoculated with 265gE- and challenged with wild type virus 21 days post-inoculation. Calves immunized with 265gE- virus and challenged with wild type virus developed very mild clinical disease with a significant reduction in the amount of virus excretion and duration. The safety of the 265gE- during pregnancy was assessed using 22 pregnant cows, at different stages of gestation, that were inoculated with the 265gE- virus intramuscularly, with 15 pregnant cows kept as non-vaccinated controls. No abortions, stillbirths or foetal abnormalities were seen after vaccination. The results show that the 265gE- recombinant is attenuated and able to prevent clinical disease upon challenge. This recombinant will be further evaluated as a candidate virus for a BHV1 differential vaccine. (author)

  11. Experiments with Superheavy Nuclei

    Science.gov (United States)

    Hofmann, S.

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α -α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  12. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO3, HReO4) ΔHads(ReO3) = -190 ± 10 kJ/mol; ΔSads(ReO3) = -179±30 J/mol K; ΔHads(HReO4) = -77 ± 5 kJ/mol; ΔSads(HReO4) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176Re, 152-155Er, 151-154Ho, 218Po, and 214Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  13. Experiments with superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author) 34 refs, 7 figs

  14. Chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Schaedel, M. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan). Advanced Science Research Center; GSI Helmholtz Center for Heavy Ion Research, Darmstadt (Germany)

    2012-07-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  15. New elements produced at GSI

    Science.gov (United States)

    Hofmann, Sigurd

    1998-12-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  16. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A. [Paul-Scherrer-Inst., Villigen (Switzerland); Gaeggeler, H.W. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Paul-Scherrer-Inst., Villigen (Switzerland)

    1999-07-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) {r_reversible} X(ads) (X = ReO{sub 3}, HReO{sub 4}) {delta}H{sub ads}(ReO{sub 3}) = -190 {+-} 10 kJ/mol; {delta}S{sub ads}(ReO{sub 3}) = -179{+-}30 J/mol K; {delta}H{sub ads}(HReO{sub 4}) = -77 {+-} 5 kJ/mol; {delta}S{sub ads}(HReO{sub 4}) = -187{+-}50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes {sup 169,170,174,176}Re, {sup 152-155}Er, {sup 151-154}Ho, {sup 218}Po, and {sup 214}Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  17. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, J.C.; Mizel, A.; Cote, M.; Cohen, M.L.; Louie, S.G. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States))

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (B[sub o]), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (B[sub o]). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated B[sub o] for Hs is comparable to that of diamond. [copyright] [ital 1999] [ital The American Physical Society

  18. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  19. Experiments with superheavy nuclei

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  20. Synthesis of heavy and superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. (Gesellschaft fur Schwerionenforshung (GSI), Darmstadt (Germany))

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-de-excitation channels. The isotopes were ambiguously identified by means of [alpha]-[alpha] correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on this results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reaction using [sup 208]Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use the neutron deficient projectile isotopes and use of actinide targets is discussed.

  1. New elements produced at GSI

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed

  2. Combining ability for maturity and plant height in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    A 5 * 5 F1 diallel cross hybrids of Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt along with parents were evaluated through combining ability for days to flowering (initiation and completion), days to maturity and plant height. Highly significant differences were recorded for all the traits. Mean squares due to general, specific and reciprocal combining ability were significant for all the traits except plant height for which the latter two components were non-significant. Prevalence of additive (plant height), non-additive (days to flowering completion; days to maturity) and reciprocal effects (days to flowering initiation) were detected. Parental line G-403 was best general combiner for all the traits. The F1 hybrids G-902 * G-265 (days to flowering initiation), G-902 * G-403 (days to flowering completion), G-265 * G-1500 (days to maturity) and G-909 * G-265 (plant height) were superior and may be exploited for future breeding programs. (author)

  3. Sequential unfolding of the hemolysin two-partner secretion domain from Proteus mirabilis.

    Science.gov (United States)

    Wimmer, Megan R; Woods, Christopher N; Adamczak, Kyle J; Glasgow, Evan M; Novak, Walter R P; Grilley, Daniel P; Weaver, Todd M

    2015-11-01

    Protein secretion is a major contributor to Gram-negative bacterial virulence. Type Vb or two-partner secretion (TPS) pathways utilize a membrane bound β-barrel B component (TpsB) to translocate large and predominantly virulent exoproteins (TpsA) through a nucleotide independent mechanism. We focused our studies on a truncated TpsA member termed hemolysin A (HpmA265), a structurally and functionally characterized TPS domain from Proteus mirabilis. Contrary to the expectation that the TPS domain of HpmA265 would denature in a single cooperative transition, we found that the unfolding follows a sequential model with three distinct transitions linking four states. The solvent inaccessible core of HpmA265 can be divided into two different regions. The C-proximal region contains nonpolar residues and forms a prototypical hydrophobic core as found in globular proteins. The N-proximal region of the solvent inaccessible core, however, contains polar residues. To understand the contributions of the hydrophobic and polar interiors to overall TPS domain stability, we conducted unfolding studies on HpmA265 and site-specific mutants of HpmA265. By correlating the effect of individual site-specific mutations with the sequential unfolding results we were able to divide the HpmA265 TPS domain into polar core, nonpolar core, and C-terminal subdomains. Moreover, the unfolding studies provide quantitative evidence that the folding free energy for the polar core subdomain is more favorable than for the nonpolar core and C-terminal subdomains. This study implicates the hydrogen bonds shared among these conserved internal residues as a primary means for stabilizing the N-proximal polar core subdomain. PMID:26350294

  4. Angular and velocity distributions of NO scattered from the Pt(111) crystal surface

    Energy Technology Data Exchange (ETDEWEB)

    Guthrie, W.L.; Lin, T.; Ceyer, S.T.; Somorjai, G.A.

    1982-06-15

    The angular and velocity distributions of NO scattered from the Pt(111) surface have been measured for a crystal temperature range of 475--1200 K and for an incident beam energy range of 265--1390 K. Both angular and velocity distributions confirm the coexistence of inelastic and trapping-desorption scattering processes. For beams with a kinetic energy of /2k equal to 265 and 615 K, the molecules scattered into angles near the surface normal were found to be equilibrated with the surface for T/sub s/ between 475 and 900 K.

  5. Intense concentration of technetium-99m pyrophosphate in the kidneys of children treated with chemotherapeutic drugs for malignant disease

    International Nuclear Information System (INIS)

    Seventeen of 265 bone scans in children receiving chemotherapy for various malignant diseases exhibited intense renal parenchymal uptake of radioactivity during bone imaging. In a retrospective analysis, it was learned that uptake occurred when imaging was performed within one week of cancer chemotherapy. It was encountered after injection of cyclophosphamide (P less than C.05), vincristine (P less than 0.01), and doxorubicin (P less than 0.02). In this series, none of the 265 scans showed intense renal uptake unless the patient received chemotherapeutic drugs in the preceding week. This finding did not seem to result from altered renal function, and the exact cause has not been defined

  6. Dicty_cDB: SSE503 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE503 (Link to dictyBase) - - - Contig-U00406-1 SSE503P (Link to Original ... m chromoso... 265 2e-69 (Q550W6) RecName: Full=GDP-fucose ... transporter 1; AltName: Full=S... 265 2e-69 (A9UUB ... 8) RecName: Full=GDP-fucose ... transporter 1; AltName: Full=S... 87 8e-16 (A7S1L6 ...

  7. Verification of Numerical Model for Trabecular Tissue using Compression Test and Time-Lapse X-Ray Radiography based on Material Model Determined from Three-Point Bending Test of Single Trabecula

    Czech Academy of Sciences Publication Activity Database

    Zlámal, P.; Doktor, Tomáš; Jiroušek, Ondřej; Jandejsek, I.

    Vol. 586. Durnten-Zurich : Trans Tech Publications, 2014 - (Pešek, L.; Zubko, P.), s. 265-269 ISBN 978-3-03785-876-9. ISSN 1013-9826. [International Conference on Local Mechanical Properties /9./. Levoča (SK), 07.11.2012-09.11.2012] R&D Projects: GA ČR(CZ) GAP105/10/2305 Institutional support: RVO:68378297 Keywords : compression test * FEM * radiography * three-point bending Subject RIV: JJ - Other Materials www.scientific.net/KEM.586.265

  8. Profil studenckiej rekreacji ruchowej na podstawie wybranych pomiarów spirometrycznych. Badania pilotażowe = The recreational student profile based on chosen spirometric measurements

    OpenAIRE

    Pujszo, Małgorzata; Drumińska, Ewelina; Wilczyńska, Sylwia; Stępniak, Robert; Pabianek, Łukasz

    2014-01-01

    Pujszo Małgorzata, Drumińska Ewelina, Wilczyńska Sylwia, Stępniak Robert, Pabianek Łukasz. Profil studenckiej rekreacji ruchowej na podstawie wybranych pomiarów spirometrycznych. Badania pilotażowe = The recreational student profile based on chosen spirometric measurements. The pilot studies. Journal of Health Sciences. 2014;4(13):257-265. ISSN 1429-9623 / 2300-665X. http://journal.rsw.edu.pl/index.php/JHS/article/view/2014%3B4%2813%29%3A257-265 http://www.ojs.ukw.edu.pl/index....

  9. Development and Testing of an Animal Feed Mixing Machine

    OpenAIRE

    A. A. Balami; D. Adgidzi; A. Mua’zu

    2013-01-01

    An animal feed mixing machine was designed, developed and tested. The machine was tested using a feed components divided into three equal measures of 50 kg for ground corn, 0.265 kg for cassava flour and 2.65 kg for shelled corn replicated thrice at four mixing durations of 5, 10, 15 and 20 min. The average CV is 4.84% which shows a significant reduction in feed components for the samples tested. The degree of mixing attained was 95.16% which portrays an improvement of about 7.8% reduction i...

  10. The Anthropogenic "Greenhouse Effect": Greek Prospective Primary Teachers' Ideas about Causes, Consequences and Cures

    Science.gov (United States)

    Ikonomidis, Simos; Papanastasiou, Dimitris; Melas, Dimitris; Avgoloupis, Stavros

    2012-01-01

    This study explores the ideas of Greek prospective primary teachers about the anthropogenic greenhouse effect, particularly about its causes, consequences and cures. For this purpose, a survey was conducted: 265 prospective teachers completed a closed-form questionnaire. The results showed serious misconceptions in all areas (causes, consequences…

  11. Calibrating your grain drill or seeder can save both seed and money

    Science.gov (United States)

    The agronomic impact of over-seeding or under-seeding a field is complex. Most farmers have worked out a seeding rate with their agronomist. Exceeding that rate may not be productive, especially at $265+ per bag of alfalfa ($500 for switchgrass). Over-seeding costs add up, even across a small number...

  12. Life history and population dynamics of an estuarine amphipod, Eriopisa chilkensis Chilton (Gammaridae)

    Digital Repository Service at National Institute of Oceanography (India)

    Aravind, N.P.; Sheeba, P.; Nair, K.K.C.; Achuthankutty, C.T.

    was found to be higher (maximum: 220 days) than males (maximum: 175 days). Females were iteroparous and attained sexual maturity within 39.3 + or - 6 days (mean + or - SD), whereas males matured within 26.5 + or - 5.6 days. Number of broods in a life span...

  13. Seasonal variation of microzooplankton (20-200 mu m) and its possible implications on the vertical carbon flux in the western Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothibabu, R.; Madhu, N.V.; Maheswaran, P.A.; Jayalakshmy, K.V.; Nair, K.K.C.; Achuthankutty, C.T.

    Stratification (throughout the year) and low solar radiation (during monsoon periods) have caused low chlorophyll a and primary production (seasonal average 13-18 mg m sup(-2) and 242-265 mg C m sup(-2) d sup(-1), respectively) in the western Bay...

  14. Německé politické strany v českých zemích 1861-1918

    Czech Academy of Sciences Publication Activity Database

    Šebek, Jaroslav

    Olomouc : Katedra politologie a evropských studií Filozofické fakulty Univerzity Palackého v Olomouci, 2000 - (Marek, P.), s. 254-265 ISBN 80-86200-25-6 Institutional research plan: CEZ:AV0Z8015903 Subject RIV: AB - History

  15. Alternative primer sets for PCR detection of genotypes involved in bacterial aerobic BTEX degradation: Distribution of the genes in BTEX degrading isolates and in subsurface soils of a BTEX contaminated industrial site

    Czech Academy of Sciences Publication Activity Database

    Hendrickx, B.; Junca, H.; Vosáhlová, Jolana; Lindner, A.; Rüegg, I.; Bucheli-Vitschel, M.; Faber, F.; Egli, F.; Mau, M.; Schlömann, M.; Brennerová, Mária; Brenner, Vladimír; Pieper, D. H.; Top, E.M.; Dejonghe, W.; Bastiaens, L.; Springael, D.

    2006-01-01

    Roč. 64, - (2006), s. 250-265. ISSN 0167-7012 Institutional research plan: CEZ:AV0Z50200510 Keywords : pcr detection * aerobic btex biodegradation * catabolic gene distribution Subject RIV: EE - Microbiology, Virology Impact factor: 2.442, year: 2006

  16. Draft Genome Sequence of a Novel Culturable Marine Chroococcalean Cyanobacterium from the South Atlantic Ocean

    OpenAIRE

    Rigonato, Janaina; Alvarenga, Danillo O.; Branco, Luis H. Z.; Varani, Alessandro M.; Brandini, Frederico P.; Fiore, Marli F.

    2015-01-01

    The novel chroococcalean cyanobacterium strain CENA595 was isolated from the deep chlorophyll maximum layer of the continental shelf of the South Atlantic Ocean. Here, we report the draft genome sequence for this strain, consisting of 60 contigs containing a total of 5,265,703 bp and 3,276 putative protein-coding genes.

  17. Draft genome sequence of a novel culturable marine chroococcalean cyanobacterium from the South atlantic ocean.

    Science.gov (United States)

    Rigonato, Janaina; Alvarenga, Danillo O; Branco, Luis H Z; Varani, Alessandro M; Brandini, Frederico P; Fiore, Marli F

    2015-01-01

    The novel chroococcalean cyanobacterium strain CENA595 was isolated from the deep chlorophyll maximum layer of the continental shelf of the South Atlantic Ocean. Here, we report the draft genome sequence for this strain, consisting of 60 contigs containing a total of 5,265,703 bp and 3,276 putative protein-coding genes. PMID:25908150

  18. Influence of the Annealing Temperature on the Photovoltaic Performance and Film Morphology Applying Novel Thermocleavable Materials

    DEFF Research Database (Denmark)

    Petersen, Martin Helgesen; Bjerring, Morten; Nielsen, Niels Chr.;

    2010-01-01

    a weight loss around 200 °C corresponding to elimination of the ester side chains followed by a second weight loss around 300 °C corresponding to loss of CO2 via decarboxylation. The temperature of thermocleavage of the active layer films was optimized to 265 °C whereby the T2:PCBM solar cells...

  19. Protonation of benzo-18-crown-6: Extraction and DFT study

    Czech Academy of Sciences Publication Activity Database

    Toman, Petr; Makrlík, E.; Vaňura, P.; Kašička, Václav

    2011-01-01

    Roč. 225, č. 2 (2011), s. 265-270. ISSN 0942-9352 R&D Projects: GA ČR(CZ) GAP205/10/2280 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z40550506 Keywords : protonation * nitrobenzene * benzo-18-crown-6 Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.568, year: 2011

  20. Cambodia Rice Sector Review

    OpenAIRE

    World Bank

    2015-01-01

    Cambodias rice exports are on a steep upward trajectory, benefiting from import duty preferences and new investments in rice mills and polishing factories. Cambodia’s major export competitors are Thailand and Vietnam. Thailand is a main competitor for fragrant rice, exporting itself ca 2.65 million tons of aromatic rice (including brokens) in 2010/2011. Vietnam is the principal competitor ...

  1. Lexicografía hispanofrancesa de los siglos XVI y XVII

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas

    2014-04-01

    Full Text Available Sobre la obra, de Luis Pablo Núñez, El arte de las palabras. Diccionarios e imprenta en el Siglo de Oro(Mérida, Editora Regional de Extremadura, 2010, 2 volúmenes, 569 y 465 p. ISBN: 978-84-9852-265-5.

  2. A new method for the determination of vitamin D-3 and 25-hydroxyvitamin D-3 in meat

    DEFF Research Database (Denmark)

    Jakobsen, Jette; Clausen, I.; Leth, Torben;

    2004-01-01

    The total vitamin D content in meat, i.e., vitamin D-3 and 25-hydroxyvitamin D-3, was determined by HPLC after alkaline hydrolysation, solid-phase extraction and semi-preparative HPLC. For detection, a DAD detector between 220 and 320 nm was used and quantification was performed at 265 nm. Vitamin...

  3. 77 FR 137 - Applications and Amendments to Facility Operating Licenses Involving Proposed No Significant...

    Science.gov (United States)

    2012-01-03

    ... participating under 10 CFR 2.315(c), must be filed in accordance with the NRC E-Filing rule (72 FR 49139, August...\\ Requestors should note that the filing requirements of the NRC's E-Filing Rule (72 FR 49139; August 28, 2007.... NRC Branch Chief: Jacob. I. Zimmerman. Exelon Generation Company, LLC (EGC), Docket No. 50-265,...

  4. 40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1...

    Science.gov (United States)

    2010-07-01

    ... been issued a final permit under 40 CFR part 270 and complies with the requirements of 40 CFR part 264, subpart O, or has certified compliance with the interim status requirements of 40 CFR part 265, subpart O... waste for which the owner or operator: (i) Has been issued a final permit under 40 CFR part 270...

  5. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265. ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  6. Mexican American Adolescent Couples Communicating about Conflict: An Integrated Developmental and Cultural Perspective

    Science.gov (United States)

    Rueda, Heidi Adams; Williams, Lela Rankin

    2016-01-01

    Using observational methods on a small sample of committed Mexican American couples (N = 10, ages 15-17, M length of relationship = 26.5 months), we describe and categorize developmental and cultural communication patterns concerning the negotiation of conflict issues. Videotaped dyadic interactions were transcribed and qualitatively coded using…

  7. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  8. Gorstian palaeoposition and geotectonic setting of Suchomasty Volcanic Centre (Silurian, Prague Basin, Teplá-Barrandian Unit, Bohemian Massif)

    Czech Academy of Sciences Publication Activity Database

    Tasáryová, Z.; Schnabl, Petr; Čížková, Kristýna; Pruner, Petr; Janoušek, V.; Rapprich, V.; Štorch, Petr; Manda, Š.; Frýda, J.; Trubač, J.

    2014-01-01

    Roč. 136, č. 1 (2014), s. 262-265. ISSN 1103-5897 R&D Projects: GA ČR GAP210/10/2351 Institutional support: RVO:67985831 Keywords : basalt geochemistry * Gorstian * palaeolatitude * Prague Basin * Silurian * Suchomasty Volcanic Centre Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.309, year: 2014

  9. Video and photographic spectroscopy of 1998 and 2001 Leonid persistent trains from 300 to 930 nm

    Czech Academy of Sciences Publication Activity Database

    Abe, S.; Ebizuka, N.; Murayama, H.; Ohtsuka, K.; Sugimoto, S.; Yamamoto, M.; Yano, H.; Watanabe, J.; Borovička, Jiří

    2005-01-01

    Roč. 95, 1-4 (2005), s. 265-277. ISSN 0167-9295. [Meteoroids 2004. London, Ontario, 16.08.2004-20.08.2004] Institutional research plan: CEZ:AV0Z1003909 Keywords : airglow * Leonid meteor * shower Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.975, year: 2005

  10. Using miniature tactile sensor in geomechanics

    Czech Academy of Sciences Publication Activity Database

    Holý, S.; Volf, J.; Trčková, Jiřina; Anger, Ladislav

    Volume 9B. Helsinki: Finnish Society of Automation, 1997 - (Halttunen, J.; Tuokko, R.), s. 262-265 ISBN 952-5183-03-3. [IMEKO World Congress /14./. Tampere (FI), 01.06.1997-06.06.1997] R&D Projects: GA ČR GA205/94/1788

  11. High spin rotational bands in 65Zn

    Indian Academy of Sciences (India)

    B Mukherjee; S Muralithar; R P Singh; R Kumar; K Rani; R K Bhowmik

    2001-07-01

    The nucleus $^{65}_{30}$Zn was studied using the 52Cr(16O, 2)65Zn reaction at a beam energy of 65 MeV. The level scheme is extended up to an excitation energy of 10.57 MeV for spin-parity (41/2ħ) with several newly observed transitions placed in it.

  12. "You Cannot Talk with All of the Strangers in a Pub": A Longitudinal Case Study of International Postgraduate Students' Social Ties at a British University

    Science.gov (United States)

    Schartner, Alina

    2015-01-01

    The formation of social ties is a major factor in the international student experience (Ramsay et al. in High Educ 54(2):247-265, 2007), influencing student wellbeing and adjustment to the new academic and sociocultural environment (Ward et al. in The psychology of culture shock. Routledge, Hove, 2001). Although a significant body of research in…

  13. Application of capillary electrochromatography using macroporous polyacrylamide columns for the analysis of lignans from seeds of Schisandra chinensis

    Czech Academy of Sciences Publication Activity Database

    Kvasničková, L.; Glatz, O.; Štěrbová, H.; Kahle, Vladislav; Slanina, J.; Musil, P.

    2001-01-01

    Roč. 916, 1-2 (2001), s. 265-271. ISSN 0021-9673 R&D Projects: GA ČR GA303/00/D062 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrochromatography * Schisandra chinensis * plant materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.793, year: 2001

  14. 42 CFR 423.279 - National average monthly bid amount.

    Science.gov (United States)

    2010-10-01

    ... approved bids submitted under § 423.265 in order to calculate the base beneficiary premium, as provided in... number of Part D eligible individuals enrolled in the plan in the reference month (as defined in § 422.258(c)(1) of this chapter) and the denominator equal to the total number of Part D...

  15. Use of fuzzy clustering technique and matrices to classify amino acids and its impact to Chou's pseudo amino acid composition

    OpenAIRE

    Georgiou, D. N.; Karakasidis, T.E.; Nieto, J J; Torres, A.

    2009-01-01

    Use of fuzzy clustering technique and matrices to classify amino acids and its impact to Chou's pseudo amino acid composition correspondence: Corresponding author. Tel.: +302421074163. (Karakasidis, T.E.) (Karakasidis, T.E.) University of Patras, Department of Mathematics - 265 00 Patras--> - GREECE (Georgiou, D.N.) University of Thessaly, Department of Civil Engineering - 383 34 Volos--> - GREECE (Karakas...

  16. Electrochemical Evidence of Host-Guest Interactions. Change of Redox Mechanism of Fungicides Iprodione and Procymidone in the Nano-cavity of Cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Hromadová, Magdaléna; Pospíšil, Lubomír; Giannarelli, S.; Fuoco, R.; Colombini, M. P.

    2002-01-01

    Roč. 73, - (2002), s. 213-219. ISSN 0026-265X R&D Projects: GA MŠk OC D15.10; GA ČR GP203/02/P082 Institutional research plan: CEZ:AV0Z4040901 Keywords : electrochemical evidence * fungicide * cyclodextrin Subject RIV: CG - Electrochemistry Impact factor: 1.325, year: 2002

  17. Adsorption of 1,2,4-Triazine Pesticides Metamitron and Metribuzin on Lignin

    Czech Academy of Sciences Publication Activity Database

    Ludvík, Jiří; Zuman, P.

    2000-01-01

    Roč. 64, č. 1 (2000), s. 15-20. ISSN 0026-265X Grant ostatní: US Science and Technology Program(US) 94033 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 0.884, year: 2000

  18. 40 CFR 63.4551 - How do I demonstrate initial compliance with the emission limitations?

    Science.gov (United States)

    2010-07-01

    ... facility that is regulated as a TSDF under 40 CFR part 262, 264, 265, or 266. The TSDF may be either off... of Plastic Parts and Products Compliance Requirements for the Emission Rate Without Add-on Controls... initial compliance demonstration for each general use, TPO, automotive lamp, and assembled on-road...

  19. 40 CFR 262.70 - Farmers.

    Science.gov (United States)

    2010-07-01

    ... or other standards in 40 CFR parts 264, 265, 268, or 270 for those wastes provided he triple rinses... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Farmers. 262.70 Section 262.70... APPLICABLE TO GENERATORS OF HAZARDOUS WASTE Farmers § 262.70 Farmers. A farmer disposing of waste...

  20. Identification of the new isotope 107265Bh by α correlated decay chains

    International Nuclear Information System (INIS)

    The experimental set-up, methods and results on the synthesis and identification of the new isotope 107265Bh are presented. The new isotope was produced by the complete fusion-evaporation reaction of 243Am with 135 MeV 26Mg bombardment at the Sector Focus Cyclotron of Heavy Ion Research Facility Lanzhou. The reaction products were transported and collected using helium-jet technique and a set of rotating wheel system. the identification of the new isotope was made by observing of correlated α-particle decays chain between the new isotope 265Bh and its 261Db and 257Lr daughters. A total of 8 correlated decay events of 265Bh and 4 decay events of 264Bh were observed. The new nuclide 265Bh has a half-life of 0.94-0.31+0.70s and decays by alpha-particle emission with decay energy of Eα=(9.24 ± 0.05) MeV. The half-life and α decay energy of 265Bh from this experiment are consistent with theoretical predictions. (authors)

  1. Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

    2013-01-01

    Roč. 117, 1-3 (2013), s. 257-265. ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light-harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

  2. Structural versus behavioral remedies in the deregulation of electricity markets: an experimental investigation motivated by policy concerns

    Czech Academy of Sciences Publication Activity Database

    van Koten, Silvester; Ortmann, A.

    2013-01-01

    Roč. 64, November (2013), s. 256-265. ISSN 0014-2921 R&D Projects: GA MŠk LC542; GA ČR(CZ) GAP402/11/0364 Institutional support: RVO:67985998 Keywords : European electricity markets * economic s experiments * forward markets Subject RIV: AH - Economic s Impact factor: 1.364, year: 2013

  3. Mõõtmise probleem 18. sajandi psühholoogias / Konstantin Ramul ; tõlk. Kenn Konstabel

    Index Scriptorium Estoniae

    Ramul, Konstantin, 1879-1975

    2004-01-01

    Mentaalsete mõõtmiste tähtsusest 18. sajandil teadusliku psühholoogia arengule 19. sajandil. 18. sajandi erinevate autorite arvamustest psühholoogiliste mõõtmiste võimalustest ja meetoditest. Varem ilmunud: American Psychologist, 1960, nr. 15, lk. 256-265

  4. Morphogenesis and bone integration of the mouse mandibular third molar

    Czech Academy of Sciences Publication Activity Database

    Chlastáková, Ivana; Lungová, V.; Wells, K.; Tucker, A. S.; Radlanski, R.J.; Míšek, Ivan; Matalová, Eva

    2011-01-01

    Roč. 119, č. 4 (2011), s. 265-274. ISSN 0909-8836 R&D Projects: GA AV ČR IAA600450904; GA ČR GC524/08/J032 Institutional research plan: CEZ:AV0Z50450515 Keywords : 3D models * apoptosis * osteoclast activity Subject RIV: ED - Physiology Impact factor: 1.878, year: 2011

  5. 40 CFR 1068.120 - What requirements must I follow to rebuild engines?

    Science.gov (United States)

    2010-07-01

    ... Tier 1 standards without certification, as provided under 40 CFR 1068.265, to replace a certified Tier... such as that described in 40 CFR 1039.625. (4) You may never replace a certified engine with an engine... rebuilding an engine's turbocharger or aftercooler or the engine's systems for fuel metering or...

  6. 41 CFR 101-26.501-9 - Centralized motor vehicle leasing program.

    Science.gov (United States)

    2010-07-01

    ... leasing program. 101-26.501-9 Section 101-26.501-9 Public Contracts and Property Management Federal...-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.501-9 Centralized motor vehicle leasing program. GSA has a centralized leasing program to provide an additional source of motor vehicle support...

  7. In vitro activity of pipecolic acid amide of clindamycin (U-57930E) on anaerobic bacteria compared with those of clindamycin, cefoxitin, and chloramphenicol.

    OpenAIRE

    Dhawan, V K; Bansal, M B; Thadepalli, H

    1982-01-01

    In vitro activity of pipecolic acid amide of clindamycin (U-57930E) against 265 isolates of anaerobic bacteria, including 66 strains of Bacteroides fragilis, was compared with those of clindamycin, chloramphenicol, and cefoxitin. At therapeutically achievable concentrations, the activities of all four antibiotics against anaerobic bacteria were similar.

  8. 41 CFR 101-26.502 - U.S. Government National Credit Card.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true U.S. Government National Credit Card. 101-26.502 Section 101-26.502 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA...

  9. Spatial and temporal diversity of smlaa shallow waters in river Lužnice floodplain

    Czech Academy of Sciences Publication Activity Database

    Pithart, David; Pichlová, R.; Bílý, M.; Hrbáček, J.; Novotná, K.; Pechar, Libor

    2007-01-01

    Roč. 584, - (2007), s. 265-275. ISSN 0018-8158 R&D Projects: GA MŽP(CZ) SL/1/6/04 Institutional research plan: CEZ:AV0Z60870520 Keywords : floodplain * terrestrial-aquatic interactions * phytoplankton * zooplankton * shading * flooding Subject RIV: EH - Ecology, Behaviour Impact factor: 1.201, year: 2007

  10. Factors affecting growth and viability of natural diatom populations in the meso-eutrophic Římov Reservoir (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Znachor, Petr; Rychtecký, Pavel; Nedoma, Jiří; Visocká, Veronika

    2015-01-01

    Roč. 762, č. 1 (2015), s. 253-265. ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : diatom * growth rate * viability * PDMPO * SYTOX green * reservoir Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  11. Growth in labour productivity of forestry and regional development : a study based on Finnish experience / Seppo Vehkamäki

    Index Scriptorium Estoniae

    Vehkamäki, Seppo

    2003-01-01

    Regionaaltasandil mõjutab metsandussektori töö tootlikkus nii puidutoodete konkurentsivõimet, metsanduse konkurentsivõimelisust tööjõu ja teiste tootmissisendite osas, majanduslikku mitmekesistumist ja arengut kui ka demograafilist ja sotsiaalset arengut. Tabelid. Lisad lk. 265-266

  12. Comparison of four NDT methods for indication of reactor steel degradation by high fluences of neutron irradiation

    Czech Academy of Sciences Publication Activity Database

    Tomáš, Ivan; Vértesy, G.; Pirfo Barroso, S.; Kobayashi, S.

    2013-01-01

    Roč. 265, DEC (2013), s. 201-209. ISSN 0029-5493 Institutional support: RVO:68378271 Keywords : neutron irradiation * steel degradation * nuclear reactor pressure vessel * magnetic NDT * magnetic minor hysteresis loops * Magnetic Barkhausen Emission Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.972, year: 2013 http://www.sciencedirect.com/science/article/pii/S0029549313004664

  13. AcEST: BP913717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_E03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000033_E03. BP913717 CL3928C ... = 36/67 (53%) Frame = +2 Query: 86 LLMSSIAALHSPCW*GWAS GTMWVVVISLSSPRMFVSYIFVSACIS*SI*QRQDLFIWNV 265 +L +S ... A++S W GWAS ... + + ++ +L + +SY F A I S+ F + Sbjct: 105 ILATSSLAVY ...

  14. Degrees of Dissociation and Hydration Numbers of M.sub.2./sub.SO.sub.4./sub.(M=H, Li, Na, K, Rb, Cs and NH.sub.4./sub.) in Aqueous Solutions at 25řC

    Czech Academy of Sciences Publication Activity Database

    Heyrovská, Rajalakshmi

    Vol. 99-2. New Jersey : ISE, 1999. s. 2041. ISBN 1-56677-265-6. [Meeting of the Electrochemical Society /196./. 00.10.1999, Honolulu] R&D Projects: GA AV ČR IAA440401 Subject RIV: CG - Electrochemistry

  15. Aqueous Redox Potentials Related to Ionization Potentials and Electron Affinities of Elements by Simple Linear Equations

    Czech Academy of Sciences Publication Activity Database

    Heyrovská, Rajalakshmi

    New Jersey : The Electrochemical Society, 2000. s. 957. ISBN 1-56677-265-6. [Meeting of the Electrochemical Society /198./. 00.10.2000, Phoenix] R&D Projects: GA AV ČR IAA440401 Institutional research plan: CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry

  16. Simplicial Finite Elements in Higher Dimensions

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Korotov, S.; Křížek, Michal

    2007-01-01

    Roč. 52, č. 3 (2007), s. 251-265. ISSN 0862-7940 R&D Projects: GA ČR GA201/04/1503 Institutional research plan: CEZ:AV0Z10190503 Keywords : n- simplex * finite element method * superconvergence Subject RIV: BA - General Mathematics

  17. Helminth parasites of the tropical gar, Atractosteus tropicus Gill, from Tabasco, Mexico

    Czech Academy of Sciences Publication Activity Database

    Salgado-Maldonado, G.; Moravec, František; Cabanas-Carranza, G.; Aguilar-Aguilar, R.; Sánchez-Nava, P.; Báez-Valé, R.; Scholz, Tomáš

    2004-01-01

    Roč. 90, č. 2 (2004), s. 260-265. ISSN 0022-3395 Grant ostatní: Consejo Nacional de Ciencia y Tecnología(MX) 27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Helminths * fish parasites * communities Subject RIV: EG - Zoology Impact factor: 1.439, year: 2004

  18. Comparative ecophysiology of cold-tolerance-related traits: Assessing range expansion potential for an invasive insect at high latitude

    Czech Academy of Sciences Publication Activity Database

    Lehmann, P.; Kaunisto, S.; Košťál, Vladimír; Margus, A.; Zahradníčková, Helena; Lindström, L.

    2015-01-01

    Roč. 88, č. 3 (2015), s. 254-265. ISSN 1522-2152 R&D Projects: GA MŠk LH12103 Grant ostatní: Academy of Finland(FI) 118456; Academy of Finland(FI) 128888 Institutional support: RVO:60077344 Keywords : Leptinotarsa decemlineata Subject RIV: ED - Physiology Impact factor: 2.398, year: 2014

  19. Experience in the separation and purification of transplutonium elements in the transuranium processing plant at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Since 1966, TRU has been the main center of production for transcurium elements in the US, producing 460 mg 249Bk, 4 g 252Cf, 18 mg 253Es, and 10 pg 257Fm. During the 14 years operation, 39 chemical processing campaigns were conducted to process 265 HFIR targets and 195 SRP production reactor targets

  20. The combined technological methods for deposition of Si:H thin films and structures with in situ embedded nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlík, Jiří; Stuchlíková, The-Ha; Remeš, Zdeněk; Purkrt, Adam; Fajgar, Radek; Koštejn, Martin; Kupčík, Jaroslav; Zhuravlev, K.; Sveshnikova, L.; Galkin, K.N.; Galkin, N.G.

    2015-01-01

    Roč. 7, č. 4 (2015), s. 265-269. ISSN 2164-6627 R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 ; RVO:67985858 Keywords : PECVD * RDE * LA * RLA * VE * PT Subject RIV: BM - Solid Matter Physics ; Magnetism

  1. A two-sex demographic model with single-dependent divorce rate

    Czech Academy of Sciences Publication Activity Database

    Maxim, D.; Berec, Luděk

    2010-01-01

    Roč. 265, č. 4 (2010), s. 647-656. ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : population dynamics * bifurcation * demography Subject RIV: EH - Ecology, Behaviour Impact factor: 2.371, year: 2010

  2. Employment Opportunities, Training Needs and Vocational Education for the Graphic Arts in Missouri.

    Science.gov (United States)

    Rayford, Erwin William

    The purpose of this study was to ascertain the current and projected employment and training needs for printers in Missouri, the predicted effects of automation on employment and training, and the nature and scope of the vocational printing programs in Missouri. Data were collected from the managers of 265 printing industries, 126 vocational…

  3. Traumatic brain injury in Denmark 1979-1996. A national study of incidence and mortality

    DEFF Research Database (Denmark)

    Engberg, Aase Worså; Teasdale, T W

    2001-01-01

    hospitalised under diagnoses ICD 800, 801, 803, 850-854 decreased 41% from 265 to 157 per 100,000 of the population per year. Decreases were 42% for ICD 850, brain concussion, 56% for ICD 800, 801, 803, cranial fractures, and 16% for ICD 851 854, structural brain injury. The percentage of cases with ICD 851...

  4. Usefulness of vernakalant hydrochloride injection for rapid conversion of atrial fibrillation

    DEFF Research Database (Denmark)

    Pratt, Craig M.; Roy, Dennis; Torp-Pedersen, Christian; Wyse, D. George; Toft, Egon; Juul-Moller, Steen; Retyk, Enrique; Drenning, David Humphrey

    2010-01-01

    infusion of placebo or vernakalant (2 mg/kg) 15 minutes later if the arrhythmia had not terminated. A total of 265 patients were randomized and received treatment. The primary end point was conversion of AF to SR for ≥1 minute within 90 minutes of the start of the drug infusion in the short-duration AF...

  5. TASTE PREFERENCES: BIOBEHAVIORAL AND NUTRIENT CORRELATES

    Science.gov (United States)

    Little is known about determinants of taste preferences. We examined correlates of taste ratings for 112 foods (32 fruits/vegetables, F/V; 65 mixed dishes/snacks, M/S; and 15 desserts, D) in 18 healthy, nonsmoking, educated, middle-income adults aged 18-49 y (BMI 26.5 +/- 4.3 kg/m2). Hedonic ratin...

  6. GenBank blastx search result: AK288311 [KOME

    Lifescience Database Archive (English)

    Full Text Available (UL26), virion scaffolding protein (UL26.5), virion membrane glycoprotein B (gB), DNA cleavage/packaging pro... subunit (pol), nuclear phosphoprotein (UL31), DNA cleavage/packaging (UL32), DNA cleavage/packaging protein

  7. „Doufám, že moje nepřítomnost nebude pozorována.“ Stanislav Špaček a prezentace Československa na jubilejní výstavě ve Filadelfii v roce 1926

    Czech Academy of Sciences Publication Activity Database

    Hálek, Jan

    Praha : Filozofická fakulta Univerzity Karlovy, 2015 - (Tumis, S.; Koura, J.; Soukup, J.), s. 254-265 ISBN 978-80-7308-574-2. - (Fontes. 16) Institutional support: RVO:67985921 Keywords : Czechoslovakia, 1920s * Špaček, Stanislav * history Subject RIV: AB - History

  8. EST data: 2943 [RED

    Lifescience Database Archive (English)

    Full Text Available EB2709 C73014 DPlate 031 G08 5' GTT CCT ACC AAA AGC CAA AG 3' 5' GCG CCC ACG TTG CCC GAC TC 3' > ... (P29602) CUCUMBER PEELING ... CUPREDOXIN (CPC) (STELLACYANIN). &SSKV(S27034;S265 ...

  9. A Brazilian glycoprotein E-negative bovine herpesvirus type 1.2a (BHV-1.2a mutant is attenuated for cattle and induces protection against wild-type virus challenge

    Directory of Open Access Journals (Sweden)

    Franco Ana Cláudia

    2002-01-01

    Full Text Available The authors previously reported the construction of a glycoprotein E-deleted (gE- mutant of bovine herpesvirus type 1.2a (BHV-1.2a. This mutant, 265gE-, was designed as a vaccinal strain for differential vaccines, allowing the distinction between vaccinated and naturally infected cattle. In order to determine the safety and efficacy of this candidate vaccine virus, a group of calves was inoculated with 265gE-. The virus was detected in secretions of inoculated calves to lower titres and for a shorter period than the parental virus inoculated in control calves. Twenty one days after inoculation, the calves were challenged with the wild type parental virus. Only mild signs of infection were detected on vaccinated calves, whereas non-vaccinated controls displayed intense rhinotracheitis and shed virus for longer and to higher titres than vaccinated calves. Six months after vaccination, both vaccinated and control groups were subjected to reactivation of potentially latent virus. The mutant 265gE- could not be reactivated from vaccinated calves. The clinical signs observed, following the reactivation of the parental virus, were again much milder on vaccinated than on non-vaccinated calves. Moreover, parental virus shedding was considerably reduced on vaccinated calves at reactivation. In view of its attenuation, immunogenicity and protective effect upon challenge and reactivation with a virulent BHV-1, the mutant 265gE- was shown to be suitable for use as a BHV-1 differential vaccine virus.

  10. TiO2 Nanotubes Supported NiW Hydrodesulphurization Catalysts: Characterization and Activity

    Czech Academy of Sciences Publication Activity Database

    Palcheva, R.; Dimitrov, L.; Tyuliev, G.; Spojakina, A.; Jirátová, Květa

    2013-01-01

    Roč. 265, JAN 15 (2013), s. 309-313. ISSN 0169-4332 Institutional support: RVO:67985858 Keywords : nano-structured TiO2 * NiW catalysts * XPS Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.538, year: 2013

  11. 75 FR 41121 - Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes...

    Science.gov (United States)

    2010-07-15

    ... AGENCY 40 CFR Parts 257, 261, 264, 265, 268, 271 and 302 RIN 2050-AE81 Hazardous and Solid Waste Management System; Identification and Listing of Special Wastes; Disposal of Coal Combustion Residuals From...), 3001, 3004, 3005, and 4004 of the Solid Waste Disposal Act of 1970, as amended by the...

  12. Interim-status groundwater monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1995-02-09

    This document outlines the groundwater monitoring plan, under RCRA regulations in 40 CFR 265 Subpart F and WAC173-300-400, for the 216-B-63 Trench. This interim status facility is being sampled under detection monitoring criteria and this plan provides current program conditions and requirements.

  13. Short telomere length is associated with NOTCH1/SF3B1/TP53 aberrations and poor outcome in newly diagnosed chronic lymphocytic leukemia patients

    DEFF Research Database (Denmark)

    Mansouri, Larry; Grabowski, Pawel; Degerman, Sofie; Svenson, Ulrika; Gunnarsson, Rebeqa; Cahill, Nicola; Smedby, Karin Ekström; Geisler, Christian; Juliusson, Gunnar; Roos, Göran; Rosenquist, Richard

    2013-01-01

    Most previous studies on telomere length (TL) in chronic lymphocytic leukemia (CLL) are based on referral cohorts including a high proportion of aggressive cases. Here, the impact of TL was analyzed in a population-based cohort of newly diagnosed CLL (n = 265) and in relation to other prognostic ...

  14. 40 CFR 61.345 - Standards: Containers.

    Science.gov (United States)

    2010-07-01

    ... Container Level 3 control requirements in 40 CFR 264.1086(e)(2)(i) or 40 CFR 265.1086(e)(2)(i) is not... Permanent or Temporary Total Enclosure” in 40 CFR 52.741, appendix B. The enclosure may have permanent or... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Containers. 61.345...

  15. 40 CFR 63.10685 - What are the requirements for the control of contaminants from scrap?

    Science.gov (United States)

    2010-07-01

    ... of the Resource Conservation and Recovery Act (RCRA) (40 CFR parts 261 through 265 and 268). The plan... facilities with permits as required under the rules implementing subtitle C of RCRA (40 CFR parts 261 through... control of contaminants from scrap? 63.10685 Section 63.10685 Protection of Environment...

  16. Cyklus a bilance uhlíku v mokřadech

    Czech Academy of Sciences Publication Activity Database

    Čížková, Hana; Pokorný, Jan; Květ, Jan; Bauer, Václav

    2004-01-01

    Roč. 21, č. 3 (2004), s. 265-268. ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03 Institutional research plan: CEZ:AV0Z6087904 Keywords : carbon * wetland * sustainable management Subject RIV: EH - Ecology, Behaviour

  17. Age at Menarche Is Associated with Divergent Alcohol Use Patterns in Early Adolescence and Early Adulthood

    Science.gov (United States)

    Richards, Meghan A.; Oinonen, Kirsten A.

    2011-01-01

    A cross-sectional retrospective design was employed to examine the relationship between age at menarche (AAM) and alcohol use patterns from middle childhood (age 7) to early adulthood in 265 University-aged women. Earlier menarche was associated with: (a) earlier ages at first drink and first intoxication, (b) greater use between ages 9 and 14…

  18. Classification of Spectra of Emission Line Stars Using Machine Learning Techniques

    Czech Academy of Sciences Publication Activity Database

    Bromová, P.; Škoda, Petr; Vážný, Jaroslav

    2014-01-01

    Roč. 11, č. 3 (2014), s. 265-273. ISSN 1476-8186 R&D Projects: GA ČR GA13-08195S Institutional support: RVO:67985815 Keywords : Be star * stellar spectrum * feature extraction Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. AcEST: DK951534 [AcEST

    Lifescience Database Archive (English)

    Full Text Available + LH Sbjct: 374 SDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTL--EMAQKQSMDESLHLGW 431 Query: 280 DLEASSKEIDAANAQISTLFE...KAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKKTISDL 1034 Query: 286 EASSKEI--------DAANAQISTLFE...ESLIKAVEES-KNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKK 1029 Query: 556 LEASLEQLKKE-LAKSENSARAME...ILKNEISKSNATIDG 270 E+A L +++ +LE E+LNTAT ++ + + K+L+N +D Sbjct: 84 EVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERM...LKN++ K A Sbjct: 207 KELLEENTRVHKENLELKENLDNIKFSDNNEKIRLNERIRSLESMITDLKNKMDKETAVA 266 Query: 265 DGLHRDLEASSKEIDAANAQISTLFE

  20. Diagnosis Of Aphasia Using Neural And Fuzzy Techniques

    DEFF Research Database (Denmark)

    Jantzen, Jan; Axer, Hubertus; Keyserlingk, Diedrich Graf von

    2002-01-01

    The language disability aphasia has several sub-diagnoses such as Amnestic, Broca, Global, and Wernicke. Data concerning 265 patients is available in the form of test scores and diagnoses, made by physicians according to the Aachen Aphasia Test. A neural network model has been built, which...

  1. Geophysical investigations over a segment of the Central Indian Ridge, Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    KameshRaju, K.A.; Ramprasad, T.; Subrahmanyam, C.

    , Searle RC, and Briais AR (1993) Segmenta- tion of the Central Indian Ridge between 12¡12@S and the Indian Ocean Triple Junction. Marine Geophysical Research 15:265—282 Phipps Morgan J and Forsyth DW (1988) 3-D ow and temperature perturbations due to a...

  2. Exploring Cultural Differences in Classroom Expectations of Students from the United States and Taiwan.

    Science.gov (United States)

    Niehoff, Brian P.; Turnley, William H.; Yen, Hsiu Ju Rebecca; Sheu, Chwen

    2001-01-01

    A survey of 265 U.S. and 247 Taiwanese college students' expectations of teachers and students showed significant differences related to cultural values such as collectivism/individualism, power distance, and egalitarianism. Ways to improve learning in multicultural classrooms were suggested by the findings. (Contains 18 references.) (SK)

  3. 40 CFR 63.490 - Batch front-end process vents-performance test methods and procedures to determine compliance.

    Science.gov (United States)

    2010-07-01

    ... interim status requirements of 40 CFR part 265, subpart O. (c) Batch front-end process vent testing and... applicable procedures of Method 301, 40 CFR part 63, appendix A. (e) Aggregate batch vent stream testing for... under 40 CFR part 270 and complies with the requirements of 40 CFR part 266, subpart H; or (ii)...

  4. 40 CFR 63.1325 - Batch process vents-performance test methods and procedures to determine compliance.

    Science.gov (United States)

    2010-07-01

    ... status requirements of 40 CFR part 265, subpart O. (c) Batch process vent testing and procedures for... Method 25A, 40 CFR part 60, appendix A. (iii) If grab samples are taken to determine average batch vent... burning hazardous waste for which the owner or operator: (i) Has been issued a final permit under 40...

  5. 77 FR 64946 - Radio Broadcasting Services; Maysville, Georgia

    Science.gov (United States)

    2012-10-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Maysville, Georgia AGENCY: Federal Communications... filed by Appalachian Broadcasting Company, Inc., proposing the allotment of Channel 265A at Maysville... Broadcasting Company, Post Office Drawer E, 233 Big A Road, Toccoa, Georgia 30577. FOR FURTHER...

  6. Hypolipidemic effect of beer proteins in experiment on rats

    Czech Academy of Sciences Publication Activity Database

    Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.

    2002-01-01

    Roč. 35, č. 3 (2002), s. 265-271. ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

  7. Infection of adult Aedes aegypti and Ae. albopictus mosquitoes with the entomopathogenic fungus Metarhizium anisopliae

    NARCIS (Netherlands)

    Scholte, E.J.; Takken, W.; Knols, B.G.J.

    2007-01-01

    This study describes a laboratory investigation on the use of the insect-pathogenic fungus Metarhizium anisopliae against adult Aedes aegypti and Ae. albopictus mosquitoes. At a dosage of 1.6 × 1010 conidia/m2, applied on material that served as a mosquito resting site, an average of 87.1 ± 2.65% of

  8. Gluconeogenesis continues in premature infants receiving total parenteral nutrition

    Science.gov (United States)

    To determine the contribution of total gluconeogenesis, to glucose production in preterm infants receiving total parenteral nutrition (TPN) providing glucose exceeding normal infant glucose turnover rate, eight infants (0.955 +/- 0.066 kg, 26.5 - 0.5 wks, 4-1 d) were studied while receiving routine ...

  9. Function spaces with the Matkowski property and degeneracy phenomena for composition operators

    Czech Academy of Sciences Publication Activity Database

    Appell, J.; Guanda, N.; Väth, Martin

    2011-01-01

    Roč. 12, č. 2 (2011), s. 265-284. ISSN 1583-5022 R&D Projects: GA AV ČR IAA100190805 Institutional research plan: CEZ:AV0Z10190503 Keywords : function spaces * nonlinear composition operator * global Lipschitz condition Subject RIV: BA - General Mathematics Impact factor: 0.970, year: 2011

  10. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

    2015-01-01

    Roč. 747, JUL (2015), s. 265-271. ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 6.131, year: 2014

  11. Gclust Server: 82707 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 82707 TET_14.m00478 Cluster Sequences Related Sequences(265) 1101 cyclic nucleotide...-binding domain containing protein chr_0_8254798_14; no annotation 1 1.00e-22 0.0 11.11 0.0 0.0 0.0 0.0 Show 82707 Cluster ID 82707

  12. 41 CFR 109-26.501-52 - Justification for purchase.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Justification for... PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 109-26.501-52 Justification for... justification of need. Such justifications shall be prepared by the motor vehicle fleet manager and approved...

  13. SPREADING LAGOONED SEWAGE SLUDGE ON FARMLAND: A CASE HISTORY

    Science.gov (United States)

    This project demonstrated that land application is feasible and practical for a metropolitan treatment plant for disposal of a large volume (265,000 cu m) of stabilized, liquid sewage sludge stored in lagoons. The project involved transportation of sludge by semi-trailer tankers ...

  14. Item Selection for the Development of Short Forms of Scales Using an Ant Colony Optimization Algorithm

    Science.gov (United States)

    Leite, Walter L.; Huang, I-Chan; Marcoulides, George A.

    2008-01-01

    This article presents the use of an ant colony optimization (ACO) algorithm for the development of short forms of scales. An example 22-item short form is developed for the Diabetes-39 scale, a quality-of-life scale for diabetes patients, using a sample of 265 diabetes patients. A simulation study comparing the performance of the ACO algorithm and…

  15. 40 CFR 260.21 - Petitions for equivalent testing or analytical methods.

    Science.gov (United States)

    2010-07-01

    ... analytical methods. 260.21 Section 260.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Petitions for equivalent testing or analytical methods. (a) Any person seeking to add a testing or analytical method to part 261, 264, or 265 of this chapter may petition for a regulatory amendment under...

  16. Quality Assessment of Compressed Video for Automatic License Plate Recognition

    DEFF Research Database (Denmark)

    Ukhanova, Ann; Støttrup-Andersen, Jesper; Forchhammer, Søren; Madsen, John

    2014-01-01

    Definition of video quality requirements for video surveillance poses new questions in the area of quality assessment. This paper presents a quality assessment experiment for an automatic license plate recognition scenario. We explore the influence of the compression by H.264/AVC and H.265/HEVC...

  17. Helix-forming self-assembly of enentiopure 2,2'-dimethylbiphenyl-6,6'-dipropiolic acid and amide organized by hydrogen bonds

    Czech Academy of Sciences Publication Activity Database

    Tichý, Miloš; Holý, Petr; Závada, Jiří; Císařová, I.; Podlaha, J.

    2001-01-01

    Roč. 12, č. 16 (2001), s. 2295-2300. ISSN 0957-4166 R&D Projects: GA ČR GA203/00/0138 Institutional research plan: CEZ:AV0Z4055905 Keywords : self-assembly * hydrogen bonding Subject RIV: CC - Organic Chemistry Impact factor: 2.265, year: 2001

  18. Domain Modeling: NP_066574.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066574.2 chr2 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr2/NP_066574.2.../NP_066574.2_holo_254-335.pdb blast 255K,259C,261E,262C,263G,264K,265A,266F,267F,268D

  19. Description of larva, redescription of adults and biology of Mortogenesia mesopotamica (Morton, 1921) (Ephemeroptera: Palingeniidae)

    Czech Academy of Sciences Publication Activity Database

    Soldán, Tomáš; Godunko, Roman J.

    2013-01-01

    Roč. 3741, č. 2 (2013), s. 265-278. ISSN 1175-5326 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : morphology * differential diagnosis * metamorphic stages Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  20. IMIDACLOPRID PRODUCES MINIMAL CHANGES IN THE EEG OF LONG-EVANS RATS

    Science.gov (United States)

    We have reported that the non-stimulus driven EEG is differentially altered by deltamethrin or permethrin (Lyke and Herr, Toxicologist, 114(S-1) :265, 2010) as well as fipronil (Lyke and Herr, Toxicologist, 120(S-2) :290, 2011). In the current study, we examined the ability to de...