WorldWideScience

Sample records for bohrium 265

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/05/0095-0100 ...

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 40 CFR 265.341 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.341 Section 265... FACILITIES Incinerators § 265.341 Waste analysis. In addition to the waste analyses required by § 265.13, the... minimum, the analysis must determine: (a) Heating value of the waste; (b) Halogen content and sulfur...

  4. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265.273 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by § 265.13...

  5. 40 CFR 265.252 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.252 Section 265... FACILITIES Waste Piles § 265.252 Waste analysis. In addition to the waste analyses required by § 265.13, the... in the pile to which it is to be added. The analysis conducted must be capable of differentiating...

  6. 40 CFR 265.375 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.375 Section 265... FACILITIES Thermal Treatment § 265.375 Waste analysis. In addition to the waste analyses required by § 265.13... of pollutants which might be emitted. At a minimum, the analysis must determine: (a) Heating value of...

  7. 40 CFR 265.14 - Security.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Security. 265.14 Section 265.14... Facility Standards § 265.14 Security. (a) The owner or operator must prevent the unknowing entry, and...) for discussion of security requirements at disposal facilities during the post-closure care period...

  8. 47 CFR 87.265 - Administrative communications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Administrative communications. 87.265 Section 87.265 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO... Stations § 87.265 Administrative communications. Domestic VHF aeronautical enroute stations authorized to...

  9. 15 CFR 265.41 - Gambling.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Gambling. 265.41 Section 265.41..., GAITHERSBURG, MARYLAND, AND BOULDER AND FORT COLLINS, COLORADO Buildings and Grounds § 265.41 Gambling. No... gambling devices, the conduct of lotteries or pools, or in the selling or purchasing of numbers tickets, or...

  10. 40 CFR 265.223 - Containment system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Containment system. 265.223 Section 265.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Surface Impoundments § 265.223 Containment system. All earthen dikes must have a protective cover...

  11. 8 CFR 265.1 - Forms.

    Science.gov (United States)

    2010-01-01

    ... for those exempted by section 263(b) of the Act, all aliens in the United States required to register under section 262 of the Act shall report each change of address and new address within 10 days on Form... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Forms. 265.1 Section 265.1 Aliens and...

  12. 40 CFR 265.1080 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... requirements of § 265.1090(c). (f) This section applies only to the facility commonly referred to as the OSi... Water 8 model or other model agreed to by the Sistersville Plant, EPA and WVDEP) under Project XL with...

  13. 40 CFR 265.1053 - Standards: Compressors.

    Science.gov (United States)

    2010-07-01

    ... compressor shall be equipped with a seal system that includes a barrier fluid system and that prevents... section. (b) Each compressor seal system as required in paragraph (a) of this section shall be: (1... control device that complies with the requirements of § 265.1060, or (3) Equipped with a system that...

  14. 40 CFR 265.1035 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... required by § 265.1033(j). (iii) If engineering calculations are used, a design analysis, specifications... engineering texts acceptable to the Regional Administrator that present basic control device design... regeneration cycle, duration of the carbon bed steaming and cooling/drying cycles, design carbon bed...

  15. 40 CFR 265.406 - Special requirements for incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.406 Section 265.406 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED..., STORAGE, AND DISPOSAL FACILITIES Chemical, Physical, and Biological Treatment § 265.406 Special...

  16. 40 CFR 265.231 - Air emission standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Air emission standards. 265.231 Section 265.231 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Surface Impoundments § 265.231...

  17. 40 CFR 265.202 - Air emission standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Air emission standards. 265.202 Section 265.202 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Tank Systems § 265.202 Air...

  18. 45 CFR 265.5 - May States use sampling?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false May States use sampling? 265.5 Section 265.5... REQUIREMENTS § 265.5 May States use sampling? (a) Each State may report the disaggregated data in the TANF Data... the use of a scientifically acceptable sampling method that we have approved. States may use sampling...

  19. 15 CFR 265.34 - Conformity with posted signs.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Conformity with posted signs. 265.34 Section 265.34 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL..., GAITHERSBURG, MARYLAND, AND BOULDER AND FORT COLLINS, COLORADO Buildings and Grounds § 265.34 Conformity with...

  20. 40 CFR 265.276 - Food chain crops.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Food chain crops. 265.276 Section 265... FACILITIES Land Treatment § 265.276 Food chain crops. (a) An owner or operator of a hazardous waste land treatment facility on which food chain crops are being grown, or have been grown and will be grown in the...

  1. 27 CFR 26.265 - Determination of tax on articles.

    Science.gov (United States)

    2010-04-01

    ... articles. 26.265 Section 26.265 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Procedure at Port of Entry From the Virgin Islands § 26.265 Determination of tax on articles. Where articles...

  2. Video Compression Study: h.265 vs h.264

    Science.gov (United States)

    Pryor, Jonathan

    2016-01-01

    H.265 video compression (also known as High Efficiency Video Encoding (HEVC)) promises to provide double the video quality at half the bandwidth, or the same quality at half the bandwidth of h.264 video compression [1]. This study uses a Tektronix PQA500 to determine the video quality gains by using h.265 encoding. This study also compares two video encoders to see how different implementations of h.264 and h.265 impact video quality at various bandwidths.

  3. 14 CFR 125.265 - Flight engineer requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...

  4. 24 CFR 241.265 - Insurance of property against flood.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of property against flood. 241.265 Section 241.265 Housing and Urban Development Regulations Relating to Housing and Urban... Insurance of property against flood. The mortgaged property shall be insured against flood as stipulated by...

  5. 40 CFR 265.1055 - Standards: Sampling connection systems.

    Science.gov (United States)

    2010-07-01

    ... capture and transport all the purged process fluid to a waste management unit that complies with the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Standards: Sampling connection systems. 265.1055 Section 265.1055 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID...

  6. 40 CFR 265.1084 - Waste determination procedures.

    Science.gov (United States)

    2010-07-01

    ... the material in the hazardous waste stream is placed in a waste management unit exempted under the... waste placed in a waste management unit exempted under the provisions of § 265.1083(c)(1) of this... § 265.1088 of this subpart, as applicable to the waste management unit. (i) An initial determination of...

  7. 40 CFR 265.178 - Air emission standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Air emission standards. 265.178 Section 265.178 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Use and Management of Container...

  8. 12 CFR 265.3 - Board review of delegated actions.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Board review of delegated actions. 265.3 Section 265.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... for determination if the delegee considers it appropriate because of the importance or complexity of...

  9. 40 CFR 265.171 - Condition of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 265.171... DISPOSAL FACILITIES Use and Management of Containers § 265.171 Condition of containers. If a container... transfer the hazardous waste from this container to a container that is in good condition, or manage the...

  10. 40 CFR 265.173 - Management of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Management of containers. 265.173... DISPOSAL FACILITIES Use and Management of Containers § 265.173 Management of containers. (a) A container... waste. (b) A container holding hazardous waste must not be opened, handled, or stored in a manner which...

  11. 40 CFR 265.251 - Protection from wind.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Protection from wind. 265.251 Section... FACILITIES Waste Piles § 265.251 Protection from wind. The owner or operator of a pile containing hazardous waste which could be subject to dispersal by wind must cover or otherwise manage the pile so that wind...

  12. 40 CFR 265.35 - Required aisle space.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Required aisle space. 265.35 Section... FACILITIES Preparedness and Prevention § 265.35 Required aisle space. The owner or operator must maintain aisle space to allow the unobstructed movement of personnel, fire protection equipment, spill control...

  13. 21 CFR 137.265 - Degerminated white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Degerminated white corn meal. 137.265 Section 137.265 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... meal, degermed white corn meal, is the food prepared by grinding cleaned white corn and removing bran...

  14. 39 CFR 265.5 - Public reading rooms.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Public reading rooms. 265.5 Section 265.5 Postal... reading rooms. The Library of the Postal Service Headquarters, 475 L'Enfant Plaza SW, Washington, DC 20260-1641, serves as public reading room for the materials which are listed in paragraphs (a)(2), (3), (4...

  15. 30 CFR 206.265 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.265... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.265 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  16. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    The periodic table of elements, the basic and most important component of research in chemistry and physics is growing continu- ously. It is interesting to note that until the. 16th century, only a handful of elements have been known to mankind (10, to be pre- cise) and during the 18th century, 10 more elements have been ...

  17. 40 CFR 265.150 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ..., STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.150 State assumption of responsibility. (a) If a State either assumes legal responsibility for an owner's or operator's compliance with the... 40 Protection of Environment 25 2010-07-01 2010-07-01 false State assumption of responsibility...

  18. 40 CFR 265.91 - Ground-water monitoring system.

    Science.gov (United States)

    2010-07-01

    ... this paragraph. (b) Separate monitoring systems for each waste management component of a facility are... Section 265.91 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... static head) from the limit of the waste management area. Their number, locations, and depths must be...

  19. 40 CFR 265.280 - Closure and post-closure.

    Science.gov (United States)

    2010-07-01

    ... contaminants caused by wind erosion; and (4) Compliance with § 265.276 concerning the growth of food-chain... and post-closure care objectives of paragraph (a) of this section: (1) Type and amount of hazardous..., including amount, frequency, and pH of precipitation; (5) Geological and soil profiles and surface and...

  20. 40 CFR 265.113 - Closure; time allowed for closure.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL FACILITIES Closure and Post-Closure § 265.113 Closure; time allowed for closure. (a) Within 90... assessment required under RCRA section 3019, and closure and post-closure plans, and updated cost estimates... sludges to the extent practicable without impairing the integrity of the liner(s), if any. (3) Removal of...

  1. 15 CFR 265.37 - Narcotics and other drugs.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Narcotics and other drugs. 265.37... other drugs. The possession, sale, consumption, or use on the site of narcotic or other drugs illegal... with respect to the possession, sale, consumption, or use of narcotic or other drugs. ...

  2. 40 CFR 265.315 - Special requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for containers..., STORAGE, AND DISPOSAL FACILITIES Landfills § 265.315 Special requirements for containers. Unless they are very small, such as an ampule, containers must be either: (a) At least 90 percent full when placed in...

  3. 33 CFR 105.265 - Security measures for handling cargo.

    Science.gov (United States)

    2010-07-01

    ... SECURITY MARITIME SECURITY MARITIME SECURITY: FACILITIES Facility Security Requirements § 105.265 Security... to do so, routinely check cargo, cargo transport units, and cargo storage areas within the facility..., containers, or other cargo transport units entering the facility match the delivery note or equivalent cargo...

  4. 15 CFR 265.43 - Pets and other animals.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Pets and other animals. 265.43 Section... INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE REGULATIONS GOVERNING TRAFFIC AND CONDUCT REGULATIONS GOVERNING TRAFFIC AND CONDUCT ON THE GROUNDS OF THE NATIONAL INSTITUTE OF STANDARDS & TECHNOLOGY...

  5. 25 CFR 26.5 - Who may be eligible for Job Placement and Training?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Who may be eligible for Job Placement and Training? 26.5 Section 26.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES JOB PLACEMENT AND TRAINING PROGRAM General Applicability § 26.5 Who may be eligible for Job Placement and Training? You may...

  6. 40 CFR 265.34 - Access to communications or alarm system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Access to communications or alarm system. 265.34 Section 265.34 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID..., STORAGE, AND DISPOSAL FACILITIES Preparedness and Prevention § 265.34 Access to communications or alarm...

  7. 15 CFR 265.42 - Photography for advertising or commercial purposes; advertising and soliciting.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Photography for advertising or commercial purposes; advertising and soliciting. 265.42 Section 265.42 Commerce and Foreign Trade Regulations... COLLINS, COLORADO Buildings and Grounds § 265.42 Photography for advertising or commercial purposes...

  8. 40 CFR 421.265 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... produced by solvent extraction Copper 0.806 0.384 Cyanide (total) 0.126 0.050 Zinc 0.643 0.265 Combined... solvent extraction raffinate and wash water. PSES for the Secondary Precious Metals Subcategory Pollutant... smelted Copper 5.760 2.745 Cyanide (total) 0.900 0.360 Zinc 4.590 1.890 Combined metals 1.350 Ammonia (as...

  9. Research of Video Steganalysis Algorithm Based on H265 Protocol

    Directory of Open Access Journals (Sweden)

    Wu Kaicheng

    2015-01-01

    This paper researches LSB matching VSA based on H265 protocol with the research background of 26 original Video sequences, it firstly extracts classification features out from training samples as input of SVM, and trains in SVM to obtain high-quality category classification model, and then tests whether there is suspicious information in the video sample. The experimental results show that VSA algorithm based on LSB matching can be more practical to obtain all frame embedded secret information and carrier and video of local frame embedded. In addition, VSA adopts the method of frame by frame with a strong robustness in resisting attack in the corresponding time domain.

  10. Experimental Investigations of Space Shuttle BX-265 Foam

    Science.gov (United States)

    Lerch, Bradley A.; Sullivan, Roy M.

    2009-01-01

    This report presents a variety of experimental studies on the polyurethane foam, BX-265. This foam is used as a close-out foam insulation on the space shuttle external tank. The purpose of this work is to provide a better understanding of the foam s behavior and to support advanced modeling efforts. The following experiments were performed: Thermal expansion was measured for various heating rates. The in situ expansion of foam cells was documented by heating the foam in a scanning electron microscope. Expansion mechanisms are described. Thermogravimetric analysis was performed at various heating rates and for various environments. The glass transition temperature was also measured. The effects of moisture on the foam were studied. Time-dependent effects were measured to give preliminary data on viscoelastoplastic properties.

  11. 40 CFR 265.114 - Disposal or decontamination of equipment, structures and soils.

    Science.gov (United States)

    2010-07-01

    ... equipment, structures and soils. 265.114 Section 265.114 Protection of Environment ENVIRONMENTAL PROTECTION... decontamination of equipment, structures and soils. During the partial and final closure periods, all contaminated equipment, structures and soil must be properly disposed of, or decontaminated unless specified otherwise in...

  12. 40 CFR 265.1054 - Standards: Pressure relief devices in gas/vapor service.

    Science.gov (United States)

    2010-07-01

    ... gas/vapor service. 265.1054 Section 265.1054 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...: Pressure relief devices in gas/vapor service. (a) Except during pressure releases, each pressure relief device in gas/vapor service shall be operated with no detectable emissions, as indicated by an instrument...

  13. 21 CFR 1271.265 - Receipt, predistribution shipment, and distribution of an HCT/P.

    Science.gov (United States)

    2010-04-01

    ... time of its occurrence. (d) Packaging and shipping. Packaging and shipping containers must be designed... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Receipt, predistribution shipment, and distribution of an HCT/P. 1271.265 Section 1271.265 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...

  14. 40 CFR 265.149 - Use of State-required mechanisms.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of State-required mechanisms. 265... DISPOSAL FACILITIES Financial Requirements § 265.149 Use of State-required mechanisms. (a) For a facility... care or liability coverage, an owner or operator may use State-required financial mechanisms to meet...

  15. 40 CFR 265.145 - Financial assurance for post-closure care.

    Science.gov (United States)

    2010-07-01

    ... care. 265.145 Section 265.145 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... made, multiplied by an amount equivalent to 85 percent of the most recent investment rate or of the...; and (B) In connection with that procedure, no matters came to his attention which caused him to...

  16. MYD88 L265P mutation contributes to the diagnosis of Bing Neel syndrome.

    Science.gov (United States)

    Poulain, Stéphanie; Boyle, Eileen M; Roumier, Christophe; Demarquette, Hélène; Wemeau, Mathieu; Geffroy, Sandrine; Herbaux, Charles; Bertrand, Elisabeth; Hivert, Bénédicte; Terriou, Louis; Verrier, Albert; Pollet, Jean Paul; Maurage, Claude Alain; Onraed, Brigitte; Morschhauser, Franck; Quesnel, Bruno; Duthilleul, Patrick; Preudhomme, Claude; Leleu, Xavier

    2014-11-01

    Bing-Neel syndrome (BNS), a rare neurological syndrome associated with Waldenström macroglobulinaemia (WM), is a direct involvement of the central nervous system by lymphoplasmacytoid cells characterized with an adverse prognostic. The MYD88 L265P mutation has been identified in the vast majority of patients with WM. The diagnosis of BNS is often challenging because of the variety of clinical presentations associated with difficult histological techniques. We hypothesized that identification of MYD88 L265P mutation in the cerebrospinal fluid (CSF) would contribute to the diagnosis of BNS in addition to imaging, flow cytometry and cytology. We identified MYD88 L265P mutation in the CSF and the bone marrow of all cases of BNS using quantitative polymerase chain reaction qPCR and Sanger sequencing. Copy neutral loss of heterozygosity including MYD88 was observed in one case. No mutation of CXCR4, CD79A and CD79B was observed in parallel. We further showed that monitoring the quantitative expression of MYD88 L265P mutation might be a useful molecular tool to monitor response to chemotherapy using qPCR. In conclusion, identification of MYD88 L265P mutation might be a new molecular-based biomarker tool to add to the diagnostic and monitoring armamentarium for BNS. © 2014 John Wiley & Sons Ltd.

  17. The role of Val-265 for flavin adenine dinucleotide (FAD) binding in pyruvate oxidase: FTIR, kinetic, and crystallographic studies on the enzyme variant V265A.

    Science.gov (United States)

    Wille, Georg; Ritter, Michaela; Weiss, Manfred S; König, Stephan; Mäntele, Werner; Hübner, Gerhard

    2005-04-05

    In pyruvate oxidase (POX) from Lactobacillus plantarum, valine 265 participates in binding the cofactor FAD and is responsible for the strained conformation of its isoalloxazine moiety that is visible in the crystal structure of POX. The contrasting effects of the conservative amino acid exchange V265A on the enzyme's catalytic properties, cofactor affinity, and protein structure were investigated. The most prominent effect of the exchange was observed in the 2.2 A crystal structure of the mutant POX. While the overall structures of the wild-type and the variant are similar, flavin binding in particular is clearly different. Local disorder at the isoalloxazine binding site prevents modeling of the complete FAD cofactor and two protein loops of the binding site. Only the ADP moiety shows well-defined electron density, indicating an "anchor" function for this part of the molecule. This notion is corroborated by competition experiments where ADP was used to displace FAD from the variant enzyme. Despite the fact that the affinity of FAD binding in the variant is reduced, the catalytic properties are very similar to the wild-type, and the redox potential of the bound flavin is the same for both proteins. The rate of electron transfer toward the flavin during turnover is reduced to one-third compared to the wild-type, but k(cat) remains unchanged. Redox-triggered FTIR difference spectroscopy of free FAD shows the nu(C(10a)=N(1)) band at 1548 cm(-)(1). In POX-V265A, this band is found at 1538 cm(-)(1) and thus shifted less strongly than in wild-type POX where it is found at 1534 cm(-)(1). Taking these observations together, the conservative exchange V265A in POX has a surprisingly small effect on the catalytic properties of the enzyme, whereas the effect on the three-dimensional structure is rather big.

  18. 12 CFR 563b.265 - How may I use proxies executed under this part?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How may I use proxies executed under this part... CONVERSIONS FROM MUTUAL TO STOCK FORM Standard Conversions Proxy Solicitation § 563b.265 How may I use proxies executed under this part? You may vote a proxy obtained under this part on matters that are incidental to...

  19. 28 CFR 26.5 - Attendance at or participation in executions by Department of Justice personnel.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Attendance at or participation in... JUSTICE DEATH SENTENCES PROCEDURES Implementation of Death Sentences in Federal Cases § 26.5 Attendance at... Department of Justice shall be required to be in attendance at or to participate in any execution if such...

  20. 39 CFR Appendix A to Part 265 - Fees for Computer Searches

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Fees for Computer Searches A Appendix A to Part 265 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION RELEASE OF INFORMATION... Personnel: High technical $120 per hour. Medium technical 70 per hour. Low technical 50 per hour. Computer...

  1. 12 CFR 265.8 - Functions delegated to the Staff Director of the Division of International Finance.

    Science.gov (United States)

    2010-01-01

    ... the Division of International Finance. 265.8 Section 265.8 Banks and Banking FEDERAL RESERVE SYSTEM... Functions delegated to the Staff Director of the Division of International Finance. The Board's Staff Director of the Division of International Finance (or the Director's delegee) is authorized: (a...

  2. Transonic and supersonic test of a Mach 2.65 mixed-compression axisymmetric intake

    Science.gov (United States)

    Koncsek, J. L.; Syberg, J.

    1972-01-01

    The test results describe isolated intake performance between Mach 0.95 and the cruise Mach number of 2.65 at angles of incidence from +5 to -5 deg. Maximum total pressure recoveries of over 94 percent with 10 percent distortion were recorded at the compressor face in the Mach range from 2.65 to 2.4. Typical cruise operating recovery was 91 percent with 13 percent distortion, 7 percent bleed, 5 percent corrected flow stability margin, and 2.2 deg angle-of-incidence tolerance without need for control action. In the started range below Mach 2.4, recoveries were 2 percent to 4 percent lower than the recoveries above Mach 2.4, and the distortion increased to approximately 20 percent. At Mach 0.95 the maximum measured capture flow was 99.4 percent of the theoretical choked value. The recovery was 97.1 percent with less than 10 percent distortion.

  3. A pulsation phase-dependent dust shell model of OH 26.5 + 0.6

    International Nuclear Information System (INIS)

    Suh, Kyungwon; Jones, T.J.; Bowen, G.H.

    1990-01-01

    The spectral energy distribution of the radio-luminous OH/IR star 26.5 + 0.6 was modeled as a function of pulsation phase, using standard radiative-transfer techniques but with more self-consistent input parameters based partly on pulsation model calculations. The changes in spectral shape and overall intensity are easily explained in terms of the radial movement of the dust condensation radius with the changing luminosity of the star. The derived amplitude of the bolometric light curve is only 1.2 mag, considerably less than expected. 30 refs

  4. A pulsation phase-dependent dust shell model of OH 26.5 + 0.6

    Science.gov (United States)

    Suh, Kyung-Won; Jones, Terry Jay; Bowen, G. H.

    1990-01-01

    The spectral energy distribution of the radio-luminous OH/IR star 26.5 + 0.6 was modeled as a function of pulsation phase, using standard radiative-transfer techniques but with more self-consistent input parameters based partly on pulsation model calculations. The changes in spectral shape and overall intensity are easily explained in terms of the radial movement of the dust condensation radius with the changing luminosity of the star. The derived amplitude of the bolometric light curve is only 1.2 mag, considerably less than expected.

  5. Subjective Video Quality Assessment of H.265 Compression Standard for Full HD Resolution

    Directory of Open Access Journals (Sweden)

    Miroslav Uhrina

    2015-01-01

    Full Text Available Recently increasing interest in multimedia services leads to requirements for quality assessment, especially in the video domain. There are many factors that influence the video quality. Compression technology and transmission link imperfection can be considered as the main ones. This paper deals with the assessment of the impact of H.265/HEVC compression standard on the video quality using subjective metrics. The evaluation is done for two types of sequences with Full HD resolution depending on content. The paper is divided as follows. In the first part of the article, a short characteristic of the H.265/HEVC compression standard is written. In the second part, the subjective video quality methods used in our experiments are described. The last part of this article deals with the measurements and experimental results. They showed that quality of sequences coded between 5 and 7 Mbps is for observers sufficient, so there is no need for providers to use higher bitrates in streaming than this threshold. These results are part of a new model that is still being created and will be used for predicting the video quality in networks based on IP.

  6. 7 CFR 1951.265 - Application for subsequent loan, subordination, or consent to additional indebtedness from a...

    Science.gov (United States)

    2010-01-01

    ... consent to additional indebtedness from a borrower who has been requested to graduate. 1951.265 Section... indebtedness from a borrower who has been requested to graduate. (a) Any borrower who appears to meet the local... considered for a subsequent loan, subordination, or consent to additional indebtedness until the borrower's...

  7. Video Traffic Characteristics of Modern Encoding Standards: H.264/AVC with SVC and MVC Extensions and H.265/HEVC

    Directory of Open Access Journals (Sweden)

    Patrick Seeling

    2014-01-01

    Full Text Available Video encoding for multimedia services over communication networks has significantly advanced in recent years with the development of the highly efficient and flexible H.264/AVC video coding standard and its SVC extension. The emerging H.265/HEVC video coding standard as well as 3D video coding further advance video coding for multimedia communications. This paper first gives an overview of these new video coding standards and then examines their implications for multimedia communications by studying the traffic characteristics of long videos encoded with the new coding standards. We review video coding advances from MPEG-2 and MPEG-4 Part 2 to H.264/AVC and its SVC and MVC extensions as well as H.265/HEVC. For single-layer (nonscalable video, we compare H.265/HEVC and H.264/AVC in terms of video traffic and statistical multiplexing characteristics. Our study is the first to examine the H.265/HEVC traffic variability for long videos. We also illustrate the video traffic characteristics and statistical multiplexing of scalable video encoded with the SVC extension of H.264/AVC as well as 3D video encoded with the MVC extension of H.264/AVC.

  8. 28 CFR 2.65 - Paroling policy for prisoners serving aggregate U.S. and D.C. Code sentences.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Paroling policy for prisoners serving... PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.65 Paroling policy for prisoners serving aggregate U.S. and...

  9. Video traffic characteristics of modern encoding standards: H.264/AVC with SVC and MVC extensions and H.265/HEVC.

    Science.gov (United States)

    Seeling, Patrick; Reisslein, Martin

    2014-01-01

    Video encoding for multimedia services over communication networks has significantly advanced in recent years with the development of the highly efficient and flexible H.264/AVC video coding standard and its SVC extension. The emerging H.265/HEVC video coding standard as well as 3D video coding further advance video coding for multimedia communications. This paper first gives an overview of these new video coding standards and then examines their implications for multimedia communications by studying the traffic characteristics of long videos encoded with the new coding standards. We review video coding advances from MPEG-2 and MPEG-4 Part 2 to H.264/AVC and its SVC and MVC extensions as well as H.265/HEVC. For single-layer (nonscalable) video, we compare H.265/HEVC and H.264/AVC in terms of video traffic and statistical multiplexing characteristics. Our study is the first to examine the H.265/HEVC traffic variability for long videos. We also illustrate the video traffic characteristics and statistical multiplexing of scalable video encoded with the SVC extension of H.264/AVC as well as 3D video encoded with the MVC extension of H.264/AVC.

  10. 20 CFR 645.265 - What safeguards are there to ensure that participants in Welfare-to-Work employment activities do...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What safeguards are there to ensure that participants in Welfare-to-Work employment activities do not displace other employees? 645.265 Section 645.265 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR PROVISIONS GOVERNING WELFARE-TO-WORK GRANTS General Program an...

  11. 20 CFR 1002.265 - If the employee is reemployed with his or her pre-service employer, is the employee's pension...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false If the employee is reemployed with his or her pre-service employer, is the employee's pension benefit the same as if he or she had remained continuously employed? 1002.265 Section 1002.265 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE,...

  12. Combustion inputs into a terrestrial archive over 265 years as evidenced by BPCA molecular markers

    Science.gov (United States)

    Hanke, Ulrich M.; Eglinton, Timothy I.; Wiedemeier, Daniel B.; Schmidt, Michael W. I.

    2015-04-01

    Pyrogenic organic matter (PyOM) such as char and soot is produced during the incomplete combustion of biomass and fossil fuel. It is composed of condensed aromatic structures and can resist degradation processes, maybe over long periods of time. Land-use changes, industrial activity and its transport by wind and water affect the fluxes of PyOM from the source to its sedimentary archive. Investigating environmental PyOM with the molecular marker benzene polycarboxylic acid (BPCA) method provides various information about quantity, quality (BPCA distribution pattern) and about its isotopic composition (13C and 14C). Assessing PyOM quality can indicate whether it is mostly combustion condensate (soot) or combustion residue (charcoal) and potentially allow source apportionment. Our study area is the Pettaquamscutt River catchment area (35 km2), Rhode Island, U.S.A. It is located down-wind of industrial areas recording deposition of long-distance atmospheric transport as well as local catchment inputs, both from natural and anthropogenic sources. We investigated 50 samples of a sediment record over a time span of 265 years (1733-1998 AD). Previous investigations provided information on the age of deposition, the content of polycyclic aromatic hydrocarbons (PAH) as well as of the radiocarbon contents of total organic carbon (TOC) and PAH (Lima, 2004). We used the BPCA molecular marker method to quantify and characterize PyOM in the same record. First results show that quantity and quality of PyOM change over 265 years. Our investigation aims at understanding how different sources of PyOM are reflected in terrestrial archives by comparing the results of BPCA with radiocarbon-dated TOC and PAH records. Among other aspects, the PAH record reflects the Great Depression and the 1970s oil embargo in North America. We interpret the BPCA distribution patterns regarding the simultaneous shift of dominant fuels including wood, coal, petroleum and gas. Future work will include

  13. Impact of H.264/AVC and H.265/HEVC Compression Standards on the Video Quality for 4K Resolution

    Directory of Open Access Journals (Sweden)

    Miroslav Uhrina

    2014-01-01

    Full Text Available This article deals with the impact of H.264/AVC and H.265/HEVC compression standards on the video quality for 4K resolution. In the first part a short characteristic of both compression standards is written. The second part focuses on the well-known objective metrics which were used for evaluating the video quality. In the third part the measurements and the experimental results are described.

  14. A large-scale video codec comparison of x264, x265 and libvpx for practical VOD applications

    Science.gov (United States)

    De Cock, Jan; Mavlankar, Aditya; Moorthy, Anush; Aaron, Anne

    2016-09-01

    Over the last years, we have seen exciting improvements in video compression technology, due to the introduction of HEVC and royalty-free coding specifications such as VP9. The potential compression gains of HEVC over H.264/AVC have been demonstrated in different studies, and are usually based on the HM reference software. For VP9, substantial gains over H.264/AVC have been reported in some publications, whereas others reported less optimistic results. Differences in configurations between these publications make it more difficult to assess the true potential of VP9. Practical open-source encoder implementations such as x265 and libvpx (VP9) have matured, and are now showing high compression gains over x264. In this paper, we demonstrate the potential of these encoder imple- mentations, with settings optimized for non-real-time random access, as used in a video-on-demand encoding pipeline. We report results from a large-scale video codec comparison test, which includes x264, x265 and libvpx. A test set consisting of a variety of titles with varying spatio-temporal characteristics from our catalog is used, resulting in tens of millions of encoded frames, hence larger than test sets previously used in the literature. Re- sults are reported in terms of PSNR, SSIM, MS-SSIM, VIF and the recently introduced VMAF quality metric. BD-rate calculations show that using x265 and libvpx vs. x264 can lead to significant bitrate savings for the same quality. x265 outperforms libvpx in most cases, but the performance gap narrows (or even reverses) at the higher resolutions.

  15. Evaluation of H.264 and H.265 full motion video encoding for small UAS platforms

    Science.gov (United States)

    McGuinness, Christopher D.; Walker, David; Taylor, Clark; Hill, Kerry; Hoffman, Marc

    2016-05-01

    Of all the steps in the image acquisition and formation pipeline, compression is the only process that degrades image quality. A selected compression algorithm succeeds or fails to provide sufficient quality at the requested compression rate depending on how well the algorithm is suited to the input data. Applying an algorithm designed for one type of data to a different type often results in poor compression performance. This is mostly the case when comparing the performance of H.264, designed for standard definition data, to HEVC (High Efficiency Video Coding), which the Joint Collaborative Team on Video Coding (JCT-VC) designed for high-definition data. This study focuses on evaluating how HEVC compares to H.264 when compressing data from small UAS platforms. To compare the standards directly, we assess two open-source traditional software solutions: x264 and x265. These software-only comparisons allow us to establish a baseline of how much improvement can generally be expected of HEVC over H.264. Then, specific solutions leveraging different types of hardware are selected to understand the limitations of commercial-off-the-shelf (COTS) options. Algorithmically, regardless of the implementation, HEVC is found to provide similar quality video as H.264 at 40% lower data rates for video resolutions greater than 1280x720, roughly 1 Megapixel (MPx). For resolutions less than 1MPx, H.264 is an adequate solution though a small (roughly 20%) compression boost is earned by employing HEVC. New low cost, size, weight, and power (CSWAP) HEVC implementations are being developed and will be ideal for small UAS systems.

  16. New insights into childhood autoimmune hemolytic anemia: a French national observational study of 265 children

    Science.gov (United States)

    Aladjidi, Nathalie; Leverger, Guy; Leblanc, Thierry; Picat, Marie Quitterie; Michel, Gérard; Bertrand, Yves; Bader-Meunier, Brigitte; Robert, Alain; Nelken, Brigitte; Gandemer, Virginie; Savel, Hélène; Stephan, Jean Louis; Fouyssac, Fanny; Jeanpetit, Julien; Thomas, Caroline; Rohrlich, Pierre; Baruchel, André; Fischer, Alain; Chêne, Geneviève; Perel, Y.

    2011-01-01

    Background Autoimmune hemolytic anemia is a rare condition in children. Little is known about its initial presentation and the subsequent progression of the disease. Design and Methods Since 2004, a national observational study has been aiming to thoroughly describe cases and identify prognostic factors. Patients from all French hematologic pediatric units have been included if they had a hemoglobin concentration less than 11 g/dL, a positive direct antiglobulin test and hemolysis. Evans’ syndrome was defined by the association of autoimmune hemolytic anemia and immunological thrombocytopenic purpura. Data from patients’ medical records were registered from birth to last follow-up. Autoimmune hemolytic anemia was classified as primary or secondary. Remission criteria, qualifying the status of anemia at last follow-up, were used with the aim of identifying a subgroup with a favorable prognosis in continuous complete remission. Results The first 265 patients had a median age of 3.8 years at diagnosis. In 74% of cases the direct antiglobulin test was IgG/IgG+C3d. Consanguinity was reported in 8% of cases and first degree familial immunological diseases in 15% of cases. Evans’ syndrome was diagnosed in 37% of cases. Autoimmune hemolytic anemia was post-infectious in 10%, immunological in 53% and primary in 37% of cases. After a median follow-up of 3 years, 4% of children had died, 28% were still treatment-dependent and 39% were in continuous complete remission. In multivariate analysis, IgG and IgG+C3d direct antiglobulin tests were associated with a lower rate of survival with continuous complete remission (adjusted hazard ratio, 0.43; 95% confidence interval, 0.21–0.86). Conclusions This nationwide French cohort is the largest reported study of childhood autoimmune hemolytic anemia. The rarity of this condition is confirmed. Subgroups with genetic predisposition and underlying immune disorders were identified. PMID:21228033

  17. 12C(n , 2 n )11C cross section from threshold to 26.5 MeV

    Science.gov (United States)

    Yuly, M.; Eckert, T.; Hartshaw, G.; Padalino, S. J.; Polsin, D. N.; Russ, M.; Simone, A. T.; Brune, C. R.; Massey, T. N.; Parker, C. E.; Fitzgerald, R.; Sangster, T. C.; Regan, S. P.

    2018-02-01

    The 12C(n ,2 n )11C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3H(d ,n )4He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β+ decay of 11C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1H(n ,p ) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.

  18. MYD88 L265P Mutations Are Correlated with 6q Deletion in Korean Patients with Waldenström Macroglobulinemia

    Directory of Open Access Journals (Sweden)

    Jung-Ah Kim

    2014-01-01

    Full Text Available Waldenström macroglobulinemia (WM is a malignant lymphoplasma-proliferative disorder with IgM monoclonal gammopathy. A recent whole-genome study identified MYD88 L265P as the key mutation in WM. We investigated MYD88 mutations in conjunction with cytogenetic study in 22 consecutive Korean WM patients. Conventional G-banding and interphase fluorescence in situ hybridization (FISH were performed at regions including 6q21 using bone marrow (BM aspirates. Sixteen patients were subjected to Sanger sequencing-based MYD88 mutation study. Five patients (28% showed cytogenetic aberrations in G-banding. The incidence of 6q21 deletion was 17% by conventional G-banding and 37% by FISH. Ten patients (45% showed cytogenetic aberrations using FISH: 6q deletion in eight (37% and IGH rearrangement in four (18%. Two patients had both the 6q deletion and IGH rearrangement, and two had only the IGH rearrangement. Eleven patients (69% presented with the MYD88 L265P mutation. MYD88 mutations were significantly associated with the presence of 6q deletions (P=0.037. Six patients with the 6q deletion for whom sequencing was possible were found to harbor MYD88 mutations. The MYD88 L265P mutation was also associated with increased lymphocyte burden in BM biopsy. This is the first report of high frequency MYD88 L265P mutations in Korean WM patients.

  19. Clone-specific MYD88 L265P and CXCR4 mutation status can provide clinical utility in suspected Waldenström macroglobulinemia/lymphoplasmacytic lymphoma.

    Science.gov (United States)

    Burnworth, Bettina; Wang, Zhixing; Singleton, Timothy P; Bennington, Angela; Fritschle, Wayne; Bennington, Richard; Brodersen, Lisa Eidenschink; Wells, Denise A; Loken, Michael R; Zehentner, Barbara K

    2016-12-01

    MYD88 L265P, a diagnostic marker for lymphoplasmacytic lymphoma (LPL)/Waldenström macroglobulinemia (WM) can also be detected in other hematopoietic malignancies. We demonstrate a novel approach to increase the specificity of this marker for WM/LPL diagnosis by combining flow cytometric cell sorting with molecular analysis. Clonal B-lymphocyte and co-occurring clonal plasma cell populations of low-grade B-cell lymphomas were sorted by flow cytometry and analyzed for immunoglobulin gene rearrangements (PCR), and for MYD88 and CXCR4 mutations. Identical clonal origin was confirmed by PCR for 21 LPL/WM cases and MYD88 L265P was detected in both B-cell and plasma cell fractions. 9/20 other B-cell lymphomas with identical light chain restriction on B-cells and plasma cells were genotypically identical by PCR and MYD88 L265P was detected in both cell fractions in 7/9 whereas in 11/20 specimens with different clonal origin, MYD88 L265P was absent (5/11), or only found in B-lymphocytes (4/11), or plasma cells (2/11). CXCR4 mutations were detected in 17/39 cases, but missed in 63% of these without cell sorting. Confirming MYD88L265P in both B-cells and plasma cell fractions can provide a novel and powerful discriminator to distinguish LPL/WM from phenotypically similar disorders. Furthermore, this approach significantly increases CXCR4 detection sensitivity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Preliminary results on effect of H2S on P265GH commercial material for natural gases and petroleum transportation

    Science.gov (United States)

    Zaharia, Marius Gabriel; Stanciu, Sergiu; Cimpoesu, Ramona; Ionita, Iulian; Cimpoesu, Nicanor

    2018-04-01

    A commercial Fe-C material (P265GH) used for natural gas delivery and transportation systems was analyzed in H2S atmosphere in order to establish the corrosion resistance. In most of the industrial processes for gas purification the corrosion rate is speed up by the presence of sulphur (S) especially as ions (HS-, SO32-) or different species like H2S. The H2S (hydrogen sulphide) is, beside a very toxic compound, a very active element in the acceleration of metallic materials deterioration. For experiments we used a three electrodes cell with Na2SO4 + Na2S solution at pH 3 for two different temperatures, room temperature ∼ 25 °C (sample 1) and at 60 (sample 2) ±1 °C in order to realize EIS (electrochemical impedance spectroscopy) and potentiodynamic polarization. After electro-chemical tests and corrosion resistance characterisation the material surface was analyzed using scanning electron microscopy (SEM), X-ray diffraction (XRD) and energy dispersive spectroscopy (EDS).

  1. Response of the leaf photosynthetic rate to available nitrogen in erect panicle-type rice (Oryza sativa L. cultivar, Shennong265

    Directory of Open Access Journals (Sweden)

    Chihiro Urairi

    2016-07-01

    Full Text Available Increasing the yield of rice per unit area is important because of the demand from the growing human population in Asia. A group of varieties called erect panicle-type rice (EP achieves very high yields under conditions of high nitrogen availability. Little is known, however, regarding the leaf photosynthetic capacity of EP, which may be one of the physiological causes of high yield. We analyzed the factors contributing to leaf photosynthetic rate (Pn and leaf mesophyll anatomy of Nipponbare, Takanari, and Shennong265 (a EP type rice cultivar varieties subjected to different nitrogen treatments. In the field experiment, Pn of Shennong265 was 33.8 μmol m−2 s−1 in the high-N treatment, and was higher than that of the other two cultivars because of its high leaf nitrogen content (LNC and a large number of mesophyll cells between the small vascular bundles per unit length. In Takanari, the relatively high value of Pn (31.5 μmol m−2 s−1 was caused by the high stomatal conductance (gs; .72 mol m−2 s−1 in the high-N treatment. In the pot experiment, the ratio of Pn/Ci to LNC, which may reflect mesophyll conductance (gm, was 20–30% higher in Nipponbare than in Takanari or Shennong265 in the high N availability treatment. The photosynthetic performance of Shennong265 might be improved by introducing the greater ratio of Pn/Ci to LNC found in Nipponbare and greater stomatal conductance found in Takanari.

  2. Tests of a mixed compression axisymmetric inlet with large transonic mass flow at Mach numbers 0.6 to 2.65

    Science.gov (United States)

    Smeltzer, D. B.; Sorensen, N. E.

    1972-01-01

    A 38.8-cm (15.28-in.) capture diameter model of a mixed-compression axisymmetric inlet system with a translating cowl was designed and tested. The internal contours, designed for Mach number 2.65, provided a throat area of 59 percent of the capture area when the cowl was retracted for transonic operation. Other model features included a boundary-layer removal system, vortex generators, an engine airflow bypass system, cowl support struts, and rotating rakes at the engine face. All tunnel testing was conducted at a tunnel total pressure of about 1 atm (a unit Reynolds number of about 8.53 million/m at Mach number 2.65) at angles of attack from 0 deg to 4 deg. Results for the following were obtained: total-pressure recovery and distortion at the engine face as a function of bleed mass-flow ratio, the effect of bleed and vortex generator configurations on pressure recovery and distortion, inlet tolerance to unstart due to changes in angle of attack or Mach number, surface pressure distributions, boundary-layer profiles, and transonic additive drag. At Mach number 2.65 and with the best bleed configurations, maximum total pressure recovery at the engine face ranged from 91 to 94.5 percent with bleed mass-flow ratios from 4 to 9 percent, respectively, and total-pressure distortion was less than 10 percent. At off-design supersonic Mach numbers above 1.70, maximum total-pressure recoveries and corresponding bleed mass flows were about the same as at Mach number 2.65, with about 10 to 15 percent distortion. In the transonic Mach number range, total pressure recovery was high (above 96 percent) and distortion was low (less than 15 percent) only when the inlet mass-flow ration was reduced 0.02 to 0.06 from the maximum theoretical value (0.590 at Mach number 1.0).

  3. Effectiveness and intermediates of microcystin-LR degradation by UV/H2O2via 265 nm ultraviolet light-emitting diodes.

    Science.gov (United States)

    Liu, Juan; Ye, Jin-Shao; Ou, Hua-Se; Lin, Jialing

    2017-02-01

    Although the degradation of cyanotoxins by 254 nm UV/H 2 O 2 has been well elucidated, the efficiency and mechanism involved are not necessarily true for other UV wavelengths. The degradation of microcystin-LR (MC-LR), a representative cyanotoxin, was explored by UV/H 2 O 2 using 265 nm ultraviolet light-emitting diode (UV-LED). The results indicated that 265 nm UV/H 2 O 2 treatment had a high removal efficiency of MC-LR ([MC-LR] = 0.1 μM, apparent rate constants reached 0.2077 min -1 , half-time at 3.3 min). The qualitative analyses demonstrated that three novel intermediates, C 48 H 74 N 10 O 15 (molecular weight = 1030.5335), C 36 H 58 N 10 O 14 (854.4134), and C 33 H 54 N 10 O 14 (814.3821), were generated in 265 nm UV/H 2 O 2 . Five published intermediates were also confirmed. The generative pathway of these products mainly involved free hydroxyl radical oxidation, resulting in consecutive hydroxyl substitutions and hydroxyl additions of unsaturated bonds in MC-LR. The toxicity of MC-LR was weaken with a relative low mineralization. The electrical energy per order values were calculated to be in the range of 0.00447 to 0.00612 kWh m -3  order -1 for 100-5000 μg L -1 MC-LR. Overall, 265 nm UV-LED/H 2 O 2 can be used as an alternative effective technology to improve the removal efficiency of MC-LR in water.

  4. Association between the MTHFR A1298C polymorphism and risk of cancer: evidence from 265 case-control studies.

    Science.gov (United States)

    Zhu, Xin-Li; Liu, Zhi-Zhong; Yan, Sen-Xiang; Wang, Wei; Chang, Rui-Xia; Zhang, Chun-Yan; Guo, Yan

    2016-02-01

    Many molecular, epidemiological studies have been performed to explore the association between MTHFR A1298C polymorphism and cancer risk. However, the results were inconsistent or even contradictory. Hence, we performed a meta-analysis to investigate the association between cancer risk and MTHFR A1298C (81,040 cases and 114,975 controls from 265 studies) polymorphism. Overall, significant association was observed between MTHFR A1298C polymorphism and cancer risk when all eligible studies were pooled into the meta-analysis. In further stratified and sensitivity analyses, significantly increased cervical cancer (dominant model: OR 1.46, 95 % CI 1.13-1.90; AC vs. AA: OR 1.48, 95 % CI 1.13-1.92) and lymphoma (dominant model: OR 1.22, 95 % CI 1.04-1.44; recessive model: OR 1.66, 95 % CI 1.15-2.39; CC vs. AA: OR 1.75, 95 % CI 1.21-2.53) risk were observed in Asians, and significantly decreased colorectal cancer risk was found in Asians (recessive model: OR 0.75, 95 % CI 0.59-0.96; CC vs. AA: OR 0.77, 95 % CI 0.60-1.00). In summary, this meta-analysis suggests that MTHFR A1298C polymorphism is associated with increased cervical cancer and lymphoma risk in Asians, and MTHFR A1298C polymorphism is associated with decreased colorectal cancer risk in Asians. Moreover, this meta-analysis also points out the importance of new studies, such as oral cancer and chronic myeloid leukemia, because they had high heterogeneity in this meta-analysis (I (2) > 75 %).

  5. The use of droplet digital PCR in liquid biopsies: A highly sensitive technique for MYD88 p.(L265P) detection in cerebrospinal fluid.

    Science.gov (United States)

    Hiemcke-Jiwa, Laura S; Minnema, Monique C; Radersma-van Loon, Joyce H; Jiwa, N Mehdi; de Boer, Mirthe; Leguit, Roos J; de Weger, Roel A; Huibers, Manon M H

    2018-04-01

    The gold standard for diagnosis of central nervous system lymphomas still regards a stereotactic brain biopsy, with the risk of major complications for the patient. As tumor cells can be detected in cerebrospinal fluid (CSF), CSF analysis can be used as an alternative. In this respect, mutation analysis in CSF can be of added value to other diagnostic parameters such a cytomorphology and clonality analysis. A well-known example of targeted mutation analysis entails MYD88 p.(L265P) detection, which is present in the majority of Bing Neel syndrome and primary central nervous system lymphoma (PCNSL) patients. Unfortunately, tumor yield in CSF can be very low. Therefore, use of the highly sensitive droplet digital PCR (ddPCR) might be a suitable analysis strategy for targeted mutation detection. We analyzed 26 formalin fixed paraffin embedded (FFPE) samples (8 positive and 18 negative for MYD88 p.(L265P) mutation) by ddPCR, of which the results were compared with next generation sequencing (NGS). Subsequently, 32 CSF samples were analyzed by ddPCR. ddPCR and NGS results on FFPE material showed 100% concordance. Among the 32 CSF samples, 9 belonged to patients with lymphoplasmacytic lymphoma (LPL) and clinical suspicion of Bing Neel syndrome, and 3 belonged to patients with PCNSL. Nine of these samples tested positive for MYD88 p.(L265P) (8 LPL and 1 PCNSL). This study shows that sensitive MYD88 mutation analysis by ddPCR in CSF is highly reliable and can be applied even when DNA input is low. Therefore, ddPCR is of added value to current diagnostic parameters, especially when the available amount of DNA is limited. Copyright © 2017 John Wiley & Sons, Ltd.

  6. Neoplasmas oculares e de anexos em cães e gatos no Rio Grande do Sul: 265 casos (2009 -2014)

    OpenAIRE

    Hesse, Kivia L.; Fredo, Gabriela; Guimarães, Lorena L.B.; Reis, Matheus O.; Pigatto, João A.T.; Pavarini, Saulo P.; Driemeier, David; Sonne, Luciana

    2015-01-01

    Neoplasias oculares causam desconforto, problemas de visão e podem refletir doenças sistêmicas. Um estudo retrospectivo foi realizado para identificar e analisar neoplasmas oculares e de anexos obtidos por biópsias enviadas ao Setor de Patologia Veterinária (SPV) da Universidade Federal do Rio Grande do Sul (UFRGS). Durante o período de janeiro de 2009 a dezembro de 2014 realizou-se 265 diagnósticos de neoplasmas oculares e de anexos, destes 87,5% na espécie canina e em 12,5% na espécie felin...

  7. Neoplasmas oculares e de anexos em cães e gatos no Rio Grande do Sul: 265 casos (2009-2014)

    OpenAIRE

    Hesse, Kivia L.; Fredo, Gabriela; Guimarães, Lorena Lima Barbosa; Reis, Matheus de O.; Pigatto, João Antonio Tadeu; Pavarini, Saulo Petinatti; Driemeier, David; Sonne, Luciana

    2015-01-01

    Neoplasias oculares causam desconforto, problemas de visão e podem refletir doenças sistêmicas. Um estudo retrospectivo foi realizado para identificar e analisar neoplasmas oculares e de anexos obtidos por biópsias enviadas ao Setor de Patologia Veterinária (SPV) da Universidade Federal do Rio Grande do Sul (UFRGS). Durante o período de janeiro de 2009 a dezembro de 2014 realizou-se 265 diagnósticos de neoplasmas oculares e de anexos, destes 87,5% na espécie canina e em 12,5% na espécie felin...

  8. Investigation of Chlorella vulgaris UTEX 265 Cultivation under Light and Low Temperature Stressed Conditions for Lutein Production in Flasks and the Coiled Tree Photo-Bioreactor (CTPBR).

    Science.gov (United States)

    Gong, Mengyue; Bassi, Amarjeet

    2017-10-01

    Lutein has an increasing share in the pharmaceutical and nutraceutical market due to its benefits to eye health. Microalgae may be a potential source for lutein production while the expense limits the commercialization. In this study, a coiled tubular tree photobioreactor (CTPBR) design was investigated for cultivating the cold tolerant microalgae Chlorella vulgaris UTEX 265 under various conditions for lutein production. The influence and interaction of light irradiance strength, lighting cycle, and temperature on microalgae and lutein production efficiency at low temperature range were also studied in flasks via response surface method (RSM). The results demonstrated that 14 h day-light, 120 μmol photons m -2  s -1 , and 10 °C was the optimal condition for algae growth and lutein production at low temperature experimental ranges. C. vulgaris UTEX 265 showed good potential to produce lutein in cold weather, and the optimum lutein production was contrary to the specific lutein content but corresponds to the trend of optimum growth. Additionally, fast growth (μ = 1.50 day -1 ) and good lutein recovery (11.98 mg g -1  day -1 ) in CTPBR were also achieved at the low irradiance stress condition and the low temperature photo-inhibition conditions.

  9. Effect of thickness on microwave absorptive behavior of La-Na doped Co-Zr barium hexaferrites in 18.0–26.5 GHz band

    Energy Technology Data Exchange (ETDEWEB)

    Arora, Amit [D.A.V. Institute of Engineering and Technology, Jalandhar (India); Narang, Sukhleen Bindra, E-mail: sukhleen2@yahoo.com [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India); Pubby, Kunal [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India)

    2017-02-01

    In this research, the microwave properties of Lanthanum-Sodium doped Cobalt-Zirconium barium hexaferrites, intended as microwave absorbers, are analyzed on Vector Network Analyzer in K-band. The results indicate that the doping has resulted in lowering of real permittivity and enhancement of dielectric losses. Real permeability has shown increase while magnetic losses have shown decrease in value with doping. All these four properties have shown very small variation with frequency in the scanned frequency range which indicates the relaxation type of behavior. Microwave absorption characteristics of these compositions are analyzed with change in sample thickness. The results demonstrate that the matching frequency of the microwave absorber shifts towards lower side of frequency band with increase in thickness. The complete analysis of the prepared microwave absorbers shows a striking achievement with very low reflection loss and wide absorption bandwidth for all the six compositions in 18–26.5 GHz frequency band. - Highlights: • Electromagnetic Characterization of M-hexaferrites in K-band (18–26.5 GHz) • Variation of absorption properties with thickness of sample. • Satisfaction of quarter-wavelength condition for absorption properties • Results of double-layer absorbers (not reports till day by anyone).

  10. Comparative assessment of H.265/MPEG-HEVC, VP9, and H.264/MPEG-AVC encoders for low-delay video applications

    Science.gov (United States)

    Grois, Dan; Marpe, Detlev; Nguyen, Tung; Hadar, Ofer

    2014-09-01

    The popularity of low-delay video applications dramatically increased over the last years due to a rising demand for realtime video content (such as video conferencing or video surveillance), and also due to the increasing availability of relatively inexpensive heterogeneous devices (such as smartphones and tablets). To this end, this work presents a comparative assessment of the two latest video coding standards: H.265/MPEG-HEVC (High-Efficiency Video Coding), H.264/MPEG-AVC (Advanced Video Coding), and also of the VP9 proprietary video coding scheme. For evaluating H.264/MPEG-AVC, an open-source x264 encoder was selected, which has a multi-pass encoding mode, similarly to VP9. According to experimental results, which were obtained by using similar low-delay configurations for all three examined representative encoders, it was observed that H.265/MPEG-HEVC provides significant average bit-rate savings of 32.5%, and 40.8%, relative to VP9 and x264 for the 1-pass encoding, and average bit-rate savings of 32.6%, and 42.2% for the 2-pass encoding, respectively. On the other hand, compared to the x264 encoder, typical low-delay encoding times of the VP9 encoder, are about 2,000 times higher for the 1-pass encoding, and are about 400 times higher for the 2-pass encoding.

  11. Measurement of the reaction {gamma}p{yields}K{sup 0}{sigma}{sup +} for photon energies up to 2.65 GeV with the SAPHIR detector at ELSA; Messung der Reaktion {gamma}p {yields} K{sup 0}{sigma}{sup +} fuer Photonenergien bis 2.65 GeV mit dem SAPHIR-Detektor an ELSA

    Energy Technology Data Exchange (ETDEWEB)

    Lawall, R.

    2004-01-01

    The reaction {gamma}p {yields} K{sup 0}{sigma}{sup +} was measured with the SAPHIR-detector at ELSA during the run periods 1997 and 1998. Results were obtained for cross sections in the photon energy range from threshold up to 2.65 GeV for all production angles and for the {sigma}{sup +}-polarization. Emphasis has been put on the determination and reduction of the contributions of background reactions and the comparison with other measurements and theoretical predictions. (orig.)

  12. APO A2 -265T/C Polymorphism Is Associated with Increased Inflammatory Responses in Patients with Type 2 Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Fariba Koohdani

    2016-06-01

    Full Text Available BackgroundApolipoprotein A2 (APO A2 is the second most abundant structural apolipoprotein in high density lipoprotein. Several studies have examined the possible effect of APO A2 on atherosclerosis incidence. Due to the role of inflammation in atherosclerosis, we aimed to determine the relationship between APO A2 -265T/C polymorphism and inflammation as a risk factor in type 2 diabetes mellitus (T2DM patients.MethodsIn total, 180 T2DM patients, with known APO A2 -265T/C polymorphism, were recruited for this comparative study and were grouped equally based on their genotypes. Dietary intakes, anthropometric parameters, lipid profile, and inflammatory markers (i.e., pentraxin 3 [PTX3], high-sensitivity C-reactive protein [hs-CRP], and interleukin 18 were measured. The data were analyzed using an independent t-test, a chi-square test, and the analysis of covariance.ResultsAfter adjusting for confounding factors, in the entire study population and in the patients with or without obesity, the patients with the CC genotype showed higher hs-CRP (P=0.001, P=0.008, and P=0.01, respectively and lower PTX3 (P=0.01, P=0.03, and P=0.04, respectively in comparison with the T allele carriers. In the patients with the CC genotype, no significant differences were observed in the inflammatory markers between the obese or non-obese patients. However, regarding the T allele carriers, the plasma hs-CRP level was significantly higher in the obese patients compared to the non-obese patients (P=0.01.ConclusionIn the T2DM patients, the CC genotype could be considered as a risk factor and the T allele as a protective agent against inflammation, which the latter effect might be impaired by obesity. Our results confirmed the anti-atherogenic effect of APO A2, though more studies are required to establish this effect.

  13. The interaction between ApoA2 -265T>C polymorphism and dietary fatty acids intake on oxidative stress in patients with type 2 diabetes mellitus.

    Science.gov (United States)

    Zamani, Elham; Sadrzadeh-Yeganeh, Haleh; Sotoudeh, Gity; Keramat, Laleh; Eshraghian, Mohammadreza; Rafiee, Masoumeh; Koohdani, Fariba

    2017-08-01

    Apolipoprotein A2 (APOA2) -265T>C polymorphism has been studied in relation to oxidative stress and various dietary fatty acids. Since the interaction between APOA2 polymorphism and dietary fatty acids on oxidative stress has not yet discussed, we aimed to investigate the interaction on oxidative stress in type 2 diabetes mellitus (T2DM) patients. The subjects were 180 T2DM patients with known APOA2 genotype, either TT, TC or CC. Superoxide dismutase (SOD) activity was determined by colorimetric method. Total antioxidant capacity (TAC) and serum level of 8-isoprostane F2α were measured by spectrophotometry and ELISA, respectively. Dietary intake was collected through a food frequency questionnaire. Based on the median intake, fatty acids intake was dichotomized into high or low groups. The interaction between APOA2 polymorphism and dietary fatty acids intake was analyzed by ANCOVA multivariate interaction model. Higher than median intake of omega-6 polyunsaturated fatty acids (n-6 PUFA) was associated with increased serum level of 8-isoprostane F2α in subjects with TT/TC genotype (p = 0.004), and higher than median intake of omega-3 polyunsaturated fatty acids (n-3 PUFA) was associated with increased serum SOD activity in CC genotype (p fatty acids intake on oxidative stress. More investigations on different populations are required to confirm the interaction.

  14. A first-in-human phase I, multicenter, open-label, dose-escalation study of the oral RAF/VEGFR-2 inhibitor (RAF265) in locally advanced or metastatic melanoma independent from BRAF mutation status.

    Science.gov (United States)

    Izar, Benjamin; Sharfman, William; Hodi, F Stephen; Lawrence, Donald; Flaherty, Keith T; Amaravadi, Ravi; Kim, Kevin B; Puzanov, Igor; Sosman, Jeffrey; Dummer, Reinhard; Goldinger, Simone M; Lam, Lyhping; Kakar, Shefali; Tang, Zhongwen; Krieter, Oliver; McDermott, David F; Atkins, Michael B

    2017-08-01

    To establish the maximum tolerated dose (MTD), dose-limiting toxicities (DLT), safety profile, and anti-tumor efficacy of RAF265. We conducted a multicenter, open-label, phase-I, dose-escalation trial of RAF265, an orally available RAF kinase/VEGFR-2 inhibitor, in patients with advanced or metastatic melanoma. Pharmacokinetic (PK) analysis, pharmacodynamics (PD) and tumor response assessment were conducted. We evaluated metabolic tumor response by 18[F]-fluorodeoxyglucose-positron-emission tomography (FDG-PET), tissue biomarkers using immunohistochemistry (IHC), and modulators of angiogenesis. RAF265 has a serum half-life of approximately 200 h. The MTD was 48 mg once daily given continuously. Among 77 patients, most common treatment-related adverse effects were fatigue (52%), diarrhea (34%), weight loss (31%) and vitreous floaters (27%). Eight of 66 evaluable patients (12.1%) had an objective response, including seven partial and one complete response. Responses occurred in BRAF-mutant and BRAF wild-type (WT) patients. Twelve of 58 (20.7%) evaluable patients had a partial metabolic response. On-treatment versus pretreatment IHC staining in 23 patients showed dose-dependent p-ERK inhibition. We observed a significant temporal increase in placental growth factor levels and decrease in soluble vascular endothelial growth factor receptor 2 (sVEGFR-2) levels in all dose levels. RAF265 is an oral RAF/VEGFR-2 inhibitor that produced antitumor responses, metabolic responses, and modulated angiogenic growth factor levels. Antitumor activity occurred in patients with BRAF-mutant and BRAF-WT disease. Despite low activity at tolerable doses, this study provides a framework for the development of pan-RAF inhibitors and modulators of angiogenesis for the treatment of melanoma. © 2017 The Authors. Cancer Medicine published by John Wiley & Sons Ltd.

  15. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. I. Overall retardation from the stage irradiated to nuclear membrane breakdown

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, J.G.

    1976-10-01

    Neuroblasts of Chortophaga viridifasciata (DeGeer) in culture were exposed to different doses of 225, 265, or 280 nm ultraviolet radiations at 11 different stages and substages of the mitotic cycle and individually selected cells were timed to breakdown of the nuclear membrane. Comparisons of the effectiveness of different wavelengths on the different stages were based on the dose that reduced the cell progression rate to 67 percent of normal (D/sub 67/) and the slope of the regression line, i.e., the control to treated time (C/T) ratio change/erg/mm/sup 2/ at the D/sub 67/ level. Cells of the prereplication period (metaphase + anaphase + early telophase) and the S phase (middle and late telophase + interphase + very early prophase) are equally sensitive to uv and contrast sharply with the much lower sensitivity of those in the postreplication period (early and middle prophase). This can best be interpreted if chromosomal DNA is the chromophore for uv-induced mitotic retardation. Cells in the prereplication period at exposure show no wavelength effect. In the S phase all stages except middle telophase and all stages combined are significantly more sensitive to 265 and 280 nm than to 225 nm. Of the postreplication stages, early prophase is retarded significantly more by 280 than by 225 or 265 nm. The C/T ratio/erg/mm/sup 2/ is greater after exposure to 265 nm at all prereplication and replication stages, but exhibits no consistent wavelength pattern during the postreplication period. Evidence based on the orientation of the neuroblast with respect to the uv-source suggests that the chromophore for mitotic retardation does not reside within the centrosome and related structures, but may be present, at least partly, in the nucleolus.

  16. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. I. Overall retardation from the stage irradiated to nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Neuroblasts of Chortophaga viridifasciata (DeGeer) in culture were exposed to different doses of 225, 265, or 280 nm ultraviolet radiations at 11 different stages and substages of the mitotic cycle and individually selected cells were timed to breakdown of the nuclear membrane. Comparisons of the effectiveness of different wavelengths on the different stages were based on the dose that reduced the cell progression rate to 67 percent of normal (D 67 ) and the slope of the regression line, i.e., the control to treated time (C/T) ratio change/erg/mm 2 at the D 67 level. Cells of the prereplication period (metaphase + anaphase + early telophase) and the S phase (middle and late telophase + interphase + very early prophase) are equally sensitive to uv and contrast sharply with the much lower sensitivity of those in the postreplication period (early and middle prophase). This can best be interpreted if chromosomal DNA is the chromophore for uv-induced mitotic retardation. Cells in the prereplication period at exposure show no wavelength effect. In the S phase all stages except middle telophase and all stages combined are significantly more sensitive to 265 and 280 nm than to 225 nm. Of the postreplication stages, early prophase is retarded significantly more by 280 than by 225 or 265 nm. The C/T ratio/erg/mm 2 is greater after exposure to 265 nm at all prereplication and replication stages, but exhibits no consistent wavelength pattern during the postreplication period. Evidence based on the orientation of the neuroblast with respect to the uv-source suggests that the chromophore for mitotic retardation does not reside within the centrosome and related structures, but may be present, at least partly, in the nucleolus

  17. Apolipoprotein A2 -265 T>C polymorphism interacts with dietary fatty acids intake to modulate inflammation in type 2 diabetes mellitus patients.

    Science.gov (United States)

    Keramat, Laleh; Sadrzadeh-Yeganeh, Haleh; Sotoudeh, Gity; Zamani, Elham; Eshraghian, Mohammadreza; Mansoori, Anahita; Koohdani, Fariba

    2017-05-01

    Several investigations have been conducted regarding the interaction between Apolipoprotein A2 (APOA2) -265 T>C polymorphism and dietary intake of saturated fatty acids (SFAs) on obesity in healthy individuals or type 2 diabetes mellitus (T2 DM) patients. The aim of the present study is to examine the effect of this interaction on inflammatory markers in T2 DM patients. This is a comparative cross-sectional study on 180 T2 DM patients with known APOA2 genotype. Dietary intake was assessed by food-frequency questionnaire and serum levels of inflammatory markers (interleukin [IL]-18, pentraxin 3, and high-sensitivity C-reactive protein [hs-CRP]) were measured. The subjects were dichotomized into "high" and "low" categories, based on the median dietary intake of polyunsaturated fatty acids (PUFAs), monounsaturated fatty acids (MUFAs), and SFAs. The data were analyzed by analysis of covariance multivariate interaction model. In CC genotype, higher median intake of ω-3 PUFAs and MUFAs was associated with decreased serum levels of IL-18 and hs-CRP (P = 0.014 and 0.008, respectively). In T-allele carriers, higher median intake of SFAs was associated with increased serum hs-CRP level (P fatty acids, such as ω-3 PUFAs and MUFAs, could reduce the inflammatory effects associated with the CC genotype. In addition, proinflammatory fatty acids, such as SFAs, could overcome the antiinflammatory effect of the T-allele. Further studies are needed to confirm these findings. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. The effect of weight loss on HDL subfractions and LCAT activity in two genotypes of APOA-II -265T>C polymorphism.

    Science.gov (United States)

    Moradi, Masoumeh; Mahmoudi, Maryam; Saedisomeolia, Ahmad; Zahirihashemi, Roxana; Koohdani, Fariba

    2017-05-25

    People may have different responses to the same environmental changes. It has been reported that genome variations may be responsible for these differences. Also, HDL subfractions may be influenced by different genetic variations. The aim of the present study was to determine gene-diet interactions and to evaluate the influence of weight loss on HDL subfractions between two genotypes of -265 T>C APOA-II polymorphism. In the present study, 56 overweight and obese patients with type 2 diabetes mellitus were selected from 697 genotype-specified subjects. After matching for gender, age and BMI at the beginning of the study, an equal number of patients remained on each genotype of APOA-II (TT/TC and CC group). After a 6-week calorie restriction program, 44 patients completed the study. Serum HDL subfractions, including HDL2 and HDL3 and LCAT activity, were compared between the two genotypes and, before and after the intervention, were separated in each genotype. Serum concentration of HDL and its subfractions decreased significantly due to the weight loss. A comparison of the mean changes between the genotypes showed that HDL3 significantly decreased in the CC genotype while, in the TT/TC group, the serum concentration of HDL2 was significantly reduced. However, the increase of LCAT activity was not significant among the two genotypes. A comparison of mean changes of variables within two genotype groups showed that C homozygote carriers lead to a general shift toward larger size HDL subfractions and T allele carriers shift toward smaller size HDL subfractions after weight loss.

  19. Impact Testing on Reinforced Carbon-Carbon Flat Panels With BX-265 and PDL-1034 External Tank Foam for the Space Shuttle Return to Flight Program

    Science.gov (United States)

    Melis, Matthew E.; Revilock, Duane M.; Pereira, Michael J.; Lyle, Karen H.

    2009-01-01

    Following the tragedy of the Orbiter Columbia (STS-107) on February 1, 2003, a major effort commenced to develop a better understanding of debris impacts and their effect on the space shuttle subsystems. An initiative to develop and validate physics-based computer models to predict damage from such impacts was a fundamental component of this effort. To develop the models it was necessary to physically characterize reinforced carbon-carbon (RCC) along with ice and foam debris materials, which could shed on ascent and impact the orbiter RCC leading edges. The validated models enabled the launch system community to use the impact analysis software LS-DYNA (Livermore Software Technology Corp.) to predict damage by potential and actual impact events on the orbiter leading edge and nose cap thermal protection systems. Validation of the material models was done through a three-level approach: Level 1-fundamental tests to obtain independent static and dynamic constitutive model properties of materials of interest, Level 2-subcomponent impact tests to provide highly controlled impact test data for the correlation and validation of the models, and Level 3-full-scale orbiter leading-edge impact tests to establish the final level of confidence for the analysis methodology. This report discusses the Level 2 test program conducted in the NASA Glenn Research Center (GRC) Ballistic Impact Laboratory with external tank foam impact tests on flat RCC panels, and presents the data observed. The Level 2 testing consisted of 54 impact tests in the NASA GRC Ballistic Impact Laboratory on 6- by 6-in. and 6- by 12-in. flat plates of RCC and evaluated two types of debris projectiles: BX-265 and PDL-1034 external tank foam. These impact tests helped determine the level of damage generated in the RCC flat plates by each projectile and validated the use of the foam and RCC models for use in LS-DYNA.

  20. Technical complications during veno-venous extracorporeal membrane oxygenation and their relevance predicting a system-exchange--retrospective analysis of 265 cases.

    Directory of Open Access Journals (Sweden)

    Matthias Lubnow

    Full Text Available OBJECTIVES: Technical complications are a known hazard in veno-venous extracorporeal membrane oxygenation (vvECMO. Identifying these complications and predictive factors indicating a developing system-exchange was the goal of the study. METHODS: Retrospective study on prospectively collected data of technical complications including 265 adult patients (Regensburg ECMO Registry, 2009-2013 with acute respiratory failure treated with vvECMO. Alterations in blood flow resistance, gas transfer capability, hemolysis, coagulation and hemostasis parameters were evaluated in conjunction with a system-exchange in all patients with at least one exchange (n = 83. RESULTS: Values presented as median (interquartile range. Patient age was 50(36-60 years, the SOFA score 11(8-14.3 and the Murray lung injury Score 3.33(3.3-3.7. Cumulative ECMO support time 3411 days, 9(6-15 days per patient. Mechanical failure of the blood pump (n = 5, MO (n = 2 or cannula (n = 1 accounted for 10% of the exchanges. Acute clot formation within the pump head (visible clots, increase in plasma free hemoglobin (frHb, serum lactate dehydrogenase (LDH, n = 13 and MO (increase in pressure drop across the MO, n = 16 required an urgent system-exchange, of which nearly 50% could be foreseen by measuring the parameters mentioned below. Reasons for an elective system-exchange were worsening of gas transfer capability (n = 10 and device-related coagulation disorders (n = 32, either local fibrinolysis in the MO due to clot formation (increased D-dimers [DD], decreased platelet count; n = 24, or device-induced hyperfibrinolysis (increased DD, decreased fibrinogen [FG], decreased platelet count, diffuse bleeding tendency; n = 8, which could be reversed after system-exchange. Four MOs were exchanged due to suspicion of infection. CONCLUSIONS: The majority of ECMO system-exchanges could be predicted by regular inspection of the complete ECMO circuit, evaluation of gas exchange, pressure drop

  1. The 26.5 ka Oruanui eruption, New Zealand : a review of the roles of volcanism and climate in the post-eruptive sedimentary response

    International Nuclear Information System (INIS)

    Manville, V.R.; Wilson, C.J.N.

    2004-01-01

    The landscape response to large explosive pyroclastic volcanic eruptions is one of the most dramatic processes in sedimentology and geomorphology. Processes of post-eruptive erosion and resedimentation are maximised by large erupted volumes, abundant unconsolidated ash-sized material, destruction of the vegetation cover (particularly by burial by ignimbrite), and inhibition of vegetation regrowth (e.g., by harsh climatic conditions). The 26.5 ka Oruanui eruption from Taupo volcano in the central North Island of New Zealand created optimal conditions for a large-scale sedimentary response that was influenced and prolonged by the succeeding climatic nadir of the Last Glacial Maximum. About 530 km 3 of rhyolitic magma was erupted as 420 km 3 of fall deposits, 320 km 3 of pyroclastic density current deposits (mostly non-welded ignimbrite), and 430 km 3 of primary intracaldera fill. The eruption, and formation of the Oruanui caldera, destroyed one major lake but created the forerunner to modern Lake Taupo. This lake initially stably overflowed to the northwest before breaking out in a catastrophic flood during establishment of a northeasterly outlet along the line of the modern Waikato River. Suppression of revegetation by the contemporaneous harsh periglacial climate contributed to intense erosion and remobilisation of Oruanui pyroclastic units, triggering massive downstream fluvial aggradation in impacted catchments. In particular, aggradation caused the lower 180 km of the Waikato River to avulse from its long-established route via the Hauraki Plains into the Hamilton Basin where it was subsequently trapped. Aeolian reworking created localised dune fields, while generation of tephric loess formed deposits over much of the central North Island. The initial perturbation to fluvial sedimentary systems created by the eruption was generally sustained by climatic conditions until c. 17 ka. Climatic amelioration eventually stabilised primary sediment sources through the re

  2. Study of the photoproduction of the vector meson Φ(1020) and the hyperon Λ(1520) from the production threshold up to a photon energy of 2.65 GeV with SAPHIR

    International Nuclear Information System (INIS)

    Wiegers, B.

    2001-05-01

    The photoproduction of the vector meson φ(1020) and the hyperon Λ(1520) have been measured in the finale state pK + K - from their thresholds up to 2.65 GeV using the high duty-factor electron accelerator ELSA and the 4π-detectorsystem SAPHIR. The t-dependence of φ(1020)-production shows an exponential behavior as expected from diffractive production. s-channel helicity conservation can be seen in the decay angular distribution in the helicity frame. The decay angular distribution in the Gottfried-Jackson frame is not conformable with the exchange of a Pomeron in the t-channel. For the first time, differential cross sections of the Λ(1520) photoproduction from the threshold are measured. The production angular distribution and the decay angular distribution in the Gottfried-Jackson frame show a K * exchange in the t-channel. (orig.)

  3. High education is associated with low fat and high fibre, beta-carotene and vitamin C - Computation of nutrient intake based on a short food frequency questionnaire in 17,265 men and women in the Tromsø Study

    Directory of Open Access Journals (Sweden)

    Bjarne Koster Jacobsen

    2009-11-01

    Full Text Available  ABSTRACTEducational level has been correlated to the intake of several nutrients. In a population-based studyincluding 17,265 men and women aged 25-69 years, the intake of nutrients were calculated based on 37questions about food habits. In this paper, we present results from the dietary survey with emphasis onthe relationships between dietary habits and educational level. Compared to subjects with low formaleducation, subjects with high educational level have less fat in their diet and more dietary fibre, betacarotene,vitamin C and alcohol (p-value for linear trend is associated with healthy food habits and relatively higher alcohol consumption. There is a need forefforts in order to change the food habits of the less educated.NORSK SAMMENDRAGPersoner med lang utdanning har ofte et bedre kosthold enn personer med kortere utdanning. I denneundersøkelsen har vi estimert inntaket av en rekke næringsstoffer basert på 37 spørsmål om kostvanersom ble stilt til personer som tok del i Tromsø-IV-undersøkelsen (1994/95. Vår studie inkluderer 17 265menn og kvinner i Tromsø i alderen 25-69 år. Vi presenterer resultater fra denne kostholdsundersøkelsenmed vekt på relasjoner mellom kostvaner og utdanningslengde. Sammenlignet med personer med kortformell utdanning, har personer med lang utdanning mindre fett i kosten og høyere inntak av fiber, betakaroten,vitamin C og alkohol (p helsemessig gunstigere kosthold, men et høyere alkoholinntak, enn personer med kort utdanning.Funnene understreker behovet for målrettede tiltak for å utjevne sosiale forskjeller i kostvaner i Norge.

  4. X-ray photoemission studies of Zn doped Cu1-xTl xBa2Ca2Cu 3-yZn yO10-δ (y = 0, 2.65) superconductors

    International Nuclear Information System (INIS)

    Khan, Nawazish A.; Mumtaz, M.; Ahadian, M.M.; Iraji-zad, Azam

    2007-01-01

    The X-ray photoemission (XPS) measurements of Cu 1-x Tl x Ba 2 Ca 2 Cu 3-y Zn y O 10-δ (y = 0, 2.65) superconductors have been performed and compared. These studies revealed that the charge state of thallium in the Cu 0.5 Tl 0.5 Ba 2 O 4-δ charge reservoir layer in Zn doped samples is Tl 1+ , while it is a mix of Tl 1+ and Tl 2+ in Zn free samples. The binding energy of Ba atoms in the Zn doped samples is shifted to higher energy, which when considered along with the presence of Tl 1+ suggested that it more efficiently directed the carriers to ZnO 2 and CuO 2 planes. The evidence of improved inter-plane coupling witnessed in X-ray diffraction is also confirmed by XPS measurements of Ca atoms in the Zn doped samples. The shift of the valance band spectrum in these Zn doped samples to higher energies suggested that the electrons at the top edge of the valance band were tied to a higher binding energy (relative to samples without Zn doping), which most likely resulted in a much lower energy state of the system in the superconducting state. The stronger superconducting state arising out of these effects is witnessed in the form of increased T c (R 0), J c and the extent of diamagnetism in the final compound

  5. 40 CFR 265.90 - Applicability.

    Science.gov (United States)

    2010-07-01

    ..., evapotranspiration, runoff, and infiltration; and (ii) Unsaturated zone characteristics (i.e., geologic materials... properties, and rate of ground-water flow); and (ii) The proximity of the facility to water supply wells or... defined in 40 CFR 264.90), with alternative requirements developed for groundwater monitoring set out in...

  6. 43 CFR 26.5 - Administrative requirements.

    Science.gov (United States)

    2010-10-01

    ..., disadvantaged, non-public school youth, and youth having left school before graduation; (2) That selections will... State minimum hourly wage (whichever is higher) should be multiplied by 30 hours per week, or 75 percent...

  7. 46 CFR 28.265 - Emergency instructions.

    Science.gov (United States)

    2010-10-01

    ... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY UNINSPECTED VESSELS REQUIREMENTS FOR COMMERCIAL FISHING... appropriate for the vessel: (1) The survival craft embarkation stations aboard the vessel and the survival craft to which each individual is assigned; (2) The fire and emergency signal and the abandon ship...

  8. 40 CFR 265.72 - Manifest discrepancies.

    Science.gov (United States)

    2010-07-01

    ... another facility that can manage the waste. If it is impossible to locate an alternative facility that can... must send the waste to the alternative facility or to the generator within 60 days of the rejection or... delivering transporter retains custody of the waste, or the facility must provide for secure, temporary...

  9. Publications | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    India mainstreams medicinal plants. A new Indian government program to bring medicinal plants into the country's medical and livelihood mainstreams should put money into the pockets of the villagers who collect them, while making the plants safer to use. The effort.

  10. Publications | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Like urban centres all across Africa, the population of metropolitan Dakar in Senegal has mushroomed over the past three decades. As more and more people crowd into the city — an... Medicinal plant potential and profits in Latin America. Panama's Darién National Park is the largest national park in Central America and a ...

  11. 40 CFR 265.1064 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... incinerator, flare, boiler, process heater, condenser, or carbon adsorption system, monitoring and inspection... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND... the hazardous waste stream or the process by which it was produced is used. If the owner or operator...

  12. 40 CFR 265.403 - Inspections.

    Science.gov (United States)

    2010-07-01

    ...., pressure and temperature gauges), at least once each operating day, to ensure that the treatment process or equipment is being operated according to its design; (3) The construction materials of the treatment process... systems, by-pass systems, drainage systems, and pressure relief systems) at least once each operating day...

  13. 21 CFR 558.265 - Halofuginone hydrobromide.

    Science.gov (United States)

    2010-04-01

    ...) Indications for use. For the prevention of coccidiosis caused by Eimeria tenella, E. necatrix, E. acervulina... bambermycins 1 to 2 grams. (A) Indications for use. For the prevention of coccidiosis caused by Eimeria tenella...) plus virginiamycin 5 grams. (A) Indications for use. For the prevention of coccidiosis caused by...

  14. 40 CFR 265.440 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... water run-off to an associated collection system. Existing drip pads are those constructed before... inside or under a structure that provides protection from precipitation so that neither run-off nor run... contingency plan that describes how the owner or operator will respond immediately to the discharge of such...

  15. 29 CFR 1910.265 - Sawmills.

    Science.gov (United States)

    2010-07-01

    ... tramways and trestles shall have a vertical clearance of 22 feet over railroad rails. When constructed over... caving in. (f) Artificial log ponds shall be drained, cleaned, and refilled when unhealthy stagnation or... stops or hangers to prevent saws from dropping on table. (5) Edgers—(i) Location. (a) Where vertical...

  16. 40 CFR 265.1085 - Standards: Tanks.

    Science.gov (United States)

    2010-07-01

    ... wells, and stub drains. (C) Each penetration of the internal floating roof for the purpose of sampling... that one end extends into the liquid in the tank and the other end extends a vertical distance of at..., rim space vents, roof drains, and leg sleeves, each opening in the roof shall be equipped with a...

  17. 265 Statistical Consulting and the African Universities

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... supervisor's understanding of statistics, self presentation of analysis, etc. Each part gives rise to specific issues and requires that the consultant have various non-statistical skills to deal with these issues. Statistical consulting as been part of the curriculum of advanced countries' universities for more than ...

  18. 40 CFR 265.1100 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... of personnel and handling equipment within the unit; (c) If the unit is used to manage liquids, has... this subpart. The owner or operator is not subject to the definition of land disposal in RCRA section... designed and constructed of manmade materials of sufficient strength and thickness to support themselves...

  19. 40 CFR 265.1081 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... captured vapors through a closed-vent system to a control device. External floating roof means a pontoon... light material service means the container is used to manage a material for which both of the following.... Internal floating roof means a cover that rests or floats on the material surface (but not necessarily in...

  20. 40 CFR 265.1087 - Standards: Containers.

    Science.gov (United States)

    2010-07-01

    ... container that meets the applicable U.S. Department of Transportation (DOT) regulations on packaging... integral part of the container structural design (e.g., a “portable tank” or bulk cargo container equipped... Transportation (DOT) regulations on packaging hazardous materials for transportation as specified in paragraph (f...

  1. 40 CFR 265.1030 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... to process vents associated with distillation, fractionation, thin-film evaporation, solvent extraction, or air or steam stripping operations that manage hazardous wastes with organic concentrations of...

  2. 40 CFR 265.1050 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 52.2454. (g) Purged coatings and solvents from surface coating operations subject to the national emission standards for hazardous air pollutants (NESHAP) for the surface coating of automobiles and light...) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL...

  3. 265-IJBCS-Article-Dr Campell Akujobi

    African Journals Online (AJOL)

    Dr Gatsing

    2009 International Formulae Group. All rights reserved. Short Communication http://indexmedicus.afro.who.int. Asymptomatic bacteriuria in pregnant women at the .... Urinary tract infection among pregnant women in Al-Mukalla district, Yemen. East Mediterr. Health J.,. 11: 505-510. Aziz MK, Salik K, Habibullah K, Bushra A,.

  4. 10 CFR 26.5 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... than expected for human urine. Directing means the exercise of control over a work activity by an... divergent that they are not consistent with normal human physiology. Subversion and subvert the testing... the exercise of control over a work activity by an individual who is not directly involved in the...

  5. 40 CFR 265.195 - Inspections.

    Science.gov (United States)

    2010-07-01

    ... gauges, monitoring wells) to ensure that the tank system is being operated according to its design. Note..., Partially Buried, or Submerged Liquid Storage Systems,” and the American Petroleum Institute (API...

  6. Publications | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Conserving biodiversity, supporting livelihoods in Panama's rainforest. Where Central and South America come together, grows a rainforest that is one of the richest ecological regions of tropical America. The Indigenous peoples who live there depend on this forest for food, medicine, building materials and.

  7. Sinterability and conductivity of barium doped aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} electrolyte of solid oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Cao Xiaoguo [Faculty of Materials and Energy, Guangdong University of Technology, Guangzhou 510006, Guangdong (China); Jiang Sanping, E-mail: s.jiang@curtin.edu.au [Fuels and Energy Technology Institute and Department of Chemical Engineering, Curtin University, Perth, WA 6102 (Australia)

    2012-05-15

    Highlights: Black-Right-Pointing-Pointer Ba doping enhances the sintering and densification properties of aluminium lanthanum apatite. Black-Right-Pointing-Pointer Ba doping improves the oxide conductivity of aluminium lanthanum apatite. Black-Right-Pointing-Pointer The enhancement of Ba doping is mainly due to the significantly reduced grain boundary resistance of the aluminium lanthanum apatite. - Abstract: Apatite ceramics are interesting alternative solid oxide fuel cells (SOFCs) electrolytes because of their open structure for the transportation of oxide ions and their good chemical stability. This study reports the influence of barium doping on the microstructure, sinterability and oxide conductivity properties of the aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5}. SEM results show that lanthanum substitution with barium improves the sinterability of apatite ceramics. The barium doping also enhances the conductivity of the aluminium lanthanum silicates. The oxygen ion conductivity of La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} sintered at 1600 Degree-Sign C is 2.21 Multiplication-Sign 10{sup -2} S cm{sup -1} at 800 Degree-Sign C, higher than 9.81 Multiplication-Sign 10{sup -3} S cm{sup -1} of La{sub 10}Si{sub 5}AlO{sub 26.5} sample prepared under the same conditions. The results in the present study demonstrate that doping Ba on the La site for aluminium lanthanum oxyapatite reduces the sintering temperature and improves the ion conductivity. The enhancement of Ba dopant is mainly on the improvement of the densification and thus substantially reduced grain boundary resistance of aluminium lanthanum oxyapatite particularly at low temperatures.

  8. Mitotic effects of monochromatic ultraviolet radiation at 225, 265, and 280 nm on eleven stages of the cell cycle of the grasshopper neuroblast in culture. II. Changes in progression rate and cell sequence between the stage irradiated and nuclear membrane breakdown

    International Nuclear Information System (INIS)

    Carlson, J.G.

    1976-01-01

    Portions of embryos of the grasshopper, Chortophaga viridifasciata (DeGeer), were cultured in hanging drops under quartz cover slips. Immediately after exposure to 225, 265, or 280 nm radiation, microscope observations at 38 0 C were begun. The morphologically identified stage and the time after treatment of selected neuroblasts were recorded at short-time intervals until prometaphase was reached. Mitotic retardation induced by irradiation of prereplication stages (metaphase, anaphase, or early telophase) or S phase (middle or late telophase, interphase, or very early prophase) is greatest in postreplication stages (early, middle, and late prophase) and absent or minimal in stages morphologically identified as parts of S phase. Ultraviolet irradiation superimposes on the normal diversity of progression rates an additional variation factor, so that cells do not necessarily reach prometaphase in the order of their sequence at the time of treatment. This suggests the need for caution in ascribing particular radiosensitivities to substages of limited duration on the basis of the order in which they attain a subsequent stage

  9. 40 CFR 265.1063 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ... Method 21 in 40 CFR part 60. (2) The detection instrument shall meet the performance criteria of Reference Method 21. (3) The instrument shall be calibrated before use on each day of its use by the... background level shall be determined, as set forth in Reference Method 21. (3) The instrument probe shall be...

  10. 40 CFR 265.1034 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    .... In the event that a sample is accidentally lost or conditions occur in which one of the three runs... pipe or other closed system that is used to transfer the waste after generation to the first affected...

  11. 40 CFR 265.1086 - Standards: Surface impoundments.

    Science.gov (United States)

    2010-07-01

    ... materials of construction and designing the cover and closure devices shall include: Organic vapor... closure device in the closed position, as applicable. (B) To remove accumulated sludge or other residues... construction and designing the cover and closure devices shall include: Organic vapor permeability; the effects...

  12. 40 CFR 265.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT... 24 hours, or at the earliest practicable time if the existing detection technology or site conditions... collected material is discharged through a point source to waters of the United States, it is subject to the...

  13. 39 CFR 265.6 - Availability of records.

    Science.gov (United States)

    2010-07-01

    ... disapprove a proposed closing or consolidation, all advisory opinions concerning the private express statutes... adjudication of cases, Postal Service policy statements which may be relied on as precedents in the disposition... or financial information, obtained from any person. (3) Information of a commercial nature, including...

  14. 40 CFR 265.1 - Purpose, scope, and applicability.

    Science.gov (United States)

    2010-07-01

    ... establish minimum national standards that define the acceptable management of hazardous waste during the... municipal or industrial solid waste, if the only hazardous waste the facility treats, stores, or disposes of... (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND...

  15. All projects related to | Page 265 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: India, Central Asia, Far East Asia, South Asia ... Project. The mangrove ecosystem of Tumbes plays a pivotal role in providing protection against tides, winds and storm surges, and habitat for a number of fish species. ... Multi-donor Research Platform on Social Protection, Financial Inclusion and ICTs. Project.

  16. 40 CFR 265.19 - Construction quality assurance program.

    Science.gov (United States)

    2010-07-01

    ...) Geomembranes (flexible membrane liners); (v) Leachate collection and removal systems and leak detection systems... specifications and good engineering practices, and proper installation of all components (e.g., pipes) according...

  17. 31 CFR 26.5 - Upgrades and additional environmental information.

    Science.gov (United States)

    2010-07-01

    ... determine that a project would have a significant impact on the human environment, but that the level of... that: (i) A MDB project would have a significant impact on the human environment, and (ii) The MDB... than a full-fledged environmental impact assessment as defined by that MDB's own procedures, the...

  18. SU-E-T-265: Presage Thin Sheet Dosimeter Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Dumas, M; Rakowski, J [Wayne State University/Karmanos Cancer Institute, Detroit, MI (United States)

    2014-06-01

    Purpose: To quantify the sensitivity and stability of the Presage dosimeter in sheet form for different concentrations of chemicals and for a diverse range of clinical photon energies. Methods: Presage polymer dosimeters are formulated to investigate and optimize their sensitivity and stability. The dosimeter is composed of clear polyurethane base, leucomalachite green reporting dye, and bromoform radical initiator in 1mm thick sheets. The chemicals are well mixed together, cast in an aluminum mold, and left to cure at 60 psi for a minimum of 2 days. Dosimeter response will be characterized at multiple energies including Co-60, 6 MV, 15 MV, 50 kVp, and 250 kVp. The dosimeters are read by an Epson 10000 XL scanner at 800 dpi, 2{sup 16} bit depth. Red component images are analyzed with ImageJ. Results: Analysis of optical density verse dose for Co-60 energies indicates that the bromoform containing Presage was able to quantify dose from 0 to 300 Gy, with saturation beyond 300 Gy. Initial results show two regions of linear response, 0–100 Gy and 150–300 Gy. The 150–300 Gy region has a sensitivity of 0.0024 net OD/Gy. Further results on other energies are still in progress. Conclusions: This work shows the potential for use of thin sheets of Presage dosimeter as a dosimeter capable of being analyzed with a flatbed scanner.

  19. 40 CFR 265.301 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... migration of any hazardous constituent into ground water or surface water at any future time. (e) In the... and with guidance documents governing liners and leachate collection systems under paragraph (a) of...

  20. 40 CFR 265.221 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... there will be no migration of any hazardous constituent into ground water or surface water at any future... (a) of this section and with guidance documents governing liners and leachate collection systems...

  1. 45 CFR 265.1 - What does this part cover?

    Science.gov (United States)

    2010-10-01

    ... oversight responsibilities. (b) This part describes the information in the quarterly and annual reports that... quarterly Data Report, the quarterly Financial Report, and the Annual Report on State MOE Programs, as well... Caseload Reduction Report described at § 261.41(b) of this chapter. (1) The case record information...

  2. 40 CFR 265.443 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ..., climatic conditions, the stress of installation, and the stress of daily operations, e.g., variable and... pad leakage to which they are exposed, climatic conditions, the stress of installation, and the stress... or operator must design, construct, operate and maintain a run-on control system capable of...

  3. 40 CFR 265.1101 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... prevent the migration of hazardous constituents into the barrier (e.g. a geomembrane covered by a concrete... prevent migration of hazardous constituents into the barrier, and a leak detection system that is capable... unit. (2) Obtain and keep on-site a certification by a qualified Professional Engineer that the...

  4. 40 CFR 265.93 - Preparation, evaluation, and response.

    Science.gov (United States)

    2010-07-01

    ...) The rate and extent of migration of hazardous waste or hazardous waste constituents in the ground... outline required under paragraph (a) of this section and certified by a qualified geologist or... this section, and, at a minimum, determine: (i) The rate and extent of migration of the hazardous waste...

  5. 40 CFR 265.1201 - Design and operating standards.

    Science.gov (United States)

    2010-07-01

    ... as designed and that releases that may adversely impact human health or the environment are not... products, or contaminated run-off, to the soil, ground water, surface water, and atmosphere; (2) Provide a...

  6. 1935 15' Quad #265 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  7. 33 CFR 104.265 - Security measures for access control.

    Science.gov (United States)

    2010-07-01

    ... prohibition to be applied and the means of enforcing them; (3) The means used to establish the identity of... individual's claim of loss or theft. (3) If an individual cannot present his or her TWIC for any other reason... carry-on items), personal effects, and vehicles for dangerous substances and devices at the rate...

  8. 40 CFR 265.1032 - Standards: Process vents.

    Science.gov (United States)

    2010-07-01

    ... owner or operator of a fa-cil-ity with process vents associated with distillation, fractionation, thin-film evaporation, solvent extraction or -air or steam stripping operations man-aging haz-ard-ous wastes...

  9. 40 CFR 265.92 - Sampling and analysis.

    Science.gov (United States)

    2010-07-01

    ... characterizing the suitability of the ground water as a drinking water supply, as specified in appendix III. (2...-water contamination: (i) pH (ii) Specific Conductance (iii) Total Organic Carbon (iv) Total Organic... ground-water contamination must be obtained and analyzed for the parameters specified in paragraph (b)(3...

  10. 7 CFR 2.65 - Administrator, Agricultural Research Service.

    Science.gov (United States)

    2010-01-01

    ...) Provide national leadership and support for research programs and other research activities in the food... Science Award for research or advanced studies in the food and agricultural sciences (7 U.S.C. 3153). (21... goods or services in support of research, extension, or teaching activities in the food and agricultural...

  11. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... This trend is maintained when abasic sites in DNA oligomers are exposed to fibroblast cell extracts in the presence of the extract. While DNA conformational alteration is negligible, APE1 enzyme shows characteristic changes in the alpha helix and beta strand ratio after incubation with G. lucidum extract.

  12. 12038_2016_9614_Article_print 265..275

    Indian Academy of Sciences (India)

    2016-05-13

    s12038-016-9614-0. 1. Introduction. Ganoderma lucidum (GL) is a fungus that belongs to the class basidiomycetes and polyporaceae family (Russell and Paterson. 2006). This mushroom is quite well known from ancient times.

  13. 39 CFR 265.9 - Schedule of fees.

    Science.gov (United States)

    2010-07-01

    ... commencing work on the request. (ii) When a requester has previously failed to pay a fee in a timely fashion... research the results of which are not intended to promote any particular product or industry. (8... make their products available for purchase or subscription by the general public. These examples are...

  14. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian

    2013-01-01

    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py......CSP simulator is able to simulate 220 Monte Carlo simulations in less than 35 seconds in the smallest BPU simulation....

  15. PRODUKSI ETANOL DARI TETES TEBU OLEH Saccharomyces cerevisiae PEMBENTUK FLOK (NRRL – Y 265 (Ethanol Production from Cane Molasses by Flocculant Saccharomyces cerevisiae (NRRL – Y 265

    Directory of Open Access Journals (Sweden)

    Agustin Krisna Wardani

    2013-08-01

    Full Text Available The potential use of sugar cane molasses by flocculant Saccharomyces cerevisiae in ethanol production was investigated. In order to minimize the negative effect of calcium on yeast growth, pretreated sugar cane molasses with dilute acid was performed. The influence of process parameters such as sugar concentration and inoculum concentration were evaluated for enhancing bioethanol production. Result showed that maximum ethanol concentration of 8,792% (b/v was obtained at the best condition of inoculum concentration 10% (v/v and sugar concentration 15% (b/v. Based on the experimental data, maximum yield of ethanol production of 65% was obtained. This result demonstrated the potential of molasses as promising biomass resources for ethanol production. Keywords: Ethanol, preteated cane molasses, flocculant Saccharomyces cerevisiae, fermentation   ABSTRAK Efisiensi produksi bioetanol diperoleh melalui ketepatan pemilihan jenis mikroorganisme, bahan baku, dan kontrol proses fermentasi. Alternatif proses untuk meminimalisasi biaya produksi etanol adalah dengan mengeliminasi tahap pemisahan sentrifugasi sel dari produk karena memerlukan biaya instalasi dan biaya perawatan yang tinggi. Proses sentrifugasi merupakan tahapan penting untuk memisahkan sel mikroba dari medium fermentasi pada produksi bioetanol. Untuk meminimalisir biaya produksi akibat proses tersebut digunakan inokulum Saccharomyces cerevisiae pembentuk flok dan tetes tebu sebagai sumber gula. Penelitian ini bertujuan untuk mendapatkan konsentrasi penambahan inokulum Saccharomyces cerevisiae pembentuk flok dan konsentrasi sumber gula dalam tetes tebu yang tepat dalam produksi etanol yang maksimum. Saccharomyces cerevisiae sebanyak 5%, 10%, dan 15% (v/v diinokulasikan pada medium tetes tebu hasil pretreatment dengan kandungan gula 15%, 20%, dan 25% (b/v pada pH 5. Fermentasi dilakukan pada suhu 30°C dan agitasi 100 rpm selama 72 jam. Etanol tertinggi didapat pada kondisi konsentrasi inokulum 10% (v/v dan konsentrasi sumber gula 15% (b/v yaitu sebesar 8, 792% (b/v dengan yield etanol sebesar 65%. Kata kunci: Etanol, tetes tebu, Saccharomyces cerevisiae pembentuk flok, fermentasi

  16. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...... in the cases where we were not able to gain any performance boost by specialization, the added cost, for kernel generation and extra bookkeeping, is minimal. Many of the lessons learned developing and optimizing the Bohrium GPU vector engine has proven to be valuable in a broader perspective, which has made...

  17. 265. Afectación del bazo en la endocarditis infecciosa: Un enemigo silencioso

    Directory of Open Access Journals (Sweden)

    E. Quintana

    2012-04-01

    Conclusiones: Debe sospecharse absceso esplénico en los pacientes con endocarditis, fiebre y dolor abdominal. La esplenectomía y la intervención valvular pueden realizarse en el mismo acto dependiendo de la condición del paciente.

  18. Structural health monitoring of wind turbine blades : SE 265 Final Project.

    Energy Technology Data Exchange (ETDEWEB)

    Barkley, W. C.(Walter C.); Jacobs, Laura D.; Rutherford, A. C.(Amanda C.); Puckett, Anthony

    2006-03-23

    ACME Wind Turbine Corporation has contacted our dynamic analysis firm regarding structural health monitoring of their wind turbine blades. ACME has had several failures in previous years. Examples are shown in Figure 1. These failures have resulted in economic loss for the company due to down time of the turbines (lost revenue) and repair costs. Blade failures can occur in several modes, which may depend on the type of construction and load history. Cracking and delamination are some typical modes of blade failure. ACME warranties its turbines and wishes to decrease the number of blade failures they have to repair and replace. The company wishes to implement a real time structural health monitoring system in order to better understand when blade replacement is necessary. Because of warranty costs incurred to date, ACME is interested in either changing the warranty period for the blades in question or predicting imminent failure before it occurs. ACME's current practice is to increase the number of physical inspections when blades are approaching the end of their fatigue lives. Implementation of an in situ monitoring system would eliminate or greatly reduce the need for such physical inspections. Another benefit of such a monitoring system is that the life of any given component could be extended since real conditions would be monitored. The SHM system designed for ACME must be able to operate while the wind turbine is in service. This means that wireless communication options will likely be implemented. Because blade failures occur due to cyclic stresses in the blade material, the sensing system will focus on monitoring strain at various points.

  19. 12 CFR 265.7 - Functions delegated to Director of Division of Banking Supervision and Regulation.

    Science.gov (United States)

    2010-01-01

    ... corporate reorganization or an internal transfer of funds, subject to any conditions and terms the Director... strength; (ii) The investor's investment strategy is not unsafe or unsound; (iii) Granting such authority...

  20. STUDIO DI UN MOVIMENTO SISMOCO DEL BASSO TIRRENO,ORIGINANTE ALLA PROFONDITA' DI 265 KM.

    Directory of Open Access Journals (Sweden)

    ANTONINO GIRLANDA

    1956-06-01

    Full Text Available Gli studi microsismici condotti sul terremoto delle
    isole Lipari del 13 aprile 1938, sebbene siano concordi nell'attribuire
    all'ipocentro una profondità di circa 300 km, valore eccezionale e fino
    allora insospettato nella zona del Mediterraneo centro-occidentale (1,
    hanno condotto a risultati discordanti in relazione alla velocità di
    propagazione delle onde sismiche in corrispondenza del basso Tirreno.
    Le determinazioni delle coordinate spazio-temporali, eseguite dai vari
    Centri sismologici e da diversi autori, conducono a risultati assai discordanti.
    Le determinazioni del B.C.I.S., della J.S.A., di Pasadena,
    e, in modo particolare, una seconda determinazione di Demetrescu,
    condotta sui dati di 45 stazioni, portano a conclusioni che contrastano
    nettamente con i dati forniti dalle stazioni più vicine all'epicentro.
    Secondo gli ultimi risultati di Demetrescu, tali stazioni avrebbero
    registrato l'onda P con un anticipo eccezionale, anticipo che risulterebbe
    di 12s per Trenta e Pompei, di l l s per Taranto e Bari, di 9S per
    Napoli.

  1. : tous les projets | Page 265 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 30 mars 2017. Région: South Asia, North of Sahara, South of Sahara, Central Asia, Far East Asia, North and Central America, South America. Programme: Maternal and Child Health. Financement total : CA$ 1,627,640.00. Équité en matière de santé et de financement de la santé - création et renforcement de ...

  2. 77 FR 58354 - Foreign-Trade Zone 265-Conroe, TX; Notification of Proposed Production Activity, Bauer...

    Science.gov (United States)

    2012-09-20

    ..., diesel engines and related parts, hydraulic engines/motors, pumps, compressors, turbochargers, air..., wiring harnesses, magnets, batteries, lighting equipment, reception devices, horns, cameras/video...

  3. 40 CFR 265 interim-status ground-water monitoring plan for the 2101-M pond

    International Nuclear Information System (INIS)

    Chamness, M.A.; Luttrell, S.P.; Dudziak, S.

    1989-03-01

    This report outlines a ground-water monitoring plan for the 2101-M pond, located in the southwestern part of the 200-East Area on the Hanford Site in south-central Washington State. It has been determined that hazardous materials may have been discharged to the pond. Installation of an interim-status ground-water monitoring system is required under the Resource Conservation and Recovery Act to determine if hazardous chemicals are moving out of the pond. This plan describes the location of new wells for the monitoring system, how the wells are to be completed, the data to be collected, and how those data can be used to determine the source and extent of any ground-water contamination from the 2101-M pond. Four new wells are planned, one upgradient and three downgradient. 35 refs., 12 figs., 9 tabs

  4. 40 CFR 265.314 - Special requirements for bulk and containerized liquids.

    Science.gov (United States)

    2010-07-01

    ... (volcanic glass); expanded volcanic rock; volcanic ash; cement kiln dust; fly ash; rice hull ash; activated... density polyethylene (HDPE), polypropylene, polystyrene, polyurethane, polyacrylate, polynorborene...

  5. 49 CFR 26.5 - What do the terms used in this part mean?

    Science.gov (United States)

    2010-10-01

    ... Spanish or Portuguese culture or origin, regardless of race; (iii) “Native Americans,” which includes persons who are American Indians, Eskimos, Aleuts, or Native Hawaiians; (iv) “Asian-Pacific Americans...; (v) “Subcontinent Asian Americans,” which includes persons whose origins are from India, Pakistan...

  6. 40 CFR 265.1088 - Standards: Closed-vent systems and control devices.

    Science.gov (United States)

    2010-07-01

    ... 266, subpart H; or (E) A boiler or industrial furnace burning hazardous waste for which the owner or... (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE... waste in the waste management unit to a control device that meets the requirements specified in...

  7. 12 CFR 265.11 - Functions delegated to Federal Reserve Banks.

    Science.gov (United States)

    2010-01-01

    ... member bank's total investment, including the retained earnings of the Edge and agreement corporation... for which the Reserve Bank is reponsible for receiving applications or registration statements or to... registration statement. To extend the time within which a bank holding company must file a registration...

  8. 40 CFR Appendix III to Part 265 - EPA Interim Primary Drinking Water Standards

    Science.gov (United States)

    2010-07-01

    ... Fluoride 1.4-2.4 Lead 0.05 Mercury 0.002 Nitrate (as N) 10 Selenium 0.01 Silver 0.05 Endrin 0.0002 Lindane 0.004 Methoxychlor 0.1 Toxaphene 0.005 2,4-D 0.1 2,4,5-TP Silver 0.01 Radium 5 pCi/1 Gross Alpha 15 pCi/1 Gross Beta 4 millirem/yr Turbidity 1/TU Coliform Bacteria 1/100 ml ...

  9. 39 CFR 265.8 - Business information; procedures for predisclosure notification to submitters.

    Science.gov (United States)

    2010-07-01

    ... containing the business information. In the case of an administrative appeal, the General Counsel shall be... the time of its submission. (1) Submitters of business information shall use good-faith efforts to... 39 Postal Service 1 2010-07-01 2010-07-01 false Business information; procedures for predisclosure...

  10. The Class of 2010: Economic Prospects for Young Adults in the Recession. EPI Briefing Paper #265

    Science.gov (United States)

    Bivens, Josh; Edwards, Kathryn Anne; Hertel-Fernandez, Alexander; Turner, Anna

    2010-01-01

    It will take years for the labor market to recover from the damage induced by the recent recession. While monthly job losses almost surely peaked in 2009, the unemployment rate will likely peak in 2010 (CBO 2010a). In April, the unemployment rate reached 9.9% and the overall economic cause is simple: firms are not hiring quickly enough, as…

  11. Course of illness in a sample of 265 patients with first-episode psychosis

    DEFF Research Database (Denmark)

    Bertelsen, Mette; Jeppesen, Pia; Petersen, Lone

    2009-01-01

    There is an ongoing debate as to whether psychosis is a progressively deteriorating illness or one of progressive amelioration. This paper aims at investigating the rate of recovery and institutionalization and predicting a continuous illness course in a descriptive prospective study of a sub...

  12. Far-infrared spectrophotometry of SN 1987A - Days 265 and 267

    Science.gov (United States)

    Moseley, S. H.; Dwek, E.; Silverberg, R. F.; Glaccum, W.; Graham, J. R.; Loewenstein, R. F.

    1989-01-01

    The paper presents 16-66-micron spectra of SN 1987A taken on days 266 and 268 after core collapse. The spectrum consists of a nearly flat continuum, strong emission lines of hydrogen, and fine-structure lines of Fe II, Fe III, Co II, S I, and possibly Fe I, Ni II, and S III. From the relative strength of three lines which arise from transitions within the ground and excited states of Fe II, the temperature and a lower limit on the density of the line-emitting region are derived. From the line strengths, the abundances of Fe and S I, the end products of explosive nucleosynthesis in the supernova are estimated. An upper limit is also set to the amount of Co II remaining in the mantle. The low measured mass of Fe suggests that the ejecta are clumpy. The flat continuum is most likely free-free emission from the expanding supernova ejecta. About 35 percent of this emission arises from the ionized metals in the mantle; the rest arises from ionized hydrogen. At the time of these observations, there is no evidence for any emission from dust that may have formed in the supernova ejecta or from preexisting dust in the surrounding medium.

  13. 40 CFR 265.141 - Definitions of terms as used in this subpart.

    Science.gov (United States)

    2010-07-01

    ... cash or sold or consumed during the normal operating cycle of the business. Current liabilities means... nature. (h) Substantial business relationship means the extent of a business relationship necessary under.... A “substantial business relationship” must arise from a pattern of recent or ongoing business...

  14. 39 CFR 265.12 - Demands for testimony or records in certain legal proceedings.

    Science.gov (United States)

    2010-07-01

    ... section does not create any right or benefit, substantive or procedural, enforceable by any person against... District Manager, Customer Services and Sales, for all current employees whose work location is within the... employee whose testimony is requested and the appropriate District Manager, Customer Services and Sales, at...

  15. Decree 2006-265/PRN of 18 August 2006 fixing the modalities of mining law application

    International Nuclear Information System (INIS)

    2006-01-01

    This decree fixes modalities of applying ordinance 93-16 of 2 march 1993 concerning mining law in Niger Republic and its subsequent modified text. Any petitioner, owner of mining title, prospecting authorization, opening and mining quarry, sub-leaser shall have an office in Niger Republic and notify it to the Minister of Mines and energy. each licence or lease is based on an agreement between the government and the society. Any change of status, capital or personnel of the company shall be noted to the Minister of Mines and energy. The company shall pay fiscal duties and respect rules and regulations concerning mines and quarries health and safety [fr

  16. Course of illness in a sample of 265 patients with first-episode psychosis

    DEFF Research Database (Denmark)

    Bertelsen, Mette; Jeppesen, Pia; Petersen, Lone

    2009-01-01

    There is an ongoing debate as to whether psychosis is a progressively deteriorating illness or one of progressive amelioration. This paper aims at investigating the rate of recovery and institutionalization and predicting a continuous illness course in a descriptive prospective study of a sub-sample...

  17. Nuclear Technology. Course 26: Nondestructive Examination (NDE) Techniques I. Module 26-5, Fundamentals of Radiography.

    Science.gov (United States)

    Groseclose, Richard

    This fifth in a series of seven modules for a course titled Nondestructive Examination (NDE) Techniques I explains the radiographic process, from radiation source selection to equipment and specimen selection and arrangement, and film processing. The module follows a typical format that includes the following sections: (1) introduction, (2) module…

  18. 40 CFR 265.192 - Design and installation of new tank systems or components.

    Science.gov (United States)

    2010-07-01

    ... tank system is or will be in contact with the soil or with water, a determination by a corrosion expert of: (i) Factors affecting the potential for corrosion, including but not limited to: (A) Soil moisture content; (B) Soil pH; (C) Soil sulfides level; (D) Soil resistivity; (E) Structure to soil...

  19. 40 CFR 265.1033 - Standards: Closed-vent systems and control devices.

    Science.gov (United States)

    2010-07-01

    ... carbon at a regular, pre-de-termined time interval that is no longer than the carbon service life... condenser or adsorber) shall be designed and operated to recover the organic vapors vented to it with an... enclosed combustion device (e.g., a vapor incinerator, boiler, or process heater) shall be designed and...

  20. 75 FR 67663 - Labeling Imported Wines With Multistate Appellations (2008R-265P)

    Science.gov (United States)

    2010-11-03

    ...'' resulting in ``more accurate information being provided to consumers about wine origin.'' According to T.D...-2010-0007; Notice No. 110] RIN 1513-AB58 Labeling Imported Wines With Multistate Appellations (2008R.... SUMMARY: The Alcohol and Tobacco Tax and Trade Bureau proposes to amend the wine labeling regulations to...

  1. 12 CFR 265.5 - Functions delegated to Secretary of the Board.

    Science.gov (United States)

    2010-01-01

    ... Service Corporation Act (12 U.S.C. 1865(a), (b), 1867(d)); the Change in Bank Control Act (12 U.S.C. 1817... treatment of information in Board records under the Freedom of Information Act (5 U.S.C. 552) and under the Board's Rules Regarding Availability of Information (12 CFR part 261). (2) Annual reports on Privacy Act...

  2. 40 CFR 265.17 - General requirements for ignitable, reactive, or incompatible wastes.

    Science.gov (United States)

    2010-07-01

    ..., smoking, cutting and welding, hot surfaces, frictional heat, sparks (static, electrical, or mechanical..., dusts, or gases in sufficient quantities to threaten human health; (3) Produce uncontrolled flammable... health or the environment. ...

  3. 39 CFR 265.11 - Compliance with subpoena duces tecum, court orders, and summonses.

    Science.gov (United States)

    2010-07-01

    ... release medical information, in response to proper requests and upon competent medical advice, in... medical records are primarily under the exclusive jurisdiction of the U.S. Civil Service Commission. The... any medical information about an employee to any non-Federal entity or individual without...

  4. 40 CFR Appendix V to Part 265 - Examples of Potentially Incompatible Waste

    Science.gov (United States)

    2010-07-01

    ... neutralizes them (e.g., a strong acid mixed with a strong base), or that controls substances produced (e.g... solvent Lime sludge and other corrosive alkalies Lime wastewater Pickling liquor and other corrosive acids...

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF. pp 101-102 Book Review. Fixed Points - From Russia with Love - A Primer of Fixed Point Theory · A K Vijaykumar · More Details Fulltext PDF. pp 102-103 Book Review. The Medusa and the Snail.

  6. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  7. Fulltext PDF

    Indian Academy of Sciences (India)

    64 Fulfilling Mendeleev's Dream. A G Samuelson. 67 Glenn Seaborg 1912-1999. Gregory J Butera. RESEARCH EWS. 91 Nobel Prize in Physiology or Medicine 1999. Utpal Tatu. 95 Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. BO K REV EWS. Fixed Points. From Russia with Love - A Primer of ...

  8. مقایسه تأثیر محلول کلوییدی نانونقره و بیوساید صنعتی E-265 بر تنفس و تشکیل بیوفیلم باکتریایی به‌روش میکروتیترپلیت

    Directory of Open Access Journals (Sweden)

    سمانه شاهرخ

    2013-03-01

    Full Text Available نانوذرات نقره به‌دلیل خواص ضد میکربی بی‌نظیر و سمّیت کم نسبت به سلول‌های پستانداران به یکی از رایج‌ترین نانوذرات در محصولات مصرفی تبدیل گشته‌اند. امروزه در زمینه تصفیه آب از نانوذرات به‌منظور تشخیص و حذف مواد بیولوژیکی و شیمیایی استفاده می‌شود. بنابراین به‌دنبال استفاده روز افزون از نانوذرات، لازم است که مطالعات بیشتری در ارتباط با اثرات این ذرات صورت گیرد. در این تحقیق اثرات ضد باکتریایی و ضد بیوفیلم محلول کلوییدی نانونقره (میانگین اندازه 10± 40 نانومتر به‌روش میکروتیترپلیت بر رشد، تنفس سلولی و تشکیل بیوفیلم سویه‌های پاتوژن و ایزوله‌های جداسازی شده (A1 و A2 از سیستم خنک کننده پالایشگاه نفت اصفهان با بیوساید E-265 ، مقایسه شد. نتایج نشان دادند که غلظتهای مختلف بیوساید E-265 اثر ضد باکتریایی معنی‌داری بر رشد باکتری‌های مورد مطالعه نداشت و حتی در غلظتهای ppm 20 و ppm 40 سبب افزایش صد درصدی تشکیل بیوفیلم در ایزوله A1 شد. همچنین مشخص شد که غلظتهای پایینی از نانونقره ppm 2-1، فعالیت ضد باکتریایی و ضد بیوفیلم بی‌نظیری نشان می‌دهند و بنابراین می‌توان آن را به‌عنوان یک بیوساید مناسب به‌منظور استفاده در سیستم‌های گردشی آب پیشنهاد نمود.

  9. 47 CFR 90.265 - Assignment and use of frequencies in the bands allocated for Federal use.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Standards for Special... Safety Pool or the Industrial/Business Pool, subject to the provisions of this section: Hydro Channels... operating on these frequencies shall not communicate with any station in the mobile service unless written...

  10. 40 CFR Appendix Vi to Part 265 - Compounds With Henry's Law Constant Less Than 0.1 Y/X

    Science.gov (United States)

    2010-07-01

    ... Diethanolamine 111-42-2 N,N-Diethylaniline 91-66-7 Diethylene glycol 111-46-6 Diethylene glycol dimethyl ether (dimethyl Carbitol) 111-96-6 Diethylene glycol monobutyl ether (butyl Carbitol) 112-34-5 Diethylene glycol monoethyl ether acetate (Carbitol acetate) 112-15-2 Diethylene glycol monoethyl ether (Carbitol Cellosolve...

  11. 45 CFR 265.7 - How will we determine if the State is meeting the quarterly reporting requirements?

    Science.gov (United States)

    2010-10-01

    ... TANF Data Report, the TANF Financial Report (or Territorial Financial Report), and the SSP-MOE Data... complete and accurate report” means that: (1) The reported data accurately reflect information available to..., “a complete and accurate report” means that: (1) The reported data accurately reflect information...

  12. 42 CFR 2.65 - Procedures and criteria for orders authorizing disclosure and use of records to criminally...

    Science.gov (United States)

    2010-10-01

    ... independent of counsel for an applicant who is a person performing a law enforcement function. (c) Review of... person conducting investigative or prosecutorial activities with respect to the enforcement of criminal laws. The application may be filed separately, as part of an application for a subpoena or other...

  13. 39 CFR 265.13 - Compliance with subpoenas, summonses, and court orders by postal employees within the Inspection...

    Science.gov (United States)

    2010-07-01

    ... capacities in proceedings that do not relate to the Postal Service (e.g., cases arising from traffic accidents, domestic relations) and do not involve professional or consultative services; and (6) When in the... determined by 28 U.S.C. 1821 or other applicable statute, the costs of providing testimony, including...

  14. 40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Bjornstad, B.N.; Dudziak, S.

    1989-03-01

    This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs.

  15. HLA class I-restricted MYD88 L265P-derived peptides as specific targets for lymphoma immunotherapy

    NARCIS (Netherlands)

    Nelde, A. (Annika); Walz, J.S. (Juliane Sarah); Kowalewski, D.J. (Daniel Johannes); Schuster, H. (Heiko); Wolz, O.-O. (Olaf-Oliver); Peper, J.K. (Janet Kerstin); Cardona Gloria, Y. (Yamel); A.W. Langerak (Anton); A.F. Muggen; Claus, R. (Rainer); Bonzheim, I. (Irina); F. Fend (Falko); Salih, H.R. (Helmut Rainer); Kanz, L. (Lothar); Rammensee, H.-G. (Hans-Georg); Stevanović, S. (Stefan); Weber, A.N.R. (Alexander N. R.)

    2017-01-01

    textabstractGenome sequencing has uncovered an array of recurring somatic mutations in different non-Hodgkin lymphoma (NHL) subtypes. If affecting protein-coding regions, such mutations may yield mutation-derived peptides that may be presented by HLA class I proteins and recognized by cytotoxic T

  16. Optimized adaptation algorithm for HEVC/H.265 dynamic adaptive streaming over HTTP using variable segment duration

    Science.gov (United States)

    Irondi, Iheanyi; Wang, Qi; Grecos, Christos

    2016-04-01

    Adaptive video streaming using HTTP has become popular in recent years for commercial video delivery. The recent MPEG-DASH standard allows interoperability and adaptability between servers and clients from different vendors. The delivery of the MPD (Media Presentation Description) files in DASH and the DASH client behaviours are beyond the scope of the DASH standard. However, the different adaptation algorithms employed by the clients do affect the overall performance of the system and users' QoE (Quality of Experience), hence the need for research in this field. Moreover, standard DASH delivery is based on fixed segments of the video. However, there is no standard segment duration for DASH where various fixed segment durations have been employed by different commercial solutions and researchers with their own individual merits. Most recently, the use of variable segment duration in DASH has emerged but only a few preliminary studies without practical implementation exist. In addition, such a technique requires a DASH client to be aware of segment duration variations, and this requirement and the corresponding implications on the DASH system design have not been investigated. This paper proposes a segment-duration-aware bandwidth estimation and next-segment selection adaptation strategy for DASH. Firstly, an MPD file extension scheme to support variable segment duration is proposed and implemented in a realistic hardware testbed. The scheme is tested on a DASH client, and the tests and analysis have led to an insight on the time to download next segment and the buffer behaviour when fetching and switching between segments of different playback durations. Issues like sustained buffering when switching between segments of different durations and slow response to changing network conditions are highlighted and investigated. An enhanced adaptation algorithm is then proposed to accurately estimate the bandwidth and precisely determine the time to download the next optimal segment considering the variable segment duration. Furthermore, objective metrics are employed to highlight the merits of the achieved compression efficiency using longer segment sizes for higher bitrate representations.

  17. 78 FR 79390 - Foreign-Trade Zone (FTZ) 265-Conroe, Texas, Notification of Proposed Production Activity, Bauer...

    Science.gov (United States)

    2013-12-30

    ... and in the existing scope of authority. Customs duties also could possibly be deferred or reduced on... regulations of the FTZ Board (15 CFR 400.22) was received on December 18, 2013. Bauer already has authority to... authority. Pursuant to 15 CFR 400.14(b), FTZ activity would be limited to the specific foreign-status...

  18. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels

    2016-01-01

    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  19. Corrigendum to "New constraints on kinetic isotope effects during CO2(aq) hydration and hydroxylation: Revisiting theoretical and experimental data" [Geochim. Cosmochim. Acta 214 (2017) 246-265

    Science.gov (United States)

    Sade, Ziv; Halevy, Itay

    2018-03-01

    The authors regret an error in the derivation of the link between KFFs and isotopic rate constants of CO2 hydration (Section 2.2). Considering the subset of isotopologues, C16O16O, C18O16O, H216O and H218O, there are four possible forward reactions: C16O16O + H216O → H2C16O16O16O,

  20. Effects of grain size and grain boundary segregation on fracture behaviour of a polycrystalline Fe-2.65Si-0.028P alloy

    Czech Academy of Sciences Publication Activity Database

    Janovec, J.; Lejček, Pavel; Pokluda, J.; Jenko, M.

    2006-01-01

    Roč. 44, - (2006), s. 81-87 ISSN 0023-432X R&D Projects: GA ČR(CZ) GA106/05/0134 Institutional research plan: CEZ:AV0Z10100520 Keywords : iron alloys * interface segregation * intergranular brittleness * Auger electron spectroscopy * scanning electron microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

  1. Body composition and dietary intake of adolescents from public schools in Blumenau (Brazil. DOI: 10.5007/1980-0037.2011v13n4p265

    Directory of Open Access Journals (Sweden)

    Graciella Chiarelli

    2011-06-01

    Full Text Available The objective of this study was to characterize the body composition and dietary intake of adolescents from public schools in Blumenau, Santa Catarina. A total of 268 students aged 12 to 16 years were selected by random non-probability sampling. Anthropometric measures including weight, height, waist circumference, and skinfold thickness were collected using pre-established protocols to estimate nutritional status and body composition. Dietary intake was evaluated using a food frequency questionnaire. Descriptive analysis, frequency analysis, and the Student t-test were used (p2493.5 kcal, with the distribution of macronutrients being in accordance with current recommendations. However, 84% of the adolescents consumed excess saturated fatty acids (>10% and 46% consumed excess cholesterol (>300. Comparison of dietary intake between genders showed a significant difference for protein (t=2.234, p<0.026, vitamin C (t=2.128; p<0.034, iron (t=2.654; p<0.008, and calcium (t=2.239; p<0.026. In conclusion, the results indicate the need to better understand and evaluate food intake in adolescents in order to develop intervention strategies.

  2. Bilateral renal metastasis of 261-265huerthle cell thyroid cancer with discordant uptake between I-131 sodium iodide and F-18 FDG

    Energy Technology Data Exchange (ETDEWEB)

    Claimon, Apichaya; Suh, Min Seok; Cheon, Gi Jeong; Lee, Dong Soo; Chung, June Key [Dept. of Nuclear Medicine, Seoul National University Hospital, Seoul (Korea, Republic of); Kim, E. Edmund [Dept. of Radiological Sciences, University of California, Irvine (United States)

    2017-09-15

    Renal metastasis of thyroid cancer is extremely rare. We report the case of a 62-year-old woman with Hürthle cell thyroid cancer (HCTC) with lungs, bones, and bilateral kidneys metastases. The renal metastatic lesions were clearly demonstrated by {sup 131}I whole body scan (WBS) with SPECT/CT. However, they exhibited false-negative results in {sup 18}F-FDG PET/CT, kidney ultrasonography, and contrast-enhanced CT scan. The findings imply that tumors have low glucose metabolism and are able to accumulate radioiodine, which is not commonly found in the relatively aggressive nature of HCTC. The patient received two sessions of 200 mCi {sup 131}I therapy within 6 months duration. There was complete treatment response as evaluated by the second post-therapeutic {sup 131}I SPECT/CT and serum thyroglobulin. To our knowledge, renal metastasis from HCTC with positive {sup 131}I but negative {sup 18}F-FDG uptake has not been reported in the literature. This case suggests that {sup 131}I SPECT/CT is useful for lesion localization and prediction of {sup 131}I therapy response.

  3. Course of illness in a sample of 265 patients with first-episode psychosis--five-year follow-up of the Danish OPUS trial

    DEFF Research Database (Denmark)

    Bertelsen, Mette; Jeppesen, Pia; Petersen, Lone

    2009-01-01

    There is an ongoing debate as to whether psychosis is a progressively deteriorating illness or one of progressive amelioration. This paper aims at investigating the rate of recovery and institutionalization and predicting a continuous illness course in a descriptive prospective study of a sub...

  4. [Biogeography, origin, and distribution of triatominae domiciliarity in Brazil. Revista de Saúde Pública, 14(3):265-99, 1980].

    Science.gov (United States)

    Forattini, Oswaldo Paulo

    2006-12-01

    An association is established between the Brazilian geographical pattern of the domiciliarity of the triatominae bugs and open lands characterized by natural savanna vegetation or artificial, man-made landscapes. The Brazilian open lands involved are the "caatingas'' and "cerrados", both wholly included in Brazilian territory, while the mixed Southern subtropical prairies belong to systems extending bevond national boundary lines. The other open lands are anthropic-lands opened mainly by the destruction of primitive forests of the tropical Atlantic system. Attempts were made to subject the four synanthropic species of epidemiological importance to model paleoecologic refuges and endemic centers. Triatoma sordida, Triatoma brasiliensis, and Triatoma pseudomaculata seem to have their endemic centers in the "cerrados" and "caatinga", while the Panstrongylus megistus may have originated in the tropical Atlantic forest system. The Triatoma infestans, however, seem to have originated in Bolivia, then were spread to large dispersal regions by man. Thus it can be assumed that domiciliarity is arrived at through an opportunistic mechanism stimulated by shelter and food availability factors. Once established, domiciliarity favors the species survival and dispersal, and this is of particular interest to control and surveillance programs because it increases the probability of the triatominae's success in synanthropic specialization. The present intense anthropic activities in the Amazonian system will lead to even greater expansion into the open lands; consequently, a triatominae domiciliarity spread can be expected, due to either autochthonous or man-introduced populations. A public health problem will then arise in a region where it has, heretofore, been unknown.

  5. 40 CFR 265.196 - Response to leaks or spills and disposition of leaking or unfit-for-use tank systems.

    Science.gov (United States)

    2010-07-01

    ... release and, based upon that inspection: (1) Prevent further migration of the leak or spill to soils or... information must be submitted to the Regional -Administrator: (i) Likely route of migration of the release... by a qualified Professional Engineer in accordance with § 270.11(d) that the repaired system is...

  6. Joan d’Albuzon ~ Nicolet de Turin, “En Nicolet, d’un sognie qu’ieu sognava” (BdT 265.2 = 310.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2008-06-01

    Full Text Available The article provides a commentary and a new critical edition of an Occitan tenso between two Italian troubadours, Joan d’Albuzon and Nicolet de Turin. The tenso presents a dream and its interpretation: Joan claims to have dreamt of a terrifying eagle flying through the air, accompanied by a huge ship of fire sailing across the land from Cologne. Nicolet in turn interprets the dream in terms of an emperor sweeping through Lombardy with a great army of German soldiers at his command, paid from his vast supply of treasure. Joan’s dream concludes with a vision of the eagle blowing out the fire, shining a great light over Montferrat, and settling in a high eyrie from which the whole world, now joyful, can be surveyed. Nicolet expounds this as the emperor’s desire for peace after vengeance, the Marquis of Montferrat’s submission, the emperor’s position of supreme command, and the prospect of appropriate rewards. The emperor is Frederick II Hohenstaufen and the author of the article proposes a new dating of the poem: it was probably composed in 1238 when the emperor, after his victory at the battle of Cortenuova in 1237 and subsequent subjection of several cities of the rebellious Lombard League, was arriving in Turin to receive the homage of Boniface II of Montferrat.

  7. SU-E-J-265: Feasibility Study of Texture Analysis for Prognosis of Local Tumor Recurrence Within 5-Years for Pharyngeal-Laryngeal Carcinoma Patients Received Radiotherapy Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, W; Tu, S [Chang Gung University, Kwei-shan, Tao-Yuan, Taiwan (China)

    2015-06-15

    Purpose: Pharyngeal and laryngeal carcinomas (PLC) are among the top leading cancers in Asian populations. Typically the tumor may recur and progress in a short period of time if radiotherapy fails to deliver a successful treatment. Here we used image texture features extracted from images of computed tomography (CT) planning and conducted a retrospective study to evaluate whether texture analysis is a feasible approach to predict local tumor recurrence for PLC patients received radiotherapy treatment. Methods: CT planning images of 100 patients with PLC treated by radiotherapy at our facility between 2001 and 2010 are collected. These patients were received two separate CT scans, before and mid-course of the treatment delivery. Before the radiotherapy, a CT scanning was used for the first treatment planning. A total of 30 fractions were used in the treatment and patients were scanned with a second CT around the end of the fifteenth delivery for an adaptive treatment planning. Only patients who were treated with intensity modulated radiation therapy and RapidArc were selected. Treatment planning software of Eclipse was used. The changes of texture parameters between two CT acquisitions were computed to determine whether they were correlated to the local tumor recurrence. The following texture parameters were used in the preliminary assessment: mean, variance, standard deviation, skewness, kurtosis, energy, entropy, inverse difference moment, cluster shade, inertia, cluster prominence, gray-level co-occurrence matrix, and gray-level run-length matrix. The study was reviewed and approved by the committee of our institutional review board. Results: Our calculations suggested the following texture parameters were correlated with the local tumor recurrence: skewness, kurtosis, entropy, and inertia (p<0.0.05). Conclusion: The preliminary results were positive. However some works remain crucial to be completed, including addition of texture parameters for different image features, sensitivity of tumor segmentation variations, and effect of image filtering.

  8. Microbicidal effect of the lactoferrin peptides Lactoferricin17-30, Lactoferrampin265-284, and Lactoferrin chimera on the parasite Entamoeba histolytica

    NARCIS (Netherlands)

    López-Soto, F.; León-Sicairos, N.; Nazmi, K.; Bolscher, J.G.; de la Garza, M.

    2010-01-01

    Entamoeba histolytica is a parasitic protozoan that produces amoebiasis, an intestinal disease characterized by ulcerative colitis and dysentery. In some cases, trophozoites can travel to the liver leading to hepatic abscesses and death. Recently, lactoferrin and lactoferricin B have been shown to

  9. BORTONI-Ricardo, Stella M. The urbanization of rural dialect speakers: a sociolinguistic study in Brazil. Cambridge: Cambridge University Press, 1985. 265p. BORTONI-Ricardo, Stella M. The urbanization of rural dialect speakers: a sociolinguistic study in Brazil. Cambridge: Cambridge University Press, 1985. 265p.

    Directory of Open Access Journals (Sweden)

    Maria Jandyra Cunha

    2008-04-01

    Full Text Available Quais são os principais fatores em ação na preservção das variedades linguisticas rurais e/ou não padrão no Brasil? Seria a sua manutenção simplesmente o resultado do analfabetismo ou da marginalização social ou geografica? Os dialetos retrocedem a medida que a população ganha acesso a educação formal? Até que ponto há uma ideologia de prestigio operando entre a chamada população marginal? Até que ponto a tendência homogeneizadora da sociedade urbana oscila entre duas forças contrarias: de um lado as pressões de uma padronização, de outro a manutengao das formas não-padrão como baluartes de identidades grupais?

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  11. Misael Arturo López Zapico. El tardofranquismo contemplado a través del periódico «The New York Times», Gijón, Ábaco Historia, 2010, 265 pp.

    Directory of Open Access Journals (Sweden)

    Antonio César Moreno Cantano

    2011-05-01

    Full Text Available La época calificada como «tardofranquismo», aquella que podemos englobar entre la designación de D. Juan Carlos como sucesor de Franco con el título de Rey (17 de julio de 1969 y la muerte del dictador (20 de noviembre de 1975, ha sido objeto preferente de atención por parte de la historiografía española en los últimos años. De igual manera, en fechas recientes, podemos localizar interesantes títulos que nos describen tan convulso periodo a través de las páginas de la prensa española. Es el caso de la obra colectiva La comunicación social durante el franquismo (2002, donde se localizan los trabajos de Bernardo Gómez Calderón, sobre el periodismo de opinión durante el final del franquismo; y el de Carlos Barrera del Barrio acerca de la apertura informativa en el tardofranquismo.

  12. A High Performance Backend for Array-Oriented Programming on Next-Generation Processing Units

    DEFF Research Database (Denmark)

    Lund, Simon Andreas Frimann

    are analyzed and experimentally tested. Resulting in the design and implementation of Bohrium a runtime-system for transforming, scheduling and executing array-oriented programs. Multiple interfaces for existing languages such as Python, C++, C#, and F# have been built which utilize the backend. A suite...... and the efficient execution of them on high performance systems. This work investigates the requirements for, and the implementation of, a high performance backend supporting these goals. This involves an outline of the hardware available today, in the near future and how to program it for high performance....... The main challenge is to bridge the gaps between performance, productivity and portability. A declarative high-level array-oriented programming model is explored to achieve this goal and a backend implemented to support it. Different strategies to the backend design and application of optimizations...

  13. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  14. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 265 ... Query: 7 ... ETLLYDVEDGIATITLNRPDRMNAFTARMMKDLIEVFXXXXXXXXXXXXXXXGAGRAFCA 66 ... ... ... ETLLYDVEDGIATITLNRPDRMNAFTARMMKDLIEVF ... GAGRAFCA Sbjct: 1 ... ETLLYDVEDGIATITLNRPDRMNAFTARMMKDLI

  15. Gclust Server: 85641 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 85641 CEL_ZK938.5_17535347 Cluster Sequences Related Sequences(265) 498 old-2: Overexpression...ences Related Sequences(265) Sequence length 498 Representative annotation old-2: Overexpression

  16. ORF Alignment: NC_000853 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SRENIEDVKKLIDR Sbjct: 121 ITLDGTEVYHDRYRKARNGAPTFSSIFENIFRAVNKGLFVQIRVNVSRENIEDVKKLIDR 180 ... Query: 325 PRFARC...DAMCKNSFVVDVDGRVYKC 349 ... PRFARCDAMCKNSFVVDVDGRVYKC Sbjct: 241 PRFARCDAMCKNSFVVDVDGRVYKC 265

  17. Experimental stress analysis of the attachment region of hemispherical shells with attached nozzles. Part 4c. Nonradial nozzle at 22-1/2 degrees 2.265 in. O.D. - 2.500 in. I.D. 4.00 in. penetration

    International Nuclear Information System (INIS)

    Maxwell, R.L.; Holland, R.W.

    1974-03-01

    The report presents the results of investigations conducted on a nonradially attached nozzle of 2.625'' O.D., 2.500'' I.D., and 4.00'' nominal penetration into the hemisphere. The nozzle is inclined at 22 1/2 0 from a radial axis. Stress values for the following types of loadings are tabulated: (1) internal pressure applied to the hemisphere and nozzle assembly, (2) an axial load applied collinear with nozzle, (3) a pure torque applied in the radial plane of the nozzle, and (4) a pure bending moment or axial couple applied in various axial planes of the nozzle. The report presents various stress vs. profile curves

  18. Comparative Effect of an Addition of a Surface Term to Woods-Saxon Potential on Thermodynamics of a Nucleon

    Science.gov (United States)

    Lütfüoğlu, B. C.

    2018-01-01

    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schrödinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an α particle confined in Bohrium-270 nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared for both wells. The internal energy and the specific heat capacity increase as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the number of available states. Supported by the Turkish Science and Research Council (TÜBİTAK) and Akdeniz University

  19. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  20. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LSTKPNLIRYCADELGFGLVTTKSFQVLPNPGNREPILCEPELGCFGNSVG 60 ... Query: 145 ASAGFGASIGCDPAIAAEYVKIIKKALPDCAVPIFVKLTPN...VEDIGAIASAVIEAGADGI 204 ... ASAGFGASIGCDPAIAAEYVKIIKKALPDCAVPIFVKLTPNVEDIG...AIASAVIEAGADGI Sbjct: 121 ASAGFGASIGCDPAIAAEYVKIIKKALPDCAVPIFVKLTPNVEDIGAIASAVIEAGADGI 180 ... Query: 265 GGVMT

  1. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.

    2001-01-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  2. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  3. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  4. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  5. Present state of the marine environment around India

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.

    stream_size 2 stream_content_type text/plain stream_name Mar_Archaeol_2_65.pdf.txt stream_source_info Mar_Archaeol_2_65.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  6. Department of Zoology, University of Natal, Pietermaritzburg

    African Journals Online (AJOL)

    . 11.11.65. Circus macrourus. Last date. 27. 2.65. 1st date. 29. 1.65. Circus pygargus. Last date. 11. 2.65. 24. 2.66 lst date. 28.11.64. 25.10.65. Philomachus pugnax .. Last date. 30.12.64. 1st date. 12.10.64. 15.11.65. Calidris minuta. Last date.

  7. Identification and typing of Brucella spp. in stranded harbour porpoises (Phocoena phocoena) on the Dutch coast.

    NARCIS (Netherlands)

    Maio, E.; Begeman, L.; Bisselink, Y.J.W.M.; Tulden, van P.W.; Wiersma, L.; Hiemstra, S.; Ruuls, R.; Gröne, A.; Roest, H.I.J.; Willemsen, P.T.J.; Giessen, van der J.

    2014-01-01

    The presence of Brucella (B.) spp. in harbour porpoises stranded between 2008 and 2011 along the Dutch coast was studied. A selection of 265 tissue samples from 112 animals was analysed using conventional and molecular methods. In total, 4.5% (5/112) of the animals corresponding with 2.3% (6/265)

  8. Identification and typing of Brucella spp. in stranded harbour porpoises (Phocoena phocoena) on the Dutch coast

    NARCIS (Netherlands)

    Maio, Elisa; Begeman, Lineke; Bisselink, Yvette; van Tulden, Peter; Wiersma, Lidewij; Hiemstra, Sjoukje; Ruuls, Robin; Gröne, Andrea; Roest, Hendrik-Ido-Jan; Willemsen, Peter; van der Giessen, Joke

    2014-01-01

    The presence of Brucella (B.) spp. in harbour porpoises stranded between 2008 and 2011 along the Dutch coast was studied. A selection of 265 tissue samples from 112 animals was analysed using conventional and molecular methods. In total, 4.5% (5/112) of the animals corresponding with 2.3% (6/265)

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 91; Issue 3. Issue front cover thumbnail. Volume 91, Issue 3. December 2012, pages 265-424. pp 265-277 Research Article. Genetic and morphological variability in South American rodent Oecomys (Sigmodontinae, Rodentia): evidence for a complex of species · C. C. Rosa T.

  10. 75 FR 2091 - Approval and Promulgation of Implementation Plans and Designation of Areas for Air Quality...

    Science.gov (United States)

    2010-01-14

    ... Valley Authority's (TVA) Allen Steam Plant located in Shelby County operates three coal- fired boilers..., Wall v. EPA, 265 F.3d 426, 438-40 (6th Cir. 2001) (upholding this interpretation). See also, 60 FR... Pennsylvania Growth Alliance v. Browner, 144 F.3d 984, 989-90 (6th Cir. 1998); Wall, 265 F.3d 426, at 438) plus...

  11. 78 FR 3877 - Radio Broadcasting Services; Peach Springs, AZ

    Science.gov (United States)

    2013-01-17

    ...] Radio Broadcasting Services; Peach Springs, AZ AGENCY: Federal Communications Commission. ACTION... Tribe, proposing to amend the Table of Allotments by allotting Channel 265A at Peach Springs, Arizona... service at Peach Springs. Channel 265A can be allotted at Peach Springs, Arizona, in compliance with the...

  12. Aptychi from the Berriasian/Valanginian (France and Spain): New stratigraphical and morphological details

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Janssen, N. M. M.; Klein, J.

    2016-01-01

    Roč. 86, č. 3 (2016), s. 265-272 ISSN 0208-9068 Institutional support: RVO:68145535 Keywords : Lamellaptychi * Berriasian/Valanginian * Vocontian Basin * Betic Cordillera Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.833, year: 2016 http://www.asgp.pl/sites/ default /files/volumes/86_3_265_272.pdf

  13. Globalization, increasing returns in component production, and the pattern of trade

    Czech Academy of Sciences Publication Activity Database

    Kovaříková Arro, Anu

    -, č. 265 (2005), s. 1-52 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : monopolistic competition * external and internal economies of scale * trade across the stages of production Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp265.pdf

  14. Genetic diversity of Annona senegalensis Pers. populations as ...

    African Journals Online (AJOL)

    Administrator

    2007-05-16

    May 16, 2007 ... nutrition. The food value varies considerably, but most. *Corresponding author's E-mail: westmwase@yahoo.co.uk. Tel: (265) 1 277 361 Fax: (265) 1 277 364 forms have an abundance of ... labeling and silver staining. At present ... polymorphic even between closely related lines, require low amounts of ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 265 of 265 ... Vol 36, No 3 (2009), Undescended scapula, Abstract PDF. SG Lungu. Vol 36, No 2 (2009), University students' perspective of sexual harassment: A case study at the University of Zambia, Abstract PDF. A Menon, NMP Shilalukey, S Siziya, P Ndubani, M Musepa, J Malungo, B Munalula, M Mwela, ...

  16. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  17. Neuroimaging of a minipig model of Huntington's disease: Feasibility of volumetric, diffusion-weighted and spectroscopic assessments

    Czech Academy of Sciences Publication Activity Database

    Schubert, R.; Frank, F.; Nagelmann, N.; Liebsch, L.; Schuldenzucker, V.; Schramke, S.; Wirsig, M.; Johnson, H.; Young Kim, E.; Ott, S.; Hölzner, E.; Demokritov, S. O.; Motlík, Jan; Faber, C.; Reilmann, R.

    2016-01-01

    Roč. 265, S1 (2016), s. 46-55 ISSN 0165-0270 Institutional support: RVO:67985904 Keywords : animal models * minipig * MRI * brain atlas * preclinical research Subject RIV: FH - Neurology Impact factor: 2.554, year: 2016

  18. Behavioral phenotyping of minipigs transgenic for the Huntington gene

    Czech Academy of Sciences Publication Activity Database

    Schramke, S.; Schuldenzucker, V.; Schubert, R.; Frank, F.; Wirsig, M.; Ott, S.; Motlík, Jan; Fels, M.; Kemper, N.; Hölzner, E.; Reilmann, R.

    2016-01-01

    Roč. 265, S1 (2016), s. 34-45 ISSN 0165-0270 Institutional support: RVO:67985904 Keywords : animal models * minipig * phenotyping * behavioral * motor Subject RIV: FH - Neurology Impact factor: 2.554, year: 2016

  19. Chromosomal variation in social voles: a Robertsonian fusion in Günther‘s vole

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Arslan, A.; Benda, P.; Macholán, Miloš; Kryštufek, B.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 255-265 ISSN 0001-7051 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : karyotypes * systematics * C-banding * NOR distribution Subject RIV: EG - Zoology Impact factor: 1.161, year: 2013

  20. Diversity, distribution and host-species associations of epiphytic orchids in Nepal

    Czech Academy of Sciences Publication Activity Database

    Timsina, B.; Rokaya, Maan Bahadur; Münzbergová, Zuzana; Kindlmann, P.; Shrestha, B.; Bhattarai, B.; Raskoti, B. B.

    2016-01-01

    Roč. 25, č. 13 (2016), s. 2803-2819 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : species richness * host * Nepal Himalaya Subject RIV: EF - Botanics Impact factor: 2.265, year: 2016

  1. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Guam.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 22-26 September 2003 (JD 265-269) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Guam Island in...

  2. 76 FR 11283 - Agency Information Collection Activities; Submission for OMB Review; Comment Request...

    Science.gov (United States)

    2011-03-01

    ... shall be paid in all compensable death cases. The OWCP has developed Form LS-265 for use in submitting... shall generally be subject to penalty for failing to comply with a collection of information if the...

  3. NIHSeniorHealth

    Medline Plus

    Full Text Available ... Play next Play now Physical Therapy Exercises After Knee Replacement - Duration: 5 minutes, 30 seconds. 42,265 ... 53 Play next Play now What Happens After Knee Replacement? - Duration: 5 minutes, 53 seconds. 7,946 ...

  4. Hydrological effects of fire in South-African mountain catchments

    CSIR Research Space (South Africa)

    Scott, DF

    1993-10-01

    Full Text Available , mountain 82 Pinus 22 Control for Jonkershoek fynbos radiata Bosboukloof V1H020, Short, dense 26.5 Eucalyptus 7 Wildfire, dry Ntabamhlope grassland fastigata season August 1989 VIH028, Short, dense 0 -- Control for Ntabamhlope...

  5. CDC Vital Signs: Breast Cancer

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  6. Breast Cancer Disparities

    Science.gov (United States)

    ... 2.65 MB] Read the MMWR Science Clips Breast Cancer Black Women Have Higher Death Rates from Breast ... of Page U.S. State Info Number of Additional Breast Cancer Deaths Among Black Women, By State SOURCE: National ...

  7. V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Markl, Martin; Somer, L.

    2013-01-01

    Roč. 58, č. 4 (2013), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

  8. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  9. African Journal of Biotechnology - Vol 3, No 5 (2004)

    African Journals Online (AJOL)

    Improving bambara groundnut productivity using gamma irradiation and in vitro techniques · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HK Adu-Dapaah, RS Sangwan, 260-265 ...

  10. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2014-01-01

    Roč. 61, č. 6 (2014), s. 265-271 ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  11. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  12. Association of ADAM33 gene polymorphisms with adult-onset ...

    Indian Academy of Sciences (India)

    onset asthma and its severity in an Indian adult population. Priya Tripathi, Shally Awasthi, Rajendra Prasad, Nuzhat Husain and Subramaniam Ganesh. J. Genet. 90, 265–273. Figure 1. Gel pictures of five genotyped ADAM33 gene polymorphisms ...

  13. Kas uus mõistete ümberhindamine / Karl Ast Rumor

    Index Scriptorium Estoniae

    Ast Rumor, Karl

    2007-01-01

    Sõjavaimustust pooldavate mõtete ümberhindamisest suurriikide parlamentides Esimese maailmasõja ajal. Lord Cortney kõnest Lordide Koja koosolekul. Varem ilmunud "Pealinna Teataja" 14. november 1915, nr. 265

  14. Condensed-matter physics: Magnetism in flatland

    Science.gov (United States)

    Samarth, Nitin

    2017-06-01

    A pair of two-dimensional materials have been shown to exhibit ferromagnetism -- the familiar type of magnetism found in iron bar magnets. Such materials could have applications from sensing to data storage. See Letters p.265 & p.270

  15. 78 FR 63181 - Information Collection Request Submitted to OMB for Review and Approval; Comment Request...

    Science.gov (United States)

    2013-10-23

    ... hazardous waste in boilers, incinerators, and industrial furnaces (BIFs) under 40 CFR parts 63, 264, 265... BIFs. This includes the requirements under the comparable/syngas fuel specification at 40 CFR 261.38...

  16. StreamCat

    Data.gov (United States)

    U.S. Environmental Protection Agency — The StreamCat Dataset provides summaries of natural and anthropogenic landscape features for ~2.65 million streams, and their associated catchments, within the...

  17. Helminth genome projects: all or nothing

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; Horák, Aleš; Scholz, Tomáš

    2005-01-01

    Roč. 21, č. 6 (2005), s. 265-266 ISSN 1471-4922 Institutional research plan: CEZ:AV0Z60220518 Keywords : genome project * helminth * Dracunculus Subject RIV: EG - Zoology Impact factor: 4.526, year: 2005

  18. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available esis, component of motor switch and energizing, ... enabling rotation and determining its direction ... ...etermining its ... direction [Escherichia coli O157:H7 EDL933] ... Length = 74 ... Query: 265 LVR

  19. 78 FR 21421 - NASA Advisory Council; Science Committee; Planetary Protection Subcommittee; Meeting

    Science.gov (United States)

    2013-04-10

    .../ , the meeting number on April 29 is 995 580 265, password pps04292013!; the meeting number on April 30 is 994 280 426, password pps04302013!. The agenda for the meeting includes the following topics...

  20. How States Cooperate

    DEFF Research Database (Denmark)

    Tsingou, Eleni

    2014-01-01

    Review of: Institutional Choice and Global Commerce. By Joseph Jupille, Walter Mattli, and Duncan Snidal. New York, NY: Cambridge University Press, 2013, 265 pp., $95.00 hardcover (ISBN-13: 978-1-107-03895-0)....

  1. Management of malaria at Juba Teaching Hospital: a clinical audit

    African Journals Online (AJOL)

    2012-08-03

    Aug 3, 2012 ... metabolic acidosis (bicarbonate 265µM/L. Haemoglobinuria. •. (urine test positive for blood without red blood cells seen on microscopy). Spontaneous bleeding. •. (may indicate disseminated intravascular coagulation - DIC). Acute respiratory distress syndrome. •. (ARDS).

  2. Large beech (Fagus sylvatica) trees as ‘lifeboats’ for lichen diversity in central European forests

    Czech Academy of Sciences Publication Activity Database

    Hofmeister, J.; Hošek, J.; Malíček, J.; Palice, Zdeněk; Syrovátková, L.; Steinová, J.; Černajová, I.

    2016-01-01

    Roč. 25, č. 6 (2016), s. 1073-1090 ISSN 0960-3115 Institutional support: RVO:67985939 Keywords : Fagus * forest management * Red-listed species Subject RIV: EH - Ecology, Behaviour Impact factor: 2.265, year: 2016

  3. Association of ADAM33 gene polymorphisms with adult-onset ...

    Indian Academy of Sciences (India)

    2011-08-19

    , is an asthma susceptibility gene origi- nally identified by positional cloning. ... Journal of Genetics, Vol. 90, No. 2, August 2011. 265 ... the asthma affecting the children in a north Indian population. (Awasthi et al. 2011).

  4. Einwanderungsland Kanada heute

    OpenAIRE

    Vogelsang, Roland (Prof.)

    1997-01-01

    Einwanderungsland Kanada heute : Einwanderungsregulierungen, bevölkerungsgeograph., ökonom. u. ges. Auswirkungen. - In: Kanada in der Krise / hrsg. von Rainer-Olaf Schultze ... - Bochum : Brockmeyer, 1997. - S. 231-265. - (Kanada-Studien ; 20)

  5. All projects related to Sri Lanka | Page 6 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: COMMUNITY FACILITIES, INFORMATION TECHNOLOGY, INFORMATION SERVICES, INFORMATION NETWORKS. Region: Sri Lanka, Central Asia, Far East Asia, South Asia. Total Funding: CA$ 265,330.00. Learning Initiatives for Network Economies in Asia (LIRNEasia) : Building Capacity in ICT Policy. Project.

  6. Za Milošem Vršeckým (1950-2017)

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    2017-01-01

    Roč. 27, č. 3 (2017), s. 265-266 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Plzeň * Mladina * folk dance * folklorism Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Folklore studies

  7. South African Journal of Animal Science - Vol 34, No 4 (2004)

    African Journals Online (AJOL)

    A genetic analysis of epistaxis as associated with EIPH in the Southern African Thoroughbred · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Weideman, SJ Schoeman, GF Jordaan, 265-273 ...

  8. Abelovu cenu za matematiku získal v roce 2014 Jakov G. Sinaj

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2014-01-01

    Roč. 59, č. 4 (2014), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : billiards * entropy * binary sequences Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144076

  9. Coat colour and chromosome variation in cetral European populations of the weasel (Mustela nivalis)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Cenevová, E.

    2002-01-01

    Roč. 51, č. 4 (2002), s. 265-274 ISSN 0139-7893 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : weasel * pelage coloration * karyotype Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/4/265-274.pdf

  10. Very Low Energy Scanning Electron Microscopy of Free-Standing Ultrathin Films

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Ilona; Hovorka, Miloš; Hanzlíková, Renáta; Frank, Luděk

    2010-01-01

    Roč. 51, č. 2 (2010), s. 265-270 ISSN 1345-9678 R&D Projects: GA AV ČR IAA100650902 Institutional research plan: CEZ:AV0Z20650511 Keywords : low energy scanning electron microscopy * thin foils * transmission of very slow electrons Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.779, year: 2010 http://www.jim.or.jp/journal/e/51/02/265.html

  11. Structural and stress analysis of mining practice in the Upper Silesian Coal Basin

    Czech Academy of Sciences Publication Activity Database

    Waclawik, Petr; Ptáček, Jiří; Grygar, R.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 255-265 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : horizontal stress * structural analysis * mine roadway stability * coal mining * rock burst Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_15_Waclawik_255-265.pdf

  12. Effects of somatic cell count on the gross composition, protein ...

    African Journals Online (AJOL)

    On the basis of the results, two individual milk samples were selected: one from a sheep with low milk SCC (up to 265.000 cells/mL; LCC) and one from a sheep with high milk SCC (over 265,000 and less than 1,000,000 cells/mL; HCC). In one herd, it was not possible to collect the milk samples in summer. So, a total of 44 ...

  13. The vaccine properties of a Brazilian bovine herpesvirus 1 strain with an induced deletion of the gE gene

    International Nuclear Information System (INIS)

    Franco, A.C.; Spilki, F.R.; Roehe, P.M.; Rijsewijk, F.A.M.

    2005-01-01

    Aiming at the development of a differential vaccine (DIVA) against infectious bovine rhinotracheitis (IBR), a Brazilian strain of bovine herpesvirus type 1 (BHV1) with a deletion of the glycoprotein E (gE) gene was constructed (265gE - ). Here we present the experiments performed with this strain in order to evaluate its safety and efficacy as a vaccine virus in cattle. In the first experiment, a group of calves was inoculated with 265gE - and challenged with wild type virus 21 days post-inoculation. Calves immunized with 265gE - virus and challenged with wild type virus developed very mild clinical disease with a significant reduction in the amount of virus excretion and duration. The safety of the 265gE - during pregnancy was assessed using 22 pregnant cows, at different stages of gestation, that were inoculated with the 265gE - virus intramuscularly, with 15 pregnant cows kept as non-vaccinated controls. No abortions, stillbirths or foetal abnormalities were seen after vaccination. The results show that the 265gE - recombinant is attenuated and able to prevent clinical disease upon challenge. This recombinant will be further evaluated as a candidate virus for a BHV1 differential vaccine. (author)

  14. Combining ability for maturity and plant height in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    Nasim, A.; Farhatullah, A.; Khan, N.U.; Azam, S.M.; Nasim, Z.

    2014-01-01

    A 5 * 5 F1 diallel cross hybrids of Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt along with parents were evaluated through combining ability for days to flowering (initiation and completion), days to maturity and plant height. Highly significant differences were recorded for all the traits. Mean squares due to general, specific and reciprocal combining ability were significant for all the traits except plant height for which the latter two components were non-significant. Prevalence of additive (plant height), non-additive (days to flowering completion; days to maturity) and reciprocal effects (days to flowering initiation) were detected. Parental line G-403 was best general combiner for all the traits. The F1 hybrids G-902 * G-265 (days to flowering initiation), G-902 * G-403 (days to flowering completion), G-265 * G-1500 (days to maturity) and G-909 * G-265 (plant height) were superior and may be exploited for future breeding programs. (author)

  15. Gamma ray induced Fusarium wilt resistance in pigeonpea (Cajanus cajan L. Millsp)

    International Nuclear Information System (INIS)

    Dwivedi, S.; Faris, D.G.; Jain, K.C.

    1990-01-01

    Full text: Seed of pigeonpea 'ICPL 265' susceptible to wilt (Fusarium udum) was irradiated with doses of gamma rays ranging from 5 to 40 kR. In the M 1 , untreated control and irradiated populations were all susceptible. Selfed seeds from surviving M 1 plants were grown in a wilt disease plot. Morphological variants of 40 kR treated seed showed the mutagen's impact. Nearly all check plants (99.3%) were killed by wilt; 3% of irradiated M2-plants survived. Selfed seeds were grown as M 3 bulks and as M 4 single plant progenies. The M 4 had several wilt resistant lines with yield and seed size better than 'ICPL 265'. One wilt resistant line was also resistant to Sterility Mosaic Disease and another one was shorter and earlier than 'ICPL 265'. (author)

  16. Clinical significance of disease-specific MYD88 mutations in circulating DNA in primary central nervous system lymphoma.

    Science.gov (United States)

    Hattori, Keiichiro; Sakata-Yanagimoto, Mamiko; Suehara, Yasuhito; Yokoyama, Yasuhisa; Kato, Takayasu; Kurita, Naoki; Nishikii, Hidekazu; Obara, Naoshi; Takano, Shingo; Ishikawa, Eiichi; Matsumura, Akira; Hasegawa, Yuichi; Chiba, Shigeru

    2018-01-01

    Recent sequencing studies demonstrated the MYD88 L265P mutation in more than 70% of primary central nervous system lymphomas (PCNSL), and the clinical significance of this mutation has been proposed as diagnostic and prognostic markers in PCNSL. In contrast, mutational analyses using cell-free DNAs have been reported in a variety of systemic lymphomas. To investigate how sensitively the MYD88 L265P mutation can be identified in cell-free DNA from PCNSL patients, we carried out droplet digital PCR (ddPCR) and targeted deep sequencing (TDS) in 14 consecutive PCNSL patients from whom paired tumor-derived DNA and cell-free DNA was available at diagnosis. The MYD88 L265P mutation was found in tumor-derived DNA from all 14 patients (14/14, 100%). In contrast, among 14 cell-free DNAs evaluated by ddPCR (14/14) and TDS (13/14), the MYD88 L265P mutation was detected in eight out of 14 (ddPCR) and in 0 out of 13 (TDS) samples, implying dependence on the detection method. After chemotherapy, the MYD88 L265P mutation in cell-free DNAs was traced in five patients; unexpectedly, the mutations disappeared after chemotherapy was given, and they remained undetectable in all patients. These observations suggest that ddPCR can sensitively detect the MYD88 L265P mutation in cell-free DNA and could be used as non-invasive diagnostics, but may not be applicable for monitoring minimal residual diseases in PCNSL. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  17. Comparison of UV-LED and low pressure UV for water disinfection: Photoreactivation and dark repair of Escherichia coli.

    Science.gov (United States)

    Li, Guo-Qiang; Wang, Wen-Long; Huo, Zheng-Yang; Lu, Yun; Hu, Hong-Ying

    2017-12-01

    Studies on ultraviolet light-emitting diode (UV-LED) water disinfection have shown advantages, such as safety, flexible design, and lower starting voltages. However, information about reactivation after UV-LED disinfection is limited, which is an important issue of UV light-based technology. In this study, the photoreactivation and dark repair of Escherichia coli after UV-LEDs and low pressure (LP) UV disinfection were compared. Four UV-LED units, 265 nm, 280 nm, the combination of 265 + 280 (50%), and 265 + 280 (75%) were tested. 265 nm LEDs was more effective than 280 nm LEDs and LP UV lamps for E. coli inactivation. No synergic effect for disinfection was observed from the combination of 265 and 280 nm LEDs. 265 nm LEDs had no different reactivation performances with that of LP UV, while 280 nm LEDs could significantly repress photoreactivation and dark repair at a low irradiation intensity of 6.9 mJ/cm 2 . Furthermore, the UV-induced damage of 280 nm LEDs was less repaired which was determined by endonuclease sensitive site (ESS) assay. The impaired protein activities by 280 nm LEDs might be one of the reasons that inhibited reactivation. A new reactivation rate constant, K max , was introduced into the logistic model to simulate the reactivation data, which showed positive relationship with the maximum survival ratio and was more reasonable to interpret the results of photoreactivation and dark repair. This study revealed the distinct roles of different UV lights in disinfection and reactivation, which is helpful for the future design of UV-LED equipment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Saccharomonospora colocasiae sp. nov., an actinomycete isolated from the rhizosphere of Colocasia esculenta.

    Science.gov (United States)

    Wattanasuepsin, Watsapon; Intra, Bungonsiri; Také, Akira; Inahashi, Yuki; Euanorasetr, Jirayut; Ōmura, Satoshi; Matsumoto, Atsuko; Panbangred, Watanalai

    2017-11-01

    A non-Streptomyces actinomycete, designated as strain S265 T , was isolated from rhizosphere collected under an elephant ear plant (Colocasia esculenta) in Bangkok, Thailand. The taxonomic position of this strain was determined by a polyphasic approach. Strain S265 T formed single globose spores on long, branching, aerial hyphae. It produced abundant aerial mycelium with green colour. The cell wall contained meso-diaminopimelic acid, and diagnostic whole-cell sugars were arabinose and galactose. Phosphatidylethanolamine and diphosphatidylglycerol were detected predominantly as polar lipids, whereas mycolic acids were not found. The major menaquinone was MK-9(H4), and principal cellular fatty acids were C15 : 1 B, iso-C16 : 1 H, anteiso-C15 : 0 and C15 : 0 2-OH. The DNA G+C content was 69 mol%. According to phylogenetic analysis, strain S265 T was clustered with Saccharomonospora glauca K62 T (98.1 %) and Saccharomonosporaviridis DSM 43017 T (97.1 %) despite its 16S rRNA gene sequence showing the highest similarity value to that of Saccharomonosporaazurea NA-128 T (98.6 %). DNA-DNA relatedness values between strain S265 T and the closely related strains were in the range of 7-50 %, thus strengthening the evidence derived from the polyphasic study that strain S265 T represents a novel species within the genus Saccharomonospora, for which the name Saccharomonosporacolocasiae sp. nov. is proposed. The type strain is S265 T (=TBRC 7235 T =NBRC 112945 T ).

  19. Komparacija sekundarnih etalona mikrotalasne snage / Comparison of microwave power secondary standards

    Directory of Open Access Journals (Sweden)

    Sanja Suruliz

    2003-07-01

    Full Text Available U ovom radu opisana je komparacija grupe sekundarnih etalona mikrotalasne snage kao način za održavanje metrološke sledljivosti u nedostatku primarnog etalona mikrotalasne snage. Obavljene su dve komparacije i to sa termopretvaračkim glavama, 2000. godine, a 2002. godine prošireno i na termistorske glave u opsegu frekvencija 18 do 26,5 GHz. / In absence of primary standards for microwave power, a group of microwave power secondary standards was compared as a method of sustaining metrological traceability. The comparison included thermoelectric and thermistor mounts in the frequency range from 18 to 26,5 GHz.

  20. Effect of Aqueous Ammonia Soaking on the methane yield and composition of digested manure fibers applying different ammonia concentrations and treatment durations

    DEFF Research Database (Denmark)

    Mirtsou-Xanthopoulou, Chrysoula; Jurado, Esperanza; Skiadas, Ioannis

    2014-01-01

    at 22°C was applied on digested fibers separated from the effluent of a manure-fed, full-scale anaerobic digester. A methane yield increase from 76% to 104% was achieved during the first series of experiments, while the difference in reagent concentration did not considerably affect the methane yield...... is a very promising treatment resulting to an overall increase of the methane yield of digested manure fibers from 76 to 265% depending on the conditions and the batch of digested fibers used (an even higher increase of 190-265% was achieved during the 2nd series of experiments, where different AAS...

  1. Deciphering Chinese Strategic Deception: The Middle Kingdom’s First Aircraft Carrier

    Science.gov (United States)

    2013-06-01

    convention romanizes his name as “Mao Tse-Tung”. The Pinyin convention romanizes his name as “Mao Zedong ”. The Chinese characters for his name... Zedong in the 1950s as part of efforts to simplify Chinese script and increase literacy in China—it involves the reduction in the number and...265, Shu ~ 221-263, Wu ~ 222-280 Jin i!¥ -- Western Ji n i!!i ili 265-316 52 years Eastern Jin 31<: ili 317-420 104 years Northern and Southern

  2. Natural radon reduction rate of the community groundwater system in South Korea.

    Science.gov (United States)

    Yun, Uk; Seong Kim, Tae; Kim, Hyun Koo; Kim, Moon Su; Cho, Soo Young; Choo, Chang Oh; Cho, Byong Wook

    2017-08-01

    Tank waters from 13 Community Groundwater Systems (CGS) showed average radon reduction rate of 26.5% (varying from -17.9% to 63.3%). When applying the reduction rate of 26.5% to the nationwide CGS, the percentage of CGS having radon level above 100Bq/L decreases from 28.8% to 22.0%. The natural radon reduction method would be applied to the CGS having radon level slightly exceeding guideline of WHO, as an alternative for aeration or GAC. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Clinical manifestations of allergic rhinitis in children at Denpasar Hospital

    Directory of Open Access Journals (Sweden)

    Gary Adhianto

    2001-06-01

    (12%.. Four children had history of atopic dermatitis, 1 food allergy, 10 asthma, 3 urticaria, 2 drug allaaaergy, 4 h-ad history of both atopic dermatitis and urticaria, 13 both asthma and urticaria, 2 both asthma and drug allergy and 6 children had no history of allergic diseases. Thirty three (60% one of the parents and 12 (21.8% both parents ever had allergic diseases. According to SPT, 27 (55.1% of this children had positive reaction to inhalant allergen, 13 (26.5% to food allergen and 13 (26.5% had negative reaction.

  4. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  5. MicroSISAK. Continuous liquid-liquid extractions of radionuclides at {>=} 0.2 mL/min

    Energy Technology Data Exchange (ETDEWEB)

    Hild, D.; Eberhardt, K.; Kratz, J.V.; Wiehl, N. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Even, J. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Helmholtz-Institut Mainz, Mainz (Germany); Loeb, P.; Werner, B.; Hofmann, C. [Institut fuer Mikrotechnik Mainz GmbH, Mainz (Germany)

    2013-07-01

    extraction yield determined as the ratio of the Tc {gamma}-ray activities in both detectors was 76 {+-} 1%. With this experiment, it was demonstrated that MicroSISAK is in principle ready for an on-line experiment for the chemical characterization of the superheavy element bohrium, element 107. However, the detection of a-particle activities by liquid scintillation counting still needs to be worked out. (orig.)

  6. An epidemiological study on the composition of urinary stones in ...

    African Journals Online (AJOL)

    M. Bouatia

    (Morocco) between 2008 and 2013. A series of 828 urinary stones from 537 men and 265 women was analyzed using ... From this mixture, a calculus + KBr tablet was prepared at 10 tons of pressure under ... In this series, 13 stone types were identified: calcium oxalate monohydrate(COM),calciumoxalatedihydrate(COD), ...

  7. Waveguiding Er.sup.3+./sup./Yb.sup.3+./sup.:LiNbO.sub.3./sub. films prepared by a sol–gel method using polyvinylpyrrolidone

    Czech Academy of Sciences Publication Activity Database

    Rubešová, K.; Mikolášová, D.; Hlásek, T.; Jakeš, V.; Nekvindová, P.; Bouša, D.; Oswald, Jiří

    2016-01-01

    Roč. 176, Aug (2016), s. 260-265 ISSN 0022-2313 Institutional support: RVO:68378271 Keywords : lithium niobate * polyvinylpyrrolidone * erbium * sol –gel waveguide Subject RIV: BM - Sol id Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  8. Molecular mobility of poly(vinylidene fluoride) in the anisotropic state

    Czech Academy of Sciences Publication Activity Database

    Dmitriev, I.; Gladchenko, S. V.; Afanasyeva, N. V.; Lavrentyev, V. K.; Bukošek, V.; Baldrian, Josef; Elyashevich, G. K.

    2008-01-01

    Roč. 50, č. 3 (2008), s. 265-272 ISSN 0965-545X Institutional research plan: CEZ:AV0Z40500505 Keywords : poly(vinylidene fluoride) * orientation * molecular mobility Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.543, year: 2008

  9. EST Table: FS938031 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available se subunit I [Eucereon consorta] 10/09/13 57 %/265 aa FBpp0100176|mt:CoI-PA 10/08/29 44 %/264 aa MTCE.26#CE3...FS938031 E_FL_fwgP_50M21_F_0 10/09/28 66 %/235 aa gb|AAO37307.1| cytochrome c oxida

  10. Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

    Czech Academy of Sciences Publication Activity Database

    Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

    2013-01-01

    Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

  11. Cutaneous leishmaniasis in Karak, Pakistan: Report of an outbreak ...

    African Journals Online (AJOL)

    A total of 339 patients with clinically suspected cutaneous leishmaniasis (CL) were studied from March to April, 2010 in three villages of Karak, Khyber Pakhtunkhwa, Pakistan where an epidemic of the disease was in question. Using polymerase chain reaction (PCR), 78.17% (265/339) were observed having CL.

  12. Determination of D/H Ratio on Jupiter from ISO/SWS Observations

    NARCIS (Netherlands)

    Lellouch, E.; Encrenaz, Th.; de Graauw, Th.; Schaeidt, S.; Feuchtgruber, H.; Beintema, D. A.; Bezard, B.; Drossart, P.; Griffin, M.; Heras, A.; Kessler, M.; Leech, K.; Morris, A.; Roelfsema, P. R.; Roos-Serote, M.; Salama, A.; Vandenbussche, B.; Valentijn, E. A.; Davies, G. R.; Naylor, D. A.

    1996-01-01

    Observations of Jupiter, performed on March 29, 1996, with the Short-Wavelength Spectrometer (SWS) of the Infrared Space Observatory (ISO) in Fabry-Perot mode, have allowed the first detection of the rotational R(2) line of HD at 37.7 mu m (265.3 cm(-1) ). The instrument aperture (a rectangular slit

  13. Microanalysis of clay-based pigments in paintings by XRD techniques

    Czech Academy of Sciences Publication Activity Database

    Hradil, David; Bezdička, Petr; Hradilová, J.; Vašutová, V.

    2016-01-01

    Roč. 125, MAR (2016), s. 10-20 ISSN 0026-265X R&D Projects: GA ČR(CZ) GA14-22984S Institutional support: RVO:61388980 Keywords : Clay minerals * Earth pigments * Clay-binder interaction * Powder X-ray micro-diffraction * Quantitative phase microanalysis Subject RIV: DB - Geology ; Mineralogy Impact factor: 3.034, year: 2016

  14. Predicting soil particle density from clay and soil organic matter contents

    DEFF Research Database (Denmark)

    Schjønning, Per; McBride, R.A.; Keller, T.

    2017-01-01

    Soil particle density (Dp) is an important soil property for calculating soil porosity expressions. However, many studies assume a constant value, typically 2.65Mgm−3 for arable, mineral soils. Fewmodels exist for the prediction of Dp from soil organic matter (SOM) content. We hypothesized that b...

  15. The Differential Impacts of Early Physical and Sexual Abuse and Internalizing Problems on Daytime Cortisol Rhythm in School-Aged Children

    Science.gov (United States)

    Cicchetti, Dante; Rogosch, Fred A.; Gunnar, Megan R.; Toth, Sheree L.

    2010-01-01

    The impact of early physical and sexual abuse (EPA/SA) occurring in the first 5 years of life was investigated in relation to depressive and internalizing symptomatology and diurnal cortisol regulation. In a summer camp context, school-aged maltreated (n = 265) and nonmaltreated (n = 288) children provided morning and late afternoon saliva samples…

  16. Diagnosis Of Aphasia Using Neural And Fuzzy Techniques

    DEFF Research Database (Denmark)

    Jantzen, Jan; Axer, Hubertus; Keyserlingk, Diedrich Graf von

    2002-01-01

    The language disability aphasia has several sub-diagnoses such as Amnestic, Broca, Global, and Wernicke. Data concerning 265 patients is available in the form of test scores and diagnoses, made by physicians according to the Aachen Aphasia Test. A neural network model has been built, which...

  17. Diagnosis of aphasia using neural and fuzzy techniques

    DEFF Research Database (Denmark)

    Jantzen, Jan; Axer, H.; Keyserlingk, D. Graf von

    2000-01-01

    The language disability Aphasia has several sub-diagnoses such as Amnestic, Broca, Global, and Wernicke. Data concerning 265 patients is available in the form of test scores and diagnoses, made by physicians according to the Aachen Aphasia Test. A neural network model has been built, which...

  18. Light-related variation in sapling architecture of three shade-tolerant tree species of the Mexican rain forest

    NARCIS (Netherlands)

    Martinez-Sanchez, J.L.; Meave, J.; Bongers, F.

    2008-01-01

    The crown architecture of three shade-tolerant tree species (two subcanopy and one mid-canopy) was analyzed in relation to the light regime of the forest understorey. The aim was to examine to which extent shade-tolerant species variate in their crown architecture. Tree saplings (265) between 50 and

  19. Page 1 635 Ethiopian Journal of Environmental Studies ...

    African Journals Online (AJOL)

    USER

    2015-08-10

    Aug 10, 2015 ... minimize the income fluctuation or, to supplement the working capital (26.5%) for their ... most important sector of the national economy in terms of ..... migration. Diversification as a strategy involves the attempt by individuals and households to find new ways to raise income and reduce risk. Ellis, (1998) and.

  20. Calibrating your grain drill or seeder can save both seed and money

    Science.gov (United States)

    The agronomic impact of over-seeding or under-seeding a field is complex. Most farmers have worked out a seeding rate with their agronomist. Exceeding that rate may not be productive, especially at $265+ per bag of alfalfa ($500 for switchgrass). Over-seeding costs add up, even across a small number...

  1. Trachydiscus minutus, a New Biotechnological Source of Eicosapentaenoic acid

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Petránková, Mirka; Cepák, Vladislav; Přibyl, Pavel; Sigler, Karel; Cajthaml, Tomáš

    2010-01-01

    Roč. 55, č. 3 (2010), s. 265-269 ISSN 0015-5632 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60050516 Keywords : MICROALGA ISOCHRYSIS-GALBANA * NANNOCHLOROPSIS SP * PHAEODACTYLUM-TRICORNUTUM Subject RIV: EE - Microbiology, Virology Impact factor: 0.977, year: 2010

  2. Traumatic brain injury in Denmark 1979-1996. A national study of incidence and mortality

    DEFF Research Database (Denmark)

    Engberg, Aase Worså; Teasdale, T W

    2001-01-01

    hospitalised under diagnoses ICD 800, 801, 803, 850-854 decreased 41% from 265 to 157 per 100,000 of the population per year. Decreases were 42% for ICD 850, brain concussion, 56% for ICD 800, 801, 803, cranial fractures, and 16% for ICD 851 854, structural brain injury. The percentage of cases with ICD 851...

  3. Atomic displacements due to interstitial hydrogen in Cu and Pd

    Indian Academy of Sciences (India)

    c Indian Academy of Sciences. Vol. 69, No. 2. — journal of. August 2007 physics pp. 255–265. Atomic displacements due to interstitial hydrogen in Cu and Pd ..... Phys. 64, 1015 (1992). [7] Martin Fuchs and Matthias Scheffer, Comput. Phys. Commun. 119, 67 (1999). [8] Hitesh Sharma and S Prakash, Pramana – J. Phys.

  4. Annual Report of the Inhalation Toxicology Research Institute 1991-1992

    Science.gov (United States)

    1992-12-01

    monkey exposure system. 60 During the experiment, the monkey’s mouth was taped closed to ensure nasal breathing. A specially made face mask with a... Osteogenesis . Clin. Orthop. Rel. Res. 269: 257-265, 1991. Bagi, C. M. and S. C. Miller: Dose-Related Effects of 1,25-Dihydroxyvitamin D3 on Growth

  5. The great cormorant Phalacrocorax carbo is widely distributed in ...

    African Journals Online (AJOL)

    denise

    and the freshwater species, the rest either have an es- tuarine phase in their life cycle or occur in estuaries. The fish in the regurgitations varied greatly in size, from the smallest, a Moçambique tilapia of 28 mm standard length (SL), to the largest, a freshwater mullet of 265 mm SL. Three of the four most common prey species ...

  6. Inside Public Television

    Science.gov (United States)

    Wurtzel, Alan

    1977-01-01

    In the continuing saga of the perils of public television, the author, University of Georgia School of Journalism TV Coordinator, gives the viewer an inside look at the unwieldy structure of this non-commercial medium. Today's episode: Will high-quality programming survive? The players: 265 independent public TV stations, a decentralized public TV…

  7. Comparisons of competitive enzyme-linked immunosorbent assay ...

    African Journals Online (AJOL)

    The aim of this study was to comprise competitive enzyme-linked immunosorbent assay (C-ELISA) with one step RT-PCR test for the detection of BTV in sheep. A total of 770 blood samples were obtained from sheep (265 serum positive samples and 505 serum negative samples in C-ELISA). According to our data, out of ...

  8. Utilizing linkage disequilibrium information from Indian Genome ...

    Indian Academy of Sciences (India)

    References. Barrett J. C., Fry B., Maller J. and Daly M. J. 2005 Haploview, anal- ysis and visualization of LD and haplotype maps. Bioinformatics. 21, 263–265. Bahl S., Virdi K., Mittal U., Sachdeva M. P., Kalla A. K., Holmes. S. E. et al. 2005 Evidence of a common founder for SCA12 in the Indian population. Ann. Hum. Genet.

  9. Cyber Situation Awareness through Instance-Based Learning: Modeling the Security Analyst in a Cyber-Attack Scenario

    Science.gov (United States)

    2012-01-01

    Chocolate Avenue Hershey PA 17033 Tel: 717-533-8845 Fax: 717-533-8661 E-mail: cust@igi-global.com Web site: http://www.igi-global.com Copyright © 2011...Lawrence Erlbaum Associates. Anderson, J. R., & Lebiere, C. (2003). The New- ell test for a theory of mind. The Behavioral and Brain Sciences, 26(5

  10. Impact of Online Social Network on American College Students' Reading Practices

    Science.gov (United States)

    Huang, SuHua; Capps, Matthew

    2013-01-01

    The purpose of this study was to investigate social networking sites (SNS) and ways college students spend their time on both conventional academic and recreational reading. A total of 1,265 (466 male and 799 female) college students voluntarily participated in the study by completing a self-report survey. Descriptive analysis indicated that the…

  11. Download

    African Journals Online (AJOL)

    Nazlı

    2017-12-29

    Dec 29, 2017 ... plants is invaluable in this sense. ... Essential oil of plant as the subject of this study was obtained from TP which is common in the Sivas province. ..... and chalcones. Pharmacol Res; 57: 259-265. 23. NCCLS (National Committee for Clinical Laboratory Standards) (1997).Performance standards for.

  12. Anodic Stripping Voltammetry for Arsenic Determination on Composite Gold Electrode

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Kopanica, M.; Krista, J.

    2003-01-01

    Roč. 48, č. 2 (2003), s. 265-272 ISSN 0009-2223 Grant - others:GIT(AR) 101/02/U111/CZ Institutional research plan: CEZ:AV0Z4040901 Keywords : arsenic determination * stripping voltammetry * composite gold electrode Subject RIV: CG - Electrochemistry Impact factor: 0.415, year: 2003

  13. Wideband Piezomagnetoelastic Vibration Energy Harvesting

    DEFF Research Database (Denmark)

    Lei, Anders; Thomsen, Erik Vilain

    2014-01-01

    softening effect. In linear operation (without magnets) the harvester generates a RMS power of 141 μW/g2 at 588 Hz with a relative bandwidth of 3.8% over a 100 kΩ load resistor. When operated with one magnet ideally positioned opposite the cantilever, a RMS power of 265 μW/g2 is generated at 270 Hz...

  14. The barriers preventing effective treatment of South African patients ...

    African Journals Online (AJOL)

    Diagnoses included unipolar depression (30%), bipolar mood disorder (40%) and schizophrenia / schizoaffective disorder (13%). 49% of respondents suffered from one or more types of anxiety. The median age of symptom onset for respondents was 26.5, with the median respondent waiting two years before seeking help.

  15. 77 FR 49852 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

    Science.gov (United States)

    2012-08-17

    .... Public Agency: County of Gregg, Longview, Texas. Application Number: 12-03-C-00-GGG. Application Type...,066,265 $6,669,248 04/01/16 12/01/16 *02-02-C-01-GGG, Longview, TX 07/10/12 699,232 699,232 12/01/12...

  16. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Keyhole depth instability in case of CW CO2 laser beam welding of mild steel · N Kumar S Dash A K ... April 2011 pp 251-265. Melt pool vorticity in deep penetration laser material welding ... April 2013 pp 235-246. Study of dimensionless quantities to analyse front and rear wall of keyhole formed during laser beam welding.

  17. Fine Needle Aspiration Cytology in Pediatric Age Group with Special ...

    African Journals Online (AJOL)

    hanumantp

    the commonest diagnosis among all mass lesions 38.8% (103/265), whereas Fibroadenoma. 20.8% (10/49) was commonest diagnosis among benign lesions and among malignant lesions there were two cases 15.3% (2/13) each of Hodgkins and non‑Hodgkins lymphoma and one case of chondrosarcoma. The positive ...

  18. Work-related smartphone use, work–family conflict and family role performance: The role of segmentation preference

    NARCIS (Netherlands)

    Derks, D.; Bakker, A.B.; Peters, P.; Wingerden, P. van

    2016-01-01

    Is work-related smartphone use during off-job time associated with lower conflict owing to the blurring of the boundaries between work and family life? Or does it help employees juggling work and family demands? The present four-day quantitative diary study (N = 71 employees, N = 265–280 data

  19. Galectin 3

    DEFF Research Database (Denmark)

    Stoltze Gaborit, Freja; Bosselmann, Helle; Kistorp, Caroline

    2016-01-01

    and 24-h urinary albumin excretion (albuminuria). METHODS: We prospectively enrolled 132 patients with reduced left ventricular ejection fraction (LVEF) referred to an outpatient HF clinic. The patients had a median age of 70 years (interquartile rage: 64-75), 26.5 % were female, median LVEF was 33 % (27...

  20. Kinetics of the field induced commensurate to ferro-electric phase transition in thiourea

    Czech Academy of Sciences Publication Activity Database

    Liss, K.D.; Kaiser, M.; Hlinka, Jiří; Denoyer, F.; Hock, R.; Currat, R.

    2003-01-01

    Roč. 36, - (2003), s. A172-A176 ISSN 0022-3727 R&D Projects: GA ČR GA202/99/D066 Institutional research plan: CEZ:AV0Z1010914 Keywords : commensurate * thiourea * time-resolved Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.265, year: 2003

  1. Nad edicí Kochemova Velikého života aneb Znovu k metodám vydávání raněnovověké literatury

    Czech Academy of Sciences Publication Activity Database

    Malura, Jan

    2009-01-01

    Roč. 57, č. 2 (2009), s. 253-265 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Early Modern Period * von Cochem, Martin Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Strategy, Theory, Tactical Possibilities and the Design of Amphibious Concepts

    Science.gov (United States)

    2012-05-17

    the process of learning and pierce the veil of uncertainty that lies between the protagonists, a gambit must be made—sufficient energy must be...aircraft. Martin Middlebrook, Operation Corporate : The Falklands War, 1982 (London: Viking, 1985), 265. 30 ready group of approximately 2000 soldiers...Forces group 139 Middlebrook, Operation Corporate : The Falklands War, 1982, 78. 140 Moro

  3. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  4. Attitudes and Perceptions of Healthcare Providers and Medical ...

    African Journals Online (AJOL)

    Purpose: To explore healthcare providers' (HCPs) and medical students' attitudes to, and perceptions of the pharmaceutical services that clinical pharmacists can provide in United Arab Emirates. Methods: A total of 535 participants (265 HCPs and 270 medical students) were asked to complete a questionnaire over a ...

  5. Atmosphere beyond Poetics

    DEFF Research Database (Denmark)

    Wieczorek, Izabela

    2014-01-01

    Physical Presence in Space.” Oase #91, Building Atmosphere, 21-33 Sloterdijk, Peter. (2005) 2008. “The Crystal Palace.” Translated by Michael Darroch. Public 37: Public?, 12-15. Originally published in Peter Sloterdijk. Im Weltinnenraum des Kapitals: Für eine philoso-phische Theorie der Globalisierung, 265...

  6. Density-functional study of the CO adsorption on the ferromagnetic fcc Co(001) film surface

    Czech Academy of Sciences Publication Activity Database

    Pick, Štěpán

    2010-01-01

    Roč. 604, 3-4 (2010), s. 265-268 ISSN 0039-6028 Institutional research plan: CEZ:AV0Z40400503 Keywords : Density functional calculations * chemisorption * magnetic films Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.010, year: 2010

  7. Organic amendment optimization for treatment of hydrocarbon ...

    African Journals Online (AJOL)

    Jane

    2010-10-18

    Oct 18, 2010 ... Houston, Texas 7-11 Nov. Adams RH, Domínguez VI, Vinalay L (2002). Evaluation of microbial respiration and ecotoxicity in contaminated soils representative of the pretroleum producing region of southeastern México. TERRA. Latinoamericana, 20(3): 253-265. Adams RH, Guzmán FJ (2008). Evaluation ...

  8. South African Journal of Higher Education - Vol 18, No 1 (2004)

    African Journals Online (AJOL)

    Selection for the Science Foundation Programme (University of Natal): the development of a selection instrument · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Grussendorff, M Liebenberg, J Houston, 265-272. http://dx.doi.org/10.4314/sajhe.v18i1.25442 ...

  9. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-05-01

    May 1, 2017 ... Types of Cancers Diagnosed and the. Preference of Families of Adult Patients with Cancer about Disclosing Diagnosis to the Patient. J Health Sci .... breast cancers (26.5%), colorectal cancers (19.3%) ... Table 3: Socio-demographic characteristics of attendants of cancer patients, SPHMMC, June 2015.

  10. Pramana Volume 7

    Indian Academy of Sciences (India)

    chloro 3-nitrobenzoic acid -- V S S Sastry and J Ramakrishna. 146-151. The x-ray anomalous ... On the formation of silver specks in silver halide crystals -- Mahendra Singh and A P Sharma, 255-265. Critical point phenomena in the ...

  11. Factors affecting growth and viability of natural diatom populations in the meso-eutrophic Římov Reservoir (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Znachor, Petr; Rychtecký, Pavel; Nedoma, Jiří; Visocká, Veronika

    2015-01-01

    Roč. 762, č. 1 (2015), s. 253-265 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : diatom * growth rate * viability * PDMPO * SYTOX green * reservoir Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.051, year: 2015

  12. Double spin asymmetry in exclusive rho(0) muoproduction at COMPASS

    Czech Academy of Sciences Publication Activity Database

    Alekseev, M.; Alexakhin, V. Yu.; Alexandrov, Yu.; Alexeev, G. D.; Amoroso, A.; Arbuzov, A.; Badelek, B.; Balestra, F.; Ball, J.; Baum, G.; Barth, J.; Bedfer, Y.; Bernet, C.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.; Chapiro, A.; Chiosso, M.; Cicuttin, A.; Colantoni, M.; Costa, S.; Crespo, M.; d'Hose, N.; Dalla Torre, S.; Das, S.; Dasgupta, S. S.; De Masi, R.; Dedek, N.; Denisov, O.; Dhara, L.; Diaz, V.; Dinkelbach, A.; Donskov, S.; Dorofeev, V.; Doshita, N.; Duic, V.; Dünnweber, W.; Eversheim, P.; Eyrich, W.; Fabro, M.; Faessler, M.; Falaleev, V.; Ferrero, A.; Ferrero, L.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Franz, J.; Friedrich, J.; Frolov, V.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gobbo, B.; Goertz, S.; Gorin, A. M.; Grabmüller, S.; Grajek, O.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; Hannappel, J.; von Harrach, D.; Hasegawa, T.; Heckmann, J.; Hedicke, S.; Heinsius, F.; Hermann, R.; Hess, C.; Hinterberger, F.; von Hodenberg, M.; Horikawa, N.; Horikawa, S.; Ilgner, C.; Ioukaev, A.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Janata, A.; Jasinski, P.; Joosten, R.; Jouravlev, N. I.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.; Khokhlov, Y.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.; Kolosov, V.; Komissarov, E.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V.; Korentchenko, A.; Korzenev, A.; Kotzinian, A.; Koutchinski, N.; Kouznetsov, O.; Kravchuk, N.; Kral, A.; Kroumchtein, Z.; Kuhn, R.; Kunne, F.; Kurek, K.; Ladygin, M.; Lamanna, M.; Le Goff, J.; Lednev, A.; Lehmann, A.; Lichtenstadt, J.; Liska, T.; Ludwig, I.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Maximov, A.; Meyer, W.; Mielech, A.; Mikhailov, Y.; Moinester, M.; Mutter, M.; Nähle, O.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Neliba, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.; Nikolaev, K.; Olshevsky, A.; Ostrick, M.; Padee, A.; Pagano, P.; Panebianco, S.; Panknin, R.; Panzieri, D.; Paul, S.; Pawlukiewicz-Kaminska, B.; Peshekhonov, D.; Peshekhonov, V.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.; Pretz, J.; Procureur, S.; Quintans, C.; Rajotte, J.; Rapatsky, V.; Ramos, S.; Reicherz, G.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Rozhdestvensky, A.; Ryabchikov, D.; Samoylenko, V.; Sandacz, A.; Santos, H.; Sapozhnikov, M.; Sarkar, S.; Savin, I.; Schiavon, P.; Schill, C.; Schmitt, L.; Schönmeier, P.; Schröder, W.; Shevchenko, O.; Siebert, H.; Silva, L.; Sinha, L.; Sissakian, A.; Slunecka, M.; Smirnov, G.; Sosio, S.; Sozzi, F.; Sugonyaev, V.; Srnka, Aleš; Stinzing, F.; Stolarski, M.; Sulc, M.; Sulej, R.; Takabayashi, N.; Tchalishev, V.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.; Venugopal, G.; Virius, M.; Vlassov, N.; Vossen, A.; Webb, R.; Weise, E.; Weitzel, Q.; Windmolders, R.; Wirth, S.; Wislicki, W.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Zhao, J.; Ziegler, R.; Zvyagin, A.

    2007-01-01

    Roč. 52, č. 2 (2007), s. 255-265 ISSN 1434-6044 R&D Projects: GA MŠk ME 492 Institutional research plan: CEZ:AV0Z20650511 Keywords : double spin asymmetry * polarized deuterons * scattering * COMPASS Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.255, year: 2007

  13. Youth and the Ethics of Identity Play in Virtual Spaces

    Science.gov (United States)

    Siyahhan, Sinem; Barab, Sasha; James, Carrie

    2011-01-01

    In this study, we explored a new experimental methodology for investigating children's (ages 10 to 14) stances with respect to the ethics of online identity play. We used a scenario about peer identity misrepresentation embedded in a 3D virtual game environment and randomly assigned 265 elementary students (162 female, 103 male) to three…

  14. An environmental assessment of United States drinking water watersheds

    Science.gov (United States)

    James Wickham; Timothy Wade; Kurt Riitters

    2011-01-01

    Abstract There is an emerging recognition that natural lands and their conservation are important elements of a sustainable drinking water infrastructure. We conducted a national, watershed-level environmental assessment of 5,265 drinking water watersheds using data on land cover, hydrography and conservation status. Approximately 78% of the conterminous United States...

  15. Sídliště raného až staršího eneolitu v Hřebči, okr. Kladno. Příklad dlouhodobě otevřeného pravěkého objektu

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Miroslav; Zápotocký, Milan

    2009-01-01

    Roč. 61, č. 2 (2009), s. 265-284 ISSN 0323-1267 R&D Projects: GA ČR GA404/08/1176 Institutional research plan: CEZ:AV0Z80020508 Keywords : Eneolithic * Late Lengyel * Jordanów culture * Michelsberg culture * Funnel Beaker culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Diversity, distribution and host-species associations of epiphytic orchids in Nepal

    Czech Academy of Sciences Publication Activity Database

    Timsina, Binu; Rokaya, Maan Bahadur; Munzbergová, Z.; Kindlmann, Pavel; Shrestha, B.; Bhattarai, Bishnu Prasad; Raskoti, B. B.

    2016-01-01

    Roč. 25, č. 13 (2016), s. 2803-2819 ISSN 0960-3115 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : vascular epiphytes * vertical stratification * elevational gradients * kathmandu valley * tree utilization * forest * richness * mexico * conservation * abundance * Species richness * Composition * Host * Traits * Nepal Himalaya Subject RIV: EF - Botanics Impact factor: 2.265, year: 2016

  17. Vaccinia complement control protein: Multi-functional protein and a ...

    Indian Academy of Sciences (India)

    Unknown

    molecule and potential drug. [Jha P and Kotwal G J 2003 Vaccinia complement control protein: Multi-functional protein and a potential wonder drug; J. Biosci. 28 265–271]. 1. Introduction. The pathogen-host interaction is a dynamic phenomenon which involves generation of defense mechanism by host and its evasion by ...

  18. Video and photographic spectroscopy of 1998 and 2001 Leonid persistent trains from 300 to 930 nm

    Czech Academy of Sciences Publication Activity Database

    Abe, S.; Ebizuka, N.; Murayama, H.; Ohtsuka, K.; Sugimoto, S.; Yamamoto, M.; Yano, H.; Watanabe, J.; Borovička, Jiří

    2005-01-01

    Roč. 95, 1-4 (2005), s. 265-277 ISSN 0167-9295. [Meteoroids 2004. London, Ontario, 16.08.2004-20.08.2004] Institutional research plan: CEZ:AV0Z1003909 Keywords : airglow * Leonid meteor * shower Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.975, year: 2005

  19. trisubstituted imidazoles by using microwave irradiation under

    Indian Academy of Sciences (India)

    Administrator

    Shen M, Cai C and Yi W 2008 J. Fluorine Chem. 129. 541. 44. Kidwai M, Mothsra P, Bansal V, Somvanshi R K,. Ethayathulla A S, Dey S and Singh T P 2007 J. Mol. Catal. A: Chem. 265 177. 45. Khosropour A R 2008 Ultrason. Sonochem. 15 659. 46. Sharma S D, Hazarika P and Konwar D 2008 Tetra- hedron Lett. 49 2216.

  20. VizieR Online Data Catalog: Group of early-type galaxies (Fraix-Burnet+, 2010)

    Science.gov (United States)

    Fraix-Burnet, D.; Dugue, M.; Chattopadhyay, T.; Chattopadhyay, A. K.; Davoust, E.

    2011-03-01

    We thus chose the data compiled and standardized by Hudson et al. (2001, Cat. J/MNRAS/327/265) for 699 early-type galaxies in 56 clusters, in the redshift range from 0.007 to 0.053 (Streaming Motions of Abell Clusters (SMAC) catalogue). (1 data file).

  1. Untitled

    Indian Academy of Sciences (India)

    Knight J C, Leveson N G 1986 Proc. of 16th Int. Symp. on Fault Tolerant Computing, Vienna (Silver. Spring, MD: IEEE Comput. Soc. Press) pp. 165–170. Kopetz H 1985 in Resilient computing systems (London: Collins). Lampson B, Sturgis H 1981 Lect. Notes Comput. Sci. 105: 246—265. Lee P A, Anderson T 1985 in ...

  2. Show-Bix &

    DEFF Research Database (Denmark)

    2014-01-01

    The anti-reenactment 'Show-Bix &' consists of 5 dias projectors, a dial phone, quintophonic sound, and interactive elements. A responsive interface will enable the Dias projectors to show copies of original dias slides from the Show-Bix piece ”March på Stedet”, 265 images in total. The copies are...

  3. "You Cannot Talk with All of the Strangers in a Pub": A Longitudinal Case Study of International Postgraduate Students' Social Ties at a British University

    Science.gov (United States)

    Schartner, Alina

    2015-01-01

    The formation of social ties is a major factor in the international student experience (Ramsay et al. in High Educ 54(2):247-265, 2007), influencing student wellbeing and adjustment to the new academic and sociocultural environment (Ward et al. in The psychology of culture shock. Routledge, Hove, 2001). Although a significant body of research in…

  4. Börsitöötajad teevad aktsiad rahaks / Virge Lahe

    Index Scriptorium Estoniae

    Lahe, Virge

    2008-01-01

    Dubai börsi aktsiate ülevõtmispakkumise hind OMX-le on 265 Rootsi krooni aktsia eest. Pakkumine puudutab ka tütarfirma Tallinna börsi töötajaid, kes said emafirmalt OMX AB aktsiad kingituseks. Diagramm: OMX-i aktsia hind

  5. SAJAA ND 24-29 new ted)-.fh9

    African Journals Online (AJOL)

    Studio G5

    2). 26.5. 27.8. 0.65. -6.9 to 4.4. (5.8). (5.2). RPP. 9996. 9663. 0.78. -2124 to 2789. (2852). (2353). Data are presented as mean (standard deviation). ..... Calvo R, Telletxea S, Leal N, Aguilera L, Suarez E, De La FL, Martin-Suarez A, Lukas.

  6. Pattern of Fingertip injuries Amongst Patients Admitted at a ...

    African Journals Online (AJOL)

    78.4% of injuries took place at home and all were unintentional or accidental. The fingers most commonly involved were the little finger (26.5 %), the middle finger (20.4%) and the thumb (16.3%). Majority were soft tissue injuries (74.5%) with a smaller number undergoing some degree of amputation (25.5%). Most patients ...

  7. Classification of Spectra of Emission Line Stars Using Machine Learning Techniques

    Czech Academy of Sciences Publication Activity Database

    Bromová, P.; Škoda, Petr; Vážný, Jaroslav

    2014-01-01

    Roč. 11, č. 3 (2014), s. 265-273 ISSN 1476-8186 R&D Projects: GA ČR GA13-08195S Institutional support: RVO:67985815 Keywords : Be star * stellar spectrum * feature extraction Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  8. Manohar V Kulkarni

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Manohar V Kulkarni. Articles written in Journal of Chemical Sciences. Volume 116 Issue 5 August 2004 pp 265-270. Synthesis of spiro[indolo-1,5-benzodiazepines] from 3-acetyl coumarins for use as possible antianxiety agents · Raviraj A Kusanur Manjunath Ghate Manohar ...

  9. Prevalence and Correlates of Spouse Violence Among Women in a ...

    African Journals Online (AJOL)

    Method: Three hundred and twenty one participants, who were patients and/or mothers of (children) patients, were selected through a systematic sampling method; 265 of them eventually participated in the study (82.5% response rate). A questionnaire on domestic violence was used to collect data. The data were analyzed ...

  10. La educación como conflicto intercultural en América Latina : el caso de los movimientos indígenas del CRIC (Colombia) y la CONAIE (Ecuador) /

    OpenAIRE

    González Terreros, María Isabel

    2011-01-01

     tesis que para obtener el grado de Doctor en Estudios Latinoamericanos, presenta María Isabel González Terreros ; asesor Silvia Soriano Hernández. VII, 265 páginas : fotografías, mapas. Doctorado en Estudios Latinoamericanos UNAM, Facultad de Filosofía y Letras, 2011

  11. Dissolved petroleum hydrocarbon concentrations in some regions of the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.; Qasim, S.Z.; Fondekar, S.P.; Topgi, R.S.

    Dissolved petroleum hydrocarbons were measured in some parts of the Northern Indian Ocean using UV bsorbance technique with a clean up step. The concentration of oil ranged from 0.6 to 26.5 mu gl. Higher values were recorded along the oil tanker...

  12. Download this PDF file

    African Journals Online (AJOL)

    Funk. Anal. 3:35-40. 10. Hayman, WK. (1989). Subharmonic Functions. Vol. 2, Academic Press, New. York. 11. Paley/A." (1932). Note on'integral function Proc. Cambridge Phil. Soc. 28:262—265. 12;'Petrenko; VP. (1969). The growth of meromophic functions of finite lower order. Izv. Akad. Navk. USSR 33:414—454. 7.

  13. IR laser ablative desulfurization of poly (1,4-phenylene sulfide)

    Czech Academy of Sciences Publication Activity Database

    Durani, S. M. A.; Khawaja, E. E.; Masoudi, H. M.; Bastl, Zdeněk; Šubrt, Jan; Galíková, Anna; Pola, Josef

    2005-01-01

    Roč. 73, č. 1 (2005), s. 145-149 ISSN 0165-2370 R&D Projects: GA ČR GA104/04/2028 Institutional research plan: CEZ:AV0Z40400503 Keywords : poly (1,4-phenylene sulfide) * laser ablation * desulfurization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.265, year: 2005

  14. Supplementary 1

    Indian Academy of Sciences (India)

    moj

    The name and origin of studied oily sunflower genotypes under well watered and water stressed conditions over two years. No. Name. Origin. Research centre No. Name. Origin. Research centre. 1 H100A/83HR4 France. ASGROW. 51 RHA265. France. ASGROW. 2 H209A/LC1064 France. ASGROW. 52 PM1-3. USA.

  15. Fadiya et al (8)

    African Journals Online (AJOL)

    big timmy

    da Universidade de Sao Paulo, 265 (Geologia. 20), 3-140, pls 1-21. Petters, S. W. 1979. Some Late Tertiary. Foraminifera from Parabe-1 well, Western. Niger Delta. Rev. Esp. De Micropaleontologia. 11: 119-133. Pijpers, P. J. 1933. Geology and Paleontology of. Bonaire (D.W.I). Univ. Utrecht Geogr. Geol. Med., Phy. – Geol.

  16. Komunistická strana Československa ve volbách roku 1946

    Czech Academy of Sciences Publication Activity Database

    Pernes, Jiří

    2017-01-01

    Roč. 10, č. 1 (2017), s. 265-289 ISSN 1803-411X Institutional support: RVO:68378114 Keywords : Czechoslovakia * elections * Communist Party of Czechoslovakia * pre-election struggle * campaigning Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  17. Monte Carlo modeling of Standard Model multi-boson production processes for $\\sqrt{s} = 13$ TeV ATLAS analyses

    CERN Document Server

    Li, Shu; The ATLAS collaboration

    2017-01-01

    Proceeding for the poster presentation at LHCP2017, Shanghai, China on the topic of "Monte Carlo modeling of Standard Model multi-boson production processes for $\\sqrt{s} = 13$ TeV ATLAS analyses" (ATL-PHYS-SLIDE-2017-265 https://cds.cern.ch/record/2265389) Deadline: 01/09/2017

  18. Effect of detergent and sawdust addition on hydrocarbon reduction ...

    African Journals Online (AJOL)

    Soil Total Hydrocarbon Content (THC) and okra growth performance (shoot length, leaf number, root length, total fresh weight, dry weight, leaf area and leaf area ratio) were analyzed. Results showed significant (p=0.05) reductions in THC of 44.23%, 26.5%, 70.80% and 10.79%, in detergent (20 g), sawdust (200 g), ...

  19. Re-oxidation phenomena during the filtration of steel by means of ceramic filters

    Czech Academy of Sciences Publication Activity Database

    Stránský, K.; Bažant, J.; Dobrovská, J.; Rek, Antonín; Horáková, D.

    2009-01-01

    Roč. 43, č. 5 (2009), s. 261-265 ISSN 1580-2949 Institutional research plan: CEZ:AV0Z20650511 Keywords : filtration of steel * ceramic filters * capillary tube re-oxidation * micro-cleanliness of steel Subject RIV: JG - Metallurgy Impact factor: 0.143, year: 2009 http://www.imt.si/Revija/izvodi/mit095/stransky.pdf

  20. Kurtuncu et al., Afr J Tradit Complement Altern Med. (2016) 13(3):66 ...

    African Journals Online (AJOL)

    complementary and alternative therapies in parents with no psychiatric disorder or communication problems and who had children that had been diagnosed with cancer at least one .... 50% were making use of treatment and cures concocted with various items of food or drink. Among these, 26.5% said they resorted to these ...

  1. Factors associated with infant feeding practices and nutritional ...

    African Journals Online (AJOL)

    Stunting level among the children was 26.5%, underweight level was 11.1% and no child was wasted. There was a significant association between marital status, children age group and stunting using ordinal regression. Conclusion: The study showed a knowledge gap on infant complementary feeding in area of quality ...

  2. Vaccinia virus Vaccinia complement control protein: Multi-functional ...

    Indian Academy of Sciences (India)

    Unknown

    Mysteries of the smallpox vaccine. 141. Viral mimicry. Viral mimicry of the complement system. 249. Viral molecules. Vaccinia complement control protein: Multi-functional pro- tein and a potential wonder drug. 265. Viral pneumonia. Severe acute respiratory syndrome (SARS): an old virus jumping into a new host or a new ...

  3. Technology use among Ghanaian Senior High School mathematics ...

    African Journals Online (AJOL)

    The findings revealed that the extent to which SHS mathematics teachers use technology in teaching was very low. The Independent samples t-test revealed that the male mathematics teachers use more technology (Mean = 2.65, SD = 1.12) than the female teachers (Mean = 1.51, SD =0.47) and teachers with high ...

  4. Flowering phenology and reproductive effort of the invasive alien plant Heracleum mantegazzianum

    Czech Academy of Sciences Publication Activity Database

    Perglová, Irena; Pergl, Jan; Pyšek, Petr

    2006-01-01

    Roč. 78, - (2006), s. 265-285 ISSN 0032-7786 R&D Projects: GA ČR GA206/05/0323; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : invasions * phenology * fecundity Subject RIV: EF - Botanics Impact factor: 2.119, year: 2006

  5. Surface-induced dissociation and reactions of cations and dications C7H8 center dot+/2+, C7H7+/center dot 2+ and C7H62+: Dependence of mass spectra of product ions on incident energy of the projectiles

    Czech Academy of Sciences Publication Activity Database

    Feketeová, L.; Tepnual, T.; Grill, V.; Roithová, Jana; Herman, Zdeněk; Märk, T. D.

    2007-01-01

    Roč. 265, - (2007), s. 337-346 ISSN 1387-3806 R&D Projects: GA AV ČR KJB4040302; GA AV ČR IAA4040405 Institutional research plan: CEZ:AV0Z40400503 Keywords : toluene * ion-surface collisions * surface-induced-dissociation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.411, year: 2007

  6. Pricing strategies for information goods

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    While electronic markets have enabled the lowering of search costs for consumers they have also brought about an equally profound ..... Pricing strategies for information goods. 265. Table 1. Bundling information goods. Willingness to pay ($). User type. MS Word. MS Excel. Bundle. Accountant. 5. 45. 50. Author. 45. 5. 50.

  7. Comunicación humana

    OpenAIRE

    Revista Chasqui

    2011-01-01

    La mirada del autor. Lo específicamente humano de la comunicación humana. Estraído de Manuel Martín Serrano, 2007, "Teoría de la comunicación. La comunicación la vida y la sociedad" p. 265. Madrid, McGraw-Hill / interamericana de España.

  8. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 119; Issue 3. Volume 119, Issue 3. June 2010, pages 229-396. pp 229-247. Active and break ... a quasi 5-day wave is also noticed with significant amplitude. pp 265-283. Assessing climate change impacts on water balance in the Mount Makiling forest, Philippines.

  9. Assessment of Native Languages for Food Safety Training Programs for Meat Industry Employees

    Science.gov (United States)

    Olsen, Sherrlyn S.; Cordray, Joseph C.; Sapp, Stephen; Sebranek, Joseph G.; Anderson, Barbara; Wenger, Matt

    2012-01-01

    Challenges arise when teaching food safety to culturally diverse employees working in meatpacking and food manufacturing industries. A food safety training program was developed in English, translated into Spanish, and administered to 1,265 adult learners. Assessments were conducted by comparing scores before and immediately following training.…

  10. Estimates of Quantum Chemical Molecular Characteristics for Complete Basis Sets

    Czech Academy of Sciences Publication Activity Database

    Zahradník, Rudolf; Šroubková, Libuše

    2003-01-01

    Roč. 43, 3/4 (2003), s. 243-265 ISSN 0021-2148 Institutional research plan: CEZ:AV0Z4040901 Keywords : ab initio calculations * basis set extrapolations * quantum chemical Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.722, year: 2003

  11. cutaneous involvement of hodgkin lymphoma in a child

    African Journals Online (AJOL)

    2014-02-02

    Feb 2, 2014 ... Request for reprints to: L. A. Renner, Department of Child Health, University of Ghana Medical School, P.O. Box 4236,. Accra, Ghana. ... at a District Hospital for possible extra-pulmonary tuberculosis. She appeared cachectic, weight 26.5Kg, febrile, pale and had generalised non-tender discrete firm cervical ...

  12. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.

    2003-01-01

    Roč. 27, - (2003), 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  13. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.

    2003-01-01

    Roč. 27, - (2003), s. 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910; CEZ:MSM 113100003 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  14. 78 FR 42748 - Virginia Resource Advisory Committee Meetings

    Science.gov (United States)

    2013-07-17

    ...-265-5173, [email protected] . Individuals who use telecommunication devices for the deaf (TDD.... The agenda will include time for people to make oral statements of three minutes or less. Individuals... for sign language interpreting, assistive listening devices, or other reasonable accommodations for...

  15. Infection of adult Aedes aegypti and Ae. albopictus mosquitoes with the entomopathogenic fungus Metarhizium anisopliae

    NARCIS (Netherlands)

    Scholte, E.J.; Takken, W.; Knols, B.G.J.

    2007-01-01

    This study describes a laboratory investigation on the use of the insect-pathogenic fungus Metarhizium anisopliae against adult Aedes aegypti and Ae. albopictus mosquitoes. At a dosage of 1.6 × 1010 conidia/m2, applied on material that served as a mosquito resting site, an average of 87.1 ± 2.65% of

  16. Influence of pretreatment of agriculture residues on phytase ...

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... and low oil in which the increase in phytase activity was 6.85, 6.1, 5.3 and 3.0 times, respectively. Maximum phytase activity of 68 IU/ml .... that supplementation of microbial phytase to low non phytate phosphorus diets for broiler ..... measurement with the folin phenol reagent. J. Biol. Chem. 193: 265-. 275.

  17. Pattern of surgical admissions to Tikur Anbessa Hospital, Addis ...

    African Journals Online (AJOL)

    developing countries is mainly performed on acute and curable conditions('). ... 550. 2. Gastric outlet obstruction (PUD). 265. 3. Appendicitis. 258. 4. Intestinal obstruction. 229. 5. Oesophageal carcinoma. 114. 6. Abdominal trauma. 102. 7. Other GI diseases ... managing special referred cases, the majority of admission were ...

  18. Determination of short circuit stresses in an air core reactor using ...

    African Journals Online (AJOL)

    DR OKE

    Corresponding Author: e-mail: ghchitaliya@gmail.com, Tel +91-265-2637209. Abstract. This paper shows the use and effectiveness of finite element method while designing an air core reactor for determining the short circuit forces and stress ...

  19. 75 FR 64165 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-10-19

    ... Creek Approximately 265 feet +269 City of Kenedy. downstream of South 2nd Street. Ojo de Agua Creek.... Approximately 860 feet +287 upstream of the confluence with Tributary 9 to Ojo de Agua Watershed. San Antonio...-B-1066 Victory Branch Approximately 680 feet +315 Unincorporated Areas of downstream of Salt Water...

  20. Helminth parasites of the tropical gar, Atractosteus tropicus Gill, from Tabasco, Mexico

    Czech Academy of Sciences Publication Activity Database

    Salgado-Maldonado, G.; Moravec, František; Cabanas-Carranza, G.; Aguilar-Aguilar, R.; Sánchez-Nava, P.; Báez-Valé, R.; Scholz, Tomáš

    2004-01-01

    Roč. 90, č. 2 (2004), s. 260-265 ISSN 0022-3395 Grant - others:Consejo Nacional de Ciencia y Tecnología (MX) 27668N Institutional research plan: CEZ:AV0Z6022909 Keywords : Helminths * fish parasites * communities Subject RIV: EG - Zoology Impact factor: 1.439, year: 2004

  1. Development and optimization of ultra-high performance supercritical fluid chromatography mass spectrometry method for high-throughput determination of tocopherols and tocotrienols in human serum

    Czech Academy of Sciences Publication Activity Database

    Pilařová, V.; Gottvald, T.; Svoboda, P.; Novák, Ondřej; Benešová, K.; Běláková, S.; Nováková, L.

    2016-01-01

    Roč. 934, AUG 31 (2016), s. 252-265 ISSN 0003-2670 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Ultra-high performance supercritical fluid chromatography * Mass spectrometry * Liquid liquid extraction Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.950, year: 2016

  2. Role of hepatic resection for patients with carcinoid heart disease

    DEFF Research Database (Denmark)

    Bernheim, A.M.; Connolly, H.M.; Rubin, J.

    2008-01-01

    OBJECTIVE: To evaluate the effects of resection of hepatic carcinoid metastases on progression and prognosis of carcinoid heart disease. PATIENTS AND METHODS: From our database of 265 consecutive patients diagnosed as having carcinoid heart disease from January 1, 1980, through December 31, 2005,...

  3. Genetic, Biochemical and Environmental Factors Associated with Pregnancy Outcomes in Newborns from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rössner ml., Pavel; Tabashidze, Nana; Dostál, Miroslav; Nováková, Zuzana; Chvátalová, Irena; Špátová, Milada; Šrám, Radim

    2011-01-01

    Roč. 119, č. 2 (2011), s. 265-271 ISSN 0091-6765 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390512 Keywords : air pollution * biomarkers * genetic polymorphisms Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.036, year: 2011

  4. Fourier analysis of cerebrospinal fluid flow velocities: MR imaging study. The Scandinavian Flow Group

    DEFF Research Database (Denmark)

    Thomsen, C; Ståhlberg, F; Stubgaard, M

    1990-01-01

    images. The phase information in the resultant image was converted to flow velocity with a calibration curve with the slope 26.5 radian.m-1.sec. The velocity versus time function was Fourier transformed and a continuous curve was fitted to the measured data with use of the first three harmonics...

  5. Untitled

    Indian Academy of Sciences (India)

    Studies on the Microbial Spoilage of Canned Food-III 265. In order to find out the optimum pH range for growth of the organism, nutrient agar, adjusted to ... culture was diluted in sterile distilled water to get a uniform suspension. This bacterial suspension was distributed in 10 ml. quantities in sterile test- tubes. The tubes ...

  6. Chondrocytic potential of allogenic mesenchymal stem cells transplanted without immunosuppression to regenerate physeal defect in rabbits

    Czech Academy of Sciences Publication Activity Database

    Gál, P.; Nečas, A.; Plánka, L.; Kecová, H.; Křen, L.; Krupa, P.; Hlučilová, Jana; Usvald, Dušan

    2007-01-01

    Roč. 76, - (2007), s. 265-275 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Grant - others:MZd(CZ) NR8483 Institutional research plan: CEZ:AV0Z50450515 Keywords : growth plate injury * bone bridge * limb deformity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.687, year: 2007

  7. Histopathological study of murine pulmonary cryptococcosis induced by Cryptococcus gattii and Cryptococcus neoformans.

    Science.gov (United States)

    Okubo, Yoichiro; Wakayama, Megumi; Ohno, Hideaki; Yamamoto, Shuhei; Tochigi, Naobumi; Tanabe, Koichi; Kaneko, Yukihiro; Yamagoe, Satoshi; Umeyama, Takashi; Shinozaki, Minoru; Nemoto, Tetsuo; Nakayama, Haruo; Sasai, Daisuke; Ishiwatari, Takao; Shimodaira, Kayoko; Yamamoto, Yoshiro; Kamei, Katsuhiko; Miyazaki, Yoshitsugu; Shibuya, Kazutoshi

    2013-01-01

    Although Cryptococcus gattii can cause life-threatening complications, putative virulence factors of C. gattii remain controversial. Therefore, we conducted the present study to elucidate the virulence factors of the yeast and found that the mortality rate of mice infected with C. gattii R265 was significantly higher than that of those infected with C. gattii 5815; however, no difference was found in the mortality rates between mice infected with C. gattii R265 and Cryptococcus neoformans H99. In contrast, we found a significant difference in histopathological findings of the lungs between mice infected with C. gattii R265 and C. neoformans H99. The former showed alveolar expansion due to yeast proliferation with much lesser macrophage response, whereas the latter showed numerous nodules in the alveolar space consisting of macrophages and multinucleated giant cells. Furthermore, alveolar expansion was more enhanced in mice infected with C. gattii R265 than in those infected with C. gattii 5815. Our study confirmed that there is a different pathophysiology leading to death during C. gattii and C. neoformans infections. The result can provide two characteristics of C. gattii: one includes some mechanisms to escape from host recognition via macrophage and another includes a high performance of pulmonary structural alteration. These characteristics may be associated with the high virulence of C. gattii.

  8. The molecular structure of N-fluorobis(trifluoromethanesulfonyl)imide, NF(SO2CF3)(2), as studied in the gas phase by electron diffraction restrained by ab initio calculations

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Brain, P. T.; Rankin, D. W. H.; Robertson, H. E.; Smart, B. A.; Banks, R. E.; Murtagh, V.

    -, č. 2 (2007), s. 265-271 ISSN 1477-9226 Grant - others:EPSRC(GB) GR/J59258 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystalline phases * fluorination * sulfone Subject RIV: CA - Inorganic Chemistry Impact factor: 3.212, year: 2007

  9. Enhanced leishmanicidal activity of cryptopeptide chimeras from the active N1 domain of bovine lactoferrin

    NARCIS (Netherlands)

    Silva, T.; Abengózar, M.A.; Fernández-Reyes, M.; Andreu, D.; Nazmi, K.; Bolscher, J.G.M.; Bastos, M.; Rivas, L.

    2012-01-01

    wo antimicrobial cryptopeptides from the N1 domain of bovine lactoferrin, lactoferricin (LFcin17-30) and lactoferrampin (LFampin265-284), together with a hybrid version (LFchimera), were tested against the protozoan parasite Leishmania. All peptides were leishmanicidal against Leishmania donovani

  10. ORIGINAL ARTICLE EVALUATION OF PRE-SERVICE TRAINING ...

    African Journals Online (AJOL)

    user

    schools to evaluate pre-service Inte- grated Management of ..... 9. 7. 5. 3. 26.5. 20.6. 14.7. 8.8. Future needs. More trained staff. More training materials. More training facilities. 31. 8. 4. 91.2. 23.5. 11.8. Ethiop J Health Sci. Vol. 20, No. 1. March 2010 ...

  11. Hypolipidemic effect of beer proteins in experiment on rats

    Czech Academy of Sciences Publication Activity Database

    Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.

    2002-01-01

    Roč. 35, č. 3 (2002), s. 265-271 ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

  12. A rapid diversification of rainforest trees (Guatteria; Annonaceae) following dispersal from Central into South America.

    NARCIS (Netherlands)

    Erkens, R.H.J.; Chatrou, L.W.; Maas, J.W.; Niet, van der T.; Savolainen, V.

    2007-01-01

    Several recent studies have suggested that a substantial portion of today¿s plant diversity in the Neotropics has resulted from the dispersal of taxa into that region rather than vicariance, but more data are needed to substantiate this claim. Guatteria (Annonaceae) is, with 265 species, the third

  13. Determination of methylmercury in cryptogams by means of GC-AFS using enzymatic hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Coufalík, Pavel; Meszarosová, N.; Coufalíková, K.; Zvěřina, O.; Komárek, J.

    2018-01-01

    Roč. 140 (2018), s. 8-13 ISSN 0026-265X Institutional support: RVO:68081715 Keywords : methylmercury * cryptogam * GC-AFS Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.034, year: 2016

  14. The Roman mortars used in the construction of the Ponte di Augusto (Narni, Italy)

    Czech Academy of Sciences Publication Activity Database

    Drdácký, Miloš; Fratini, F.; Frankeová, Dita; Slížková, Zuzana

    2013-01-01

    Roč. 38, č. 1 (2013), s. 1117-1128 ISSN 0950-0618 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : historic mortar * roman mortar * Narni bridge Subject RIV: AL - Art, Architecture, Cultural Heritage Impact factor: 2.265, year: 2013

  15. Application of Error Correcting Codes in Fault-Tolerant Logic Design for VLSI Circuits

    Science.gov (United States)

    1992-08-14

    computing, pp 258-265, test conf., Philadelphia, PA. pp 435-445, Oct. 1983. 1983. 10. Sandip Kundu,"Design of multioutput CMOS 3. J.P. Hayes,"ault Modellin...34T 151 F. 1. Ferguson and 1. P. Shen. "Extraction and simulation of realistic 1101 S Kundu. "Deign of multioutput CMOS combinational ogi. :r. CMOS

  16. Dry friction damping couple at high frequencies

    Czech Academy of Sciences Publication Activity Database

    Půst, Ladislav; Pešek, Luděk; Košina, Jan; Radolfová, Alena

    2014-01-01

    Roč. 8, č. 1 (2014), s. 91-100 ISSN 1802-680X Institutional support: RVO:61388998 Keywords : dry friction * damping * high frequencies Subject RIV: BI - Acoustics http://www.kme.zcu.cz/acm/acm/article/view/239/265

  17. The Core Periodicals in Career and Technical Education

    Science.gov (United States)

    Waugh, C. Keith

    2004-01-01

    When constructing the theoretical or conceptual framework for their research, researchers often rely heavily on a "core" set of periodicals within their discipline for articles relevant to their topic. In this study, an analysis of citations in 265 graduate student research papers, theses, and dissertation was conducted to identify the…

  18. Evaluation de la surdite professionnelle dans un departement du ...

    African Journals Online (AJOL)

    Of all ONIHL patients, 26,5% had tinnitus and 3,5% had complaints related to balance disorders. ONIHL was sensorineural, bilateral and symmetrical in 93% of cases. Univariate analysis showed no significant association between hearing loss, age, occupational exposure to noise and occupational group. Conclusion : To ...

  19. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

    2015-01-01

    Roč. 747, JUL (2015), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.787, year: 2015

  20. A Space to Collaborate

    Science.gov (United States)

    Raths, David

    2009-01-01

    This article features new library designs that offer flexible, people-centric, tech-driven environments that reflect the increasingly synergetic nature of today's campuses. Among these new library designs is the University of Calgary's Taylor Family Digital Library, a 265,000-square-foot building scheduled to open in fall 2010 and touted as the…

  1. Coherent structural trapping through wave packet dispersion during photoinduced spin state switching

    DEFF Research Database (Denmark)

    Lemke, Henrik T.; Kjær, Kasper Skov; Hartsock, Robert

    2017-01-01

    is distinguished from the structural trapping dynamics, which launches a coherent oscillating wave packet (265 fs period), clearly identified as molecular breathing. Throughout the structural trapping, the dispersion of the wave packet along the reaction coordinate reveals details of intramolecular vibronic...

  2. quantity and quality of litterfall in pure pine and pine/gmelina mixed ...

    African Journals Online (AJOL)

    KOME

    46: 237-242. Keay, R. W. J., 1959. An outlines of Nigeria vegetation. 3rd edn. Government Printer, Lagos, 43pp. Luizao, F. J. and Schubart, H. O. R., 1987. Litter production and decomposition in a terra-firme forest at Central. Amazonia. Experimentia 43: 259-265. Melin, E., 1962. Physiological aspects of mucorrhizae of forest.

  3. Process Water Recycle in Hydrothermal Liquefaction of Microalgae To Enhance Bio-oil Yield

    NARCIS (Netherlands)

    Ramos-Tercero, E.A.; Bertucco, A.; Brilman, Derk Willem Frederik

    2015-01-01

    In this work, the effect of recycling the process water (PW) of hydrothermal liquefaction (HTL) to the HTL reactor was investigated, with the objective being to recover carbon from the organic content of the PW and to develop a solvent-free process. When recycling twice the PW at 220, 240, and 265

  4. Sociocultural Influences and Body Image in 9- to 12-Year-Old Girls: The Role of Appearance Schemas

    Science.gov (United States)

    Clark, Levina; Tiggemann, Marika

    2007-01-01

    This study tested whether an individual's beliefs about the importance of appearance in their life is a mediator of sociocultural influences on body dissatisfaction in young girls. Participants were 265 girls in Grades 4 to 7 (M age = 10.71 years) from 5 private primary schools in metropolitan Adelaide, South Australia. Girls completed…

  5. The Stream-Catchment (StreamCat) Dataset: A database of watershed metrics for the conterminous USA

    Science.gov (United States)

    We developed an extensive database of landscape metrics for ~2.65 million streams, and their associated catchments, within the conterminous USA: The Stream-Catchment (StreamCat) Dataset. These data are publically available and greatly reduce the specialized geospatial expertise n...

  6. (+)- 10-camphorsulfonic acid and enrichment of enantiomeric

    Indian Academy of Sciences (India)

    WINTEC

    dron: Asymmetry 15 1809; Periasamy M, Venkatara- man L and Thomas K R J 1997 J. Org. Chem. 62 4302. 6. Ramanathan C R and Periasamy M 1998 Tetrahedron: Asymmetry 9 2651. 7. Periasamy M, Sivakumar S, Reddy M N and Padmaja. M 2004 Org. Lett. 6 265. 8. Vairaprakash P and Periasamy M 2006 J. Org. Chem.

  7. Small molecules and targeted therapies in distant metastatic disease

    DEFF Research Database (Denmark)

    Hersey, P; Bastholt, L; Chiarion-Sileni, V

    2009-01-01

    with chemotherapy. Agents targeting mutant B-Raf (RAF265 and PLX4032), MEK (PD0325901, AZD6244), heat-shock protein 90 (tanespimycin), mTOR (everolimus, deforolimus, temsirolimus) and VEGFR (axitinib) showed some promise in earlier stages of clinical development. Receptor tyrosine-kinase inhibitors (imatinib...

  8. Estimating carbon emissions from forest fires during 1980 to 1999 in ...

    African Journals Online (AJOL)

    white birch (Betula platyphylla Suk.), mixed broadleaved-conifer (L. gmelinii & B. platyphylla) and Mongolian oak (Quercus mongolica Fish.) forests were 437 947, 20 939, 142 527, 168 532 and 1 375 hm2 during 1980 to 1999 period, respectively. The fuel consumed based on these forests were 29.0 to 46.5, 16.7 to 26.5, ...

  9. Pharmacogenetic Analysis of Captopril Effects on Blood Pressure: Possible Role of the Ednrb (Endothelin Receptor Type B) Candidate Gene

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef; Dobešová, Zdenka; Zídek, Václav; Šilhavý, Jan; Šimáková, Miroslava; Mlejnek, Petr; Vaněčková, Ivana; Kuneš, Jaroslav; Pravenec, Michal

    2014-01-01

    Roč. 63, č. 2 (2014), s. 263-265 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LH11049 Institutional support: RVO:67985823 Keywords : captopril * blood pressure * QTL * Ednrb gene * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.293, year: 2014

  10. Growth as Product and as Process: Student Learning Outcomes Attained through College Experiences in China

    Science.gov (United States)

    Cen, Yuhao

    2012-01-01

    Little empirical research has been done on student learning outcomes and college experiences in China, where the gross enrollment rate in higher education reached 26.5 percent and the undergraduate population exceeded 22 million in 2010. This study seeks to describe, explain, and interpret student learning as perceived from students in Chinese…

  11. Rapports 2017-2018 sur les frais de voyage pour Jean Lebel ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    SD

    (s). 2017-05-24 au 2017-05-25. Destination(s). Toronto. Billet d'avion. 265.32 $. Frais de transport au sol ou autrement. 59.69 $. Frais de logement. 236.65 $. Repas et frais divers. 68.04 $. Autre frais. 0.00 $. Total. 629.70 $. Commentaires.

  12. Expression of the Csp protein family upon cold shock and production of tetracycline in Streptomyces aureofaciens

    Czech Academy of Sciences Publication Activity Database

    Mikulík, Karel; Quoc, Khanh-Hoang; Halada, Petr; Bezoušková, Silvia; Benada, Oldřich; Běhal, Vladislav

    1999-01-01

    Roč. 265, č. 2 (1999), s. 305-310 ISSN 0006-291X R&D Projects: GA ČR GA203/98/0422 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.161, year: 1999

  13. TIMELESS: a link between fly's circadian and photoperiodic clocks?

    Czech Academy of Sciences Publication Activity Database

    Pavelka, Jaroslav; Shimada, K.; Košťál, Vladimír

    2003-01-01

    Roč. 100, - (2003), s. 255-265 ISSN 1210-5759 R&D Projects: GA ČR GP204/02/P008; GA ČR GA206/02/0900 Institutional research plan: CEZ:AV0Z5007907 Keywords : Insect * Chymomyza costata * diapause Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.741, year: 2003

  14. 21 CFR 137.285 - Degerminated yellow corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Degerminated yellow corn meal. 137.285 Section 137... Cereal Flours and Related Products § 137.285 Degerminated yellow corn meal. Degerminated yellow corn meal, degermed yellow corn meal, conforms to the definition and standard of identity prescribed by § 137.265 for...

  15. 40 CFR 261.38 - Exclusion of comparable fuel and syngas fuel.

    Science.gov (United States)

    2010-07-01

    ... hydrogen sulfide; and (v) Contain less than 1 ppmv of each hazardous constituent in the target list of... 265 of this chapter and applicable CAA MACT standards. (iv) Gas turbines used to produce electric.... (14) Waiver of RCRA Closure Requirements. Interim status and permitted storage and combustion units...

  16. 41 CFR 101-26.506-2 - Limitations.

    Science.gov (United States)

    2010-07-01

    ... 26.5-GSA Procurement Programs § 101-26.506-2 Limitations. (a) When furniture and furnishings requirements have been developed in connection with interior planning and design services furnished by GSA, the... of furniture and furnishings as provided in §§ 101-25.302 and 101-25.404. (b) Furniture and...

  17. 41 CFR 101-26.506-1 - Types of service.

    Science.gov (United States)

    2010-07-01

    ...; softline space plans; development of an interior design program (to include finish materials, furniture and... PROGRAM 26.5-GSA Procurement Programs § 101-26.506-1 Types of service. GSA interior planning and design..., partitions, furniture, and equipment. The items specified for procurement will be selected from approved GSA...

  18. 41 CFR 101-26.505 - Office and household furniture and furnishings.

    Science.gov (United States)

    2010-07-01

    ... furniture and furnishings. 101-26.505 Section 101-26.505 Public Contracts and Property Management Federal...-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.505 Office and household furniture and furnishings. Requirements for new office and household furniture and furnishings as described in this § 101-26...

  19. Activity of Transition Metal Sulfides Supported on Al2O3,

    Czech Academy of Sciences Publication Activity Database

    Kaluža, Luděk

    2015-01-01

    Roč. 114, č. 2 (2015), s. 781-794 ISSN 1878-5190 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : hydrodesulfurization * hydrogenation * support effect Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.265, year: 2015

  20. Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 263-265 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-53.pdf

  1. Low Cycle Fatigue Behavior of Cast Superalloy Inconel 713LC with Al Coating at 800 °C

    Czech Academy of Sciences Publication Activity Database

    Obrtlík, Karel; Pospíšilová, S.; Juliš, M.; Podrábský, T.; Polák, Jaroslav

    452-453, - (2011), s. 265-268 ISSN 1013-9826. [Advances in Fracture and Damage Mechanics IX. Nagasaki, 20.09.2010-22.09.2010] Institutional research plan: CEZ:AV0Z20410507 Keywords : High temperature fatigue * diffusion coating * Inconel 713LC Subject RIV: JL - Materials Fatigue, Friction Mechanics

  2. Elektronová mikroskopie v Ústavu přístrojové techniky AV ČR

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Ilona; Pokorná, Zuzana; Frank, Luděk; Mikmeková, Šárka; Mikmeková, Eliška

    2012-01-01

    Roč. 57, č. 10 (2012), s. 265-269 ISSN 0447-6441 R&D Projects: GA TA ČR TE01020118; GA MŠk EE2.4.31.0016 Institutional support: RVO:68081731 Keywords : microscopy with slow electrons * crystallographic contrast * thin films * transmission electron microscopy * scanning electron microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  3. Cross-gain modulation in Raman fiber amplifier: experimentation and modeling

    Czech Academy of Sciences Publication Activity Database

    Menif, M.; Karásek, Miroslav; Rusch, L. A.

    2002-01-01

    Roč. 14, č. 9 (2002), s. 1261-1263 ISSN 1041-1135 R&D Projects: GA MŠk OC 265.10 Institutional research plan: CEZ:AV0Z2067918 Keywords : wavelength division multiplexing * optical communication * optical fibre amplifiers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.100, year: 2002

  4. Re-Engineering Healthcare Integration Programs (REHIP): Planning for Primary Care & Psychological Health Care Integration

    Science.gov (United States)

    2011-03-21

    care cost over 48 months 1. Chiles et al., Clinical Psychology. 1999;6:204–220. 2. Katon et al., Diabetes Care. 2006;29:265-270. 3. Unützer et al...Alcohol Misuse • Diabetes , IBS, Primary Insomnia • Chronic Pain, Somatic Complaints 1. Butler et al., AHRQ Publication No. 09- E003. Rockville, MD. AHRQ

  5. A genome-wide association study of early-onset breast cancer identifies PFKM as a novel breast cancer gene and supports a common genetic spectrum for breast cancer at any age

    NARCIS (Netherlands)

    Ahsan, Habibul; Halpern, Jerry; Kibriya, Muhammad G.; Pierce, Brandon L.; Tong, Lin; Gamazon, Eric; McGuire, Valerie; Felberg, Anna; Shi, Jianxin; Jasmine, Farzana; Roy, Shantanu; Brutus, Rachelle; Argos, Maria; Melkonian, Stephanie; Chang-Claude, Jenny; Andrulis, Irene; Hopper, John L.; John, Esther M.; Malone, Kathi; Ursin, Giske; Gammon, Marilie D.; Thomas, Duncan C.; Seminara, Daniela; Casey, Graham; Knight, Julia A.; Southey, Melissa C.; Giles, Graham G.; Santella, Regina M.; Lee, Eunjung; Conti, David; Duggan, David; Gallinger, Steve; Haile, Robert; Jenkins, Mark; Lindor, Noralane M.; Newcomb, Polly; Michailidou, Kyriaki; Apicella, Carmel; Park, Daniel J.; Peto, Julian; Fletcher, Olivia; dos Santos Silva, Isabel; Lathrop, Mark; Hunter, David J.; Chanock, Stephen J.; Meindl, Alfons; Schmutzler, Rita K.; Müller-Myhsok, Bertram; Lochmann, Magdalena; Beckmann, Lars; Hein, Rebecca; Makalic, Enes; Schmidt, Daniel F.; Bui, Quang Minh; Stone, Jennifer; Flesch-Janys, Dieter; Dahmen, Norbert; Nevanlinna, Heli; Aittomäki, Kristiina; Blomqvist, Carl; Hall, Per; Czene, Kamila; Irwanto, Astrid; Liu, Jianjun; Rahman, Nazneen; Turnbull, Clare; Dunning, Alison M.; Pharoah, Paul; Waisfisz, Quinten; Meijers-Heijboer, Hanne; Uitterlinden, Andre G.; Rivadeneira, Fernando; Nicolae, Dan; Easton, Douglas F.; Cox, Nancy J.; Whittemore, Alice S.

    2014-01-01

    Early-onset breast cancer (EOBC) causes substantial loss of life and productivity, creating a major burden among women worldwide. We analyzed 1,265,548 Hapmap3 single-nucleotide polymorphisms (SNP) among a discovery set of 3,523 EOBC incident cases and 2,702 population control women ages ≤ 51 years.

  6. Evaluation of phosphorus fertilizer rates for maize and sources for ...

    African Journals Online (AJOL)

    USER

    2010-06-14

    Jun 14, 2010 ... 265. Van Ray B, Van Diest A (1979). Utilization of phosphate from different sources by six plant species. Plant Soil, 51(4): 577.589. Zapata F (1986) Agronomic evaluation of rock phosphates for direct application by means of radioisotope techniques In IAEA Experimental. Guidelines Vienna, Austria: IAEA.

  7. Work Related Injuries and Associated Factors among Small Scale ...

    African Journals Online (AJOL)

    user

    Table 2: Occupational and behavioral characteristics of the respondents in small scale industries of Mizan-Aman town, Bench Maji zone, Southwest Ethiopia, 2016. Variable. Frequency (N=219). Percent (%). Consume alcohol. Yes. 87. 39.7. No. 132. 60.3. Smoke cigarettes. Yes. 58. 26.5. No. 161. 73.5. Sleeping disorder.

  8. Cyklus a bilance uhlíku v mokřadech

    Czech Academy of Sciences Publication Activity Database

    Čížková, Hana; Pokorný, Jan; Květ, Jan; Bauer, Václav

    2004-01-01

    Roč. 21, č. 3 (2004), s. 265-268 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03 Institutional research plan: CEZ:AV0Z6087904 Keywords : carbon * wetland * sustainable management Subject RIV: EH - Ecology, Behaviour

  9. Work-Related Goal Appraisals and Stress during the Transition from Education to Work

    Science.gov (United States)

    Dietrich, Julia; Jokisaari, Markku; Nurmi, Jari-Erik

    2012-01-01

    People's personal goals interact with their life situations in many ways. This study examined the appraisals of personal goals during a transition from education to work and their interplay with stress in different domains of life. Finnish young adults (N = 265, 60% female) reported on their goals in the work domain, and related appraisals of…

  10. Fulltext PDF

    Indian Academy of Sciences (India)

    Madhu

    Genetically modified cyanobacterium Nostoc muscorum over- producing proline in response to salinity and osmotic stresses. 265. Dictyostelium discoideum. Kenneth Raper, Elisha Mitchell and Dictyostelium. 195. Disease resistance. The reactive oxygen species network pathways: an essential prerequisite for perception of ...

  11. Growth in labour productivity of forestry and regional development : a study based on Finnish experience / Seppo Vehkamäki

    Index Scriptorium Estoniae

    Vehkamäki, Seppo

    2003-01-01

    Regionaaltasandil mõjutab metsandussektori töö tootlikkus nii puidutoodete konkurentsivõimet, metsanduse konkurentsivõimelisust tööjõu ja teiste tootmissisendite osas, majanduslikku mitmekesistumist ja arengut kui ka demograafilist ja sotsiaalset arengut. Tabelid. Lisad lk. 265-266

  12. Peptides eluted from HLA-B27 of human splenocytes and blood cells reveal a similar but partially different profile compared to in vitro grown cell lines

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Pohl, J.; Nguyen, V. D.; Vaingátová, Silvie; Ivašková, E.; Pla, M.; Čapková, Jana; Sedláčková, M.; Ivanyi, P.; Flieger, Miroslav

    2004-01-01

    Roč. 94, - (2004), s. 261-265 ISSN 0165-2478 R&D Projects: GA MZd NI7327 Keywords : hla -b*2705 * peptide profile * lc-ms/ms analysis Subject RIV: EE - Microbiology, Virology Impact factor: 2.136, year: 2004

  13. Experimental Problem Solving: An Instructional Improvement Field Experiment.

    Science.gov (United States)

    Ross, John A.; Maynes, Florence J.

    1983-01-01

    An instructional program based on expert-novice differences in experimental problem-solving performance was taught to grade six students (N=265). Performance was assessed with multiple-choice and open-ended measures of specific transfer. Between-group comparisons using pretest scores as covariate showed treatment condition students consistently…

  14. Genome comparison and physiological characterization of eight Streptococcus thermophilus strains isolated from Italian dairy products

    DEFF Research Database (Denmark)

    Vendramin, Veronica; Treu, Laura; Campanaro, Stefano

    2017-01-01

    to identify the core and the variable genes, which vary among strains from 196 to 265. Additionally, correlation between the isolation site and the genetic distance was investigated at genomic level. Results highlight that the phylogenetic reconstruction differs from the geographical strain distribution...

  15. 75 FR 17939 - EMD Chemicals, Inc.; Withdrawal of Color Additive Petition

    Science.gov (United States)

    2010-04-08

    ... iron oxide, mica, and titanium dioxide to color food. FOR FURTHER INFORMATION CONTACT: Judith Kidwell, Center for Food Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint Branch... for the safe use of synthetic iron oxide and mica to color food and to provide for the safe use of...

  16. 77 FR 16784 - E. & J. Gallo Winery; Filing of Color Additive Petition

    Science.gov (United States)

    2012-03-22

    ... that the color additive regulations be amended to provide for the expanded safe use of mica- based... A. Davy, Center for Food Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100... additive regulations in 21 CFR 73.350 to provide for the safe use of mica-based pearlescent pigments...

  17. Isolation and antimicrobial susceptibility of Aeromonas salmonicida in rainbow trout (Oncorhynchus mykiss) in turkey hatchery farms.

    Science.gov (United States)

    Kirkan, S; Göksoy, E O; Kaya, O

    2003-09-01

    Three Aeromonas salmonicida strains were isolated from the livers of 265 rainbow trouts sampled. The antibiotic susceptibility test results showed that A. salmonicida strains were susceptible to streptomycine and ciprofloxacin. However, they were resistant to amoxycilline + clavulanic acid, penicillin, erythromycine, oxytetracycline and cefuroxime sodium.

  18. Registro preliminar de Basidiomycetes del Páramo De Ocetá (Monguí-Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Helbert David Siabatto F.

    2005-07-01

    órdenes: Agaricales, Afiloforales, Lycoperdales y Russulales. Se realizó un análisis de acuerdo al gradiente altitudinal muestreado (3.265 a 3.455 msnm y su incidencia en la morfología, indicando posibles adaptaciones en contraste a colecciones consultadas.

  19. Dietary Fat Intake and Exercise among Two- and Four-Year College Students: Differences in Behavior and Psychosocial Factors

    Science.gov (United States)

    Berg, Carla J.; An, Lawrence C.; Ahluwalia, Jasjit S.

    2013-01-01

    Given the demographic differences among two-year colleges and four-year universities and the relatively limited access to health education and campus-based health resources, this study compares the frequency of limiting dietary fat intake and exercising among two- and four-year college students. A total of 2,265 undergraduate students aged 18-25…

  20. 76 FR 12667 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List the Mt...

    Science.gov (United States)

    2011-03-08

    ... recent treatments of butterfly taxonomy (Opler and Warren 2003, p. 30; Pelham 2008, p. 265). [[Page 12668.... 18) in which higher-elevation biophysical settings departed less from the natural range of... that thinning treatments would need to be implemented carefully to minimize short-term disturbance...

  1. 40 CFR 279.12 - Prohibitions.

    Science.gov (United States)

    2010-07-01

    ... THE MANAGEMENT OF USED OIL Applicability § 279.12 Prohibitions. (a) Surface impoundment prohibition... located on the site of a facility engaged in a manufacturing process where substances are transformed into.... (3) Hazardous waste incinerators subject to regulation under subpart O of parts 264 or 265 of this...

  2. Age-dependent remodelling of ionotropic signalling in cortical astroglia

    Czech Academy of Sciences Publication Activity Database

    Lalo, U.; Palygin, O.; North, R. A.; Verkhratsky, Alexei; Pankratov, Y.

    2011-01-01

    Roč. 10, č. 3 (2011), s. 392-402 ISSN 1474-9718 R&D Projects: GA ČR GA305/08/1384 Institutional research plan: CEZ:AV0Z50390703 Keywords : astrocytes * aging * synaptic transmission Subject RIV: FH - Neurology Impact factor: 6.265, year: 2011

  3. Microbial keratitis in Gujarat, Western India: findings from 200 cases ...

    African Journals Online (AJOL)

    Results: Of the 200 ulcers 55% were culture positive, 26.5% were bacterial ulcers of which 47% were due to Staphylococcus spp. Pure fungal growth was seen in 22% while 6% were mixed ulcers. Fusarium spp. (30%) was the most common fungus followed by Aspergillus spp. (21%). Only one case of Acanthamoeba ...

  4. Mercury Removal from MSW Incineration Flue Gas by Mineral-based Sorbents.

    Czech Academy of Sciences Publication Activity Database

    Rumayor, Marta; Svoboda, Karel; Švehla, Jaroslav; Pohořelý, Michael; Šyc, Michal

    Roč. 73, DEC 13 ( 2018 ), s. 265-270 ISSN 0956-053X R&D Projects: GA TA ČR TE02000236 Institutional support: RVO:67985858 Keywords : mercury * removal * mineral sorbents Subject RIV: DI - Air Pollution ; Quality OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.030, year: 2016

  5. In 3+-doped TiO 2 and TiO 2/In 2S 3 Nanocomposite for photocatalytic and stoichiometric degradations

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Opluštil, F.; Němec, T.

    2012-01-01

    Roč. 88, č. 2 (2012), s. 265-276 ISSN 0031-8655 R&D Projects: GA MPO FI-IM5/231 Institutional research plan: CEZ:AV0Z40320502 Keywords : WARFARE AGENTS * HOMOGENEOUS HYDROLYSIS * OPTICAL-PROPERTIES Subject RIV: CA - Inorganic Chemistry Impact factor: 2.287, year: 2012

  6. Abelovu cenu za matematiku získal v roce 2007 Srinivasa Varadhan

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Vrkoč, Ivo

    2007-01-01

    Roč. 52, č. 4 (2007), s. 265-273 ISSN 0032-2423 R&D Projects: GA MŠk 1P05ME749 Institutional research plan: CEZ:AV0Z10190503 Keywords : law of large deviatious * evolution equations * Markov process Subject RIV: BA - General Mathematics

  7. PHYTOREMEDIATION POTENTIAL OF Vigna unguiculata IN A ...

    African Journals Online (AJOL)

    FRANK

    by framework dealumination and gallium oxide incorporation led to an increase in catalytic activity. The catalytic activities of both parent ... regeneration of the coked sample was seen to completely restore the catalytic activity of both samples. KEY WORDS: Zeolite catalyst, ..... in reforming catalyst”. J. Catal. 89, 256 – 265.

  8. 75 FR 69745 - Aging Airplane Program: Widespread Fatigue Damage

    Science.gov (United States)

    2010-11-15

    ... LOV into the maintenance program for that airplane. Operators may not fly an airplane beyond its LOV... al. Aging Airplane Program: Widespread Fatigue Damage; Final Rule #0;#0;Federal Register / Vol. 75...; Amendment Nos. 25-132, 26-5, 121-351, 129- 48] RIN 2120-AI05 Aging Airplane Program: Widespread Fatigue...

  9. 40 CFR 260.3 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Use of number and gender. 260.3... (CONTINUED) HAZARDOUS WASTE MANAGEMENT SYSTEM: GENERAL General § 260.3 Use of number and gender. As used in parts 260 through 265 and 268 of this chapter: (a) Words in the masculine gender also include the...

  10. 78 FR 25861 - Radio Broadcasting Services; Peach Springs, Arizona

    Science.gov (United States)

    2013-05-03

    ... Broadcasting Services; Peach Springs, Arizona AGENCY: Federal Communications Commission. ACTION: Final rule... first Tribal Allotment and a potential second local transmission service at Peach Springs, Arizona. (The...]265A can be allotted at Peach Springs, consistent with the minimum distance separation requirements of...

  11. Development and Validation of a Path Analytic Model of Students' Performance in Chemistry.

    Science.gov (United States)

    Anamuah-Mensah, Jophus; And Others

    1987-01-01

    Reported the development and validation of an integrated model of performance on chemical concept-volumetric analysis. Model was tested on 265 chemistry students in eight schools.Results indicated that for subjects using algorithms without understanding, performance on volumetric analysis problems was not influenced by proportional reasoning…

  12. Antecedents and Outcomes of Joint Trajectories of Mother-Son Conflict and Warmth during Middle Childhood and Adolescence

    Science.gov (United States)

    Trentacosta, Christopher J.; Criss, Michael M.; Shaw, Daniel S.; Lacourse, Eric; Hyde, Luke W.; Dishion, Thomas J.

    2011-01-01

    This study investigated the development of mother-son relationship quality from ages 5 to 15 in a sample of 265 low-income families. Nonparametric random effects modeling was utilized to uncover distinct and homogeneous developmental trajectories of conflict and warmth; antecedents and outcomes of the trajectory groups also were examined. Four…

  13. Mõõtmise probleem 18. sajandi psühholoogias / Konstantin Ramul ; tõlk. Kenn Konstabel

    Index Scriptorium Estoniae

    Ramul, Konstantin, 1879-1975

    2004-01-01

    Mentaalsete mõõtmiste tähtsusest 18. sajandil teadusliku psühholoogia arengule 19. sajandil. 18. sajandi erinevate autorite arvamustest psühholoogiliste mõõtmiste võimalustest ja meetoditest. Varem ilmunud: American Psychologist, 1960, nr. 15, lk. 256-265

  14. 42 CFR 423.272 - Review and negotiation of bid and approval of plans submitted by potential Part D sponsors.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Review and negotiation of bid and approval of plans... and negotiation of bid and approval of plans submitted by potential Part D sponsors. (a) Review and negotiation regarding information, terms and conditions. CMS reviews the information filed under § 423.265(c...

  15. 41 CFR 109-26.501-53 - Acquisitions by transfer.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Acquisitions by transfer... PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 109-26.501-53 Acquisitions by transfer. (a) The acquisition of passenger motor vehicles by transfer from another Government agency or DOE...

  16. Clinicopathological Characteristics of Aural Polyps | Sogebi | East ...

    African Journals Online (AJOL)

    In the PTA, 37.9% had conductive hearing loss; 55.2% out of assessed mastoid radiographs had sclerotic cells while 26.5% of the histopathology reports had cholesteatoma. Significant differences occurred in the experience of two symptoms between children and adults. Conclusions: Both clinical and pathological ...

  17. IDRC in the Philippines

    International Development Research Centre (IDRC) Digital Library (Canada)

    I Migrant workers access reproductive health care. I Filipinos benefit from modern communication technologies. I People enjoy community. Internet access. Total IDRC support. 265 activities worth CA$44 million since 1972. Research has improved the working conditions and general well-being of rice farmers.

  18. Short telomere length is associated with NOTCH1/SF3B1/TP53 aberrations and poor outcome in newly diagnosed chronic lymphocytic leukemia patients

    DEFF Research Database (Denmark)

    Mansouri, Larry; Grabowski, Pawel; Degerman, Sofie

    2013-01-01

    Most previous studies on telomere length (TL) in chronic lymphocytic leukemia (CLL) are based on referral cohorts including a high proportion of aggressive cases. Here, the impact of TL was analyzed in a population-based cohort of newly diagnosed CLL (n = 265) and in relation to other prognostic...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 265 ... Vol 42, No 3 (2015), Relational Aggression in Adolescents at Selected Schools in Lusaka Urban, Abstract PDF. A Chirwa-Mwanza, JA Menon. Vol 43, No 3 (2016), Relationship between serum zinc levels and preeclampsia at the University Teaching Hospital, Lusaka, Zambia, Abstract PDF.

  20. Trajectories of Affective States in Adolescent Hockey Players: Turning Point and Motivational Antecedents

    Science.gov (United States)

    Gaudreau, Patrick; Amiot, Catherine E.; Vallerand, Robert J.

    2009-01-01

    This study examined longitudinal trajectories of positive and negative affective states with a sample of 265 adolescent elite hockey players followed across 3 measurement points during the 1st 11 weeks of a season. Latent class growth modeling, incorporating a time-varying covariate and a series of predictors assessed at the onset of the season,…

  1. Determinants of Male Involvement in Birth Preparedness among ...

    African Journals Online (AJOL)

    Results: Male involvement in birth preparedness was low (6.6%). Of the birth preparedness indices, saving money (26.5%) was the commonest while prior arrangement for means of getting safe blood (2.4%) was the least common. On bivariate analysis, male involvement in birth preparedness was significantly associated ...

  2. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  3. Validating a Conceptual Framework for the Core Concept of ”Cell-cell Communication”

    Czech Academy of Sciences Publication Activity Database

    Michael, J.; Martinková, Patrícia; McFarland, J.L.; Wright, A.; Cliff, W.; Modell, H.; Wenderoth, M.P.

    2017-01-01

    Roč. 41, č. 2 (2017), s. 260-265 ISSN 1043-4046 R&D Projects: GA ČR GJ15-15856Y Institutional support: RVO:67985807 Keywords : conceptual framework * core concept * cell-cell communication * physiology Subject RIV: AM - Education OBOR OECD: Education, general; including training, pedagogy, didactics [and education systems] Impact factor: 1.755, year: 2016

  4. 77 FR 20482 - Bridgestone Americas Tire Operations, LLC, Receipt of Petition for Decision of Inconsequential...

    Science.gov (United States)

    2012-04-04

    ... that manufactures and imports replacement equipment. Pursuant to 49 U.S.C. 30118(d) and 30120(h) (see... replacement equipment manufacturer from the notification and recall responsibilities of 49 CFR Part 573 for... Firestone Transforce AT, size LT265/70R17, light truck replacement tires manufactured between November 20...

  5. The effect of starvation on the metabolic rate and microanatomy of Galumna elimata (Acari: Oribatida)

    Czech Academy of Sciences Publication Activity Database

    Hubert, J.; Šustr, Vladimír

    2001-01-01

    Roč. 98, - (2001), s. 265-275 ISSN 1210-5759 R&D Projects: GA ČR GA206/97/0629 Institutional research plan: CEZ:AV0Z6066911 Keywords : Acari * starvation * mortality Subject RIV: EH - Ecology, Behaviour Impact factor: 0.802, year: 2001

  6. Grewia Gum 2: Mucoadhesive Properties of Compacts and Gels

    African Journals Online (AJOL)

    Erah

    Park K, Robinson JR. Bioadhesive polymers as platform for oral controlled drug delivery: method to study bioadhesion. Int J Pharm. 1984; 19: 107. 4. Ranga Rao, KV, Buri P. A novel in situ method to test polymers and coated microparticles for. Bioadhesion. Int J Pharm 1989; 52: 265-270. 5. Tobyn MJ, Johnson JR, Dettmar ...

  7. APTA: A Simple Ligand for Lanthanide Energy Transfer ...

    African Journals Online (AJOL)

    Photophysical data including quantum yields (Φ) excitation wavelength (265 nm), emission wavelength (544 nm) and excited state lifetimes (τwater = 0.83 ms) for the 1:1 complex are reported. The number of water molecules coordinated to the metal ion has been calculated using isotopic experiments and these data were ...

  8. A survey of internet literacy skills among physical science ...

    African Journals Online (AJOL)

    This is an in-depth study of Internet Literacy Skills among physical science students of the University of Benin. Survey design was applied by using questionnaire to collect data from 265 undergraduate students in the faculty of physical sciences at 200 and 300 levels. Data collected were analyzed using frequency count and ...

  9. Mikroskopie velmi pomalými elektrony v ultrazvukovém vakuu

    Czech Academy of Sciences Publication Activity Database

    Piňos, Jakub; Mikmeková, Eliška; Mikmeková, Šárka; Müllerová, Ilona; Frank, Luděk

    2017-01-01

    Roč. 62, č. 10 (2017), s. 264-265 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning microscopy * slow electrons * ultrahigh vacuum * graphene Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Materials engineering

  10. One Pot or Two Pot Strategies? Income Pooling in Married and Unmarried Households in Comparative Perspective

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana; Le Bourdais, C.

    2009-01-01

    Roč. 40, č. 3 (2009), s. 355-385 ISSN 0047-2328 R&D Projects: GA AV ČR(CZ) KJB700280802 Institutional research plan: CEZ:AV0Z70280505 Keywords : economic behavior * money management marriage * cohabitation Subject RIV: AO - Sociology, Demography Impact factor: 0.265, year: 2009

  11. 77 FR 31834 - Clad Steel Plate from Japan: Final Results of the Expedited Third Sunset Review of the...

    Science.gov (United States)

    2012-05-30

    ... metallurgically bonded to a base or backing of ferrous metal (usually carbon or low alloy steel) where the latter... being obtained by heat treatment at the appropriate temperature with subsequent cold rolling. See... alloy clad steel plate is manufactured to ASTM specification A265. These specifications are illustrative...

  12. 78 FR 9676 - Clad Steel Plate From Japan: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2013-02-11

    ... or backing of ferrous metal (usually carbon or low alloy steel) where the latter predominates by... by heat treatment at the appropriate temperature with subsequent cold rolling. See Harmonized... alloy clad steel plate is manufactured to ASTM specification A265. These specifications are illustrative...

  13. Idiosyncratic Deals: Testing Propositions on Timing, Content, and the Employment Relationship

    Science.gov (United States)

    Rousseau, Denise M.; Hornung, Severin; Kim, Tai Gyu

    2009-01-01

    This study tests propositions regarding idiosyncratic deals (i-deals) in a sample of N = 265 hospital employees using structural equation modeling. Timing and content of idiosyncratic employment arrangements are postulated to have differential consequences for the nature of the employment relationship. Results confirm that i-deals made after hire…

  14. Identification of new susceptibility loci for type 2 diabetes and shared etiological pathways with coronary heart disease

    DEFF Research Database (Denmark)

    Zhao, Wei; Rasheed, Asif; Tikkanen, Emmi

    2017-01-01

    To evaluate the shared genetic etiology of type 2 diabetes (T2D) and coronary heart disease (CHD), we conducted a genome-wide, multi-ancestry study of genetic variation for both diseases in up to 265,678 subjects for T2D and 260,365 subjects for CHD. We identify 16 previously unreported loci for ...

  15. Personality and Dutch emigrants' reactions to acculturation strategies

    NARCIS (Netherlands)

    Bakker, Winny; Van der Zee, K.I.; Van Oudenhoven, Jan Pieter

    2006-01-01

    This experimental questionnaire study examined individual differences in affective and normative reactions to acculturation strategics. A sample of 265 Dutch emigrants with a dual cultural background read scenarios describing the experiences of an emigrant. Eight (4 × 2) different scenario versions

  16. Personality and Dutch emigrants' reactions to acculturation strategies

    NARCIS (Netherlands)

    Bakker, Winny; Van der Zee, Karen; Van Oudenhoven, Jan Pieter

    2006-01-01

    This experimental questionnaire study examined individual differences in affective and normative reactions to acculturation strategies. A sample of 265 Dutch emigrants with a dual cultural background read scenarios describing the experiences of an emigrant. Eight (4 x 2) different scenario versions

  17. 76 FR 28192 - Petition for Rulemaking Submitted by the Nuclear Energy Institute

    Science.gov (United States)

    2011-05-16

    ... NUCLEAR REGULATORY COMMISSION 10 CFR Part 26 [Docket No. PRM-26-5; NRC-2010-0304] Petition for Rulemaking Submitted by the Nuclear Energy Institute AGENCY: Nuclear Regulatory Commission. ACTION: Petition... Anthony R. Pietrangelo, on behalf of the Nuclear Energy Institute (NEI), the petitioner, in the planned...

  18. Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004

  19. Not All Past Events Are Equal: Biased Attention and Emerging Heuristics in Children's Past-to-Future Forecasting

    Science.gov (United States)

    Lagattuta, Kristin Hansen; Sayfan, Liat

    2013-01-01

    Four- to 10-year-olds and adults (N = 265) responded to eight scenarios presented on an eye tracker. Each trial involved a character who encounters a perpetrator who had previously enacted positive (P), negative (N), or both types of actions toward him or her in varying sequences (NN, PP, PN, and NP). Participants predicted the character's…

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 265 ... Vol 43, No 3 (2016), Non-invasive ventilation in HIV positive patients with sepsis and respiratory failure at the University Teaching Hospital, Lusaka .... Vol 38, No 2 (2011), Prevalence and Socio-Demographic Correlates for Mental Illness Among Inmates at Lusaka Central Prison, Zambia, Abstract PDF.

  1. Sensitivity of annual and seasonal reference crop ...

    Indian Academy of Sciences (India)

    potranspiration Equation”; Proceedings of 4th National. Irrig. Symp., ASAE, Phoenix, AZ. Wang H, Xu S and Sun L 2006 Effects of climatic change on evapotranspiration in Zhalong Wetland, Northeast China;. Chinese Geogr. Sci. 16(3) 265–269. MS received 12 June 2014; revised 3 December 2014; accepted 5 December ...

  2. Involvement of Lipid Metabolism in the Action of Phospholipase A2 Neurotoxins

    Science.gov (United States)

    1992-04-15

    extracted separately from the supernatant and pellets by the methods of Marinetti at al. (Marinett’ et al., 1959) and Foich et al. (Foich at al., 1957...RANDALL, R.J. (1951) Protein measurement with the Folin phenol reagent. J. biol. Chem. 193, 265-275. MARINETTI , G.V., ALBRECHT, M., FORD, T. and

  3. Modeling the effects of study abroad programs on college students

    Science.gov (United States)

    Alvin H. Yu; Garry E. Chick; Duarte B. Morais; Chung-Hsien Lin

    2009-01-01

    This study explored the possibility of modeling the effects of a study abroad program on students from a university in the northeastern United States. A program effect model was proposed after conducting an extensive literature review and empirically examining a sample of 265 participants in 2005. Exploratory factor analysis (EFA), confirmatory factor analysis (CFA),...

  4. 76 FR 6120 - Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues

    Science.gov (United States)

    2011-02-03

    ... [Release No. 34-63798; File No. 265-26] Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues...''). ACTION: Notice of Meeting of Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues. SUMMARY: The Joint CFTC-SEC Advisory Committee on Emerging Regulatory Issues will hold a public meeting on...

  5. Toeplitz operators and group representations

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav

    2007-01-01

    Roč. 13, č. 3 (2007), s. 243-265 ISSN 1069-5869 R&D Projects: GA ČR GA201/03/0041; GA AV ČR IAA1019304 Institutional research plan: CEZ:AV0Z10190503 Keywords : Toeplitz operator * group representation * symbol calculus Subject RIV: BA - General Mathematics Impact factor: 1.125, year: 2007

  6. Comparative ecophysiology of cold-tolerance-related traits: Assessing range expansion potential for an invasive insect at high latitude

    Czech Academy of Sciences Publication Activity Database

    Lehmann, P.; Kaunisto, S.; Košťál, Vladimír; Margus, A.; Zahradníčková, Helena; Lindström, L.

    2015-01-01

    Roč. 88, č. 3 (2015), s. 254-265 ISSN 1522-2152 R&D Projects: GA MŠk LH12103 Grant - others:Academy of Finland(FI) 118456; Academy of Finland(FI) 128888 Institutional support: RVO:60077344 Keywords : Leptinotarsa decemlineata Subject RIV: ED - Physiology Impact factor: 2.007, year: 2015

  7. On Normal Modes of Vibrating 1-D Mechanical Systems with Discontinuous Properties

    Czech Academy of Sciences Publication Activity Database

    Fedorchenko, Alexander I.; Stachiv, Ivo; Wang, A. B.

    2012-01-01

    Roč. 19, č. 4 (2012), s. 265-270 ISSN 1537-6494 Institutional research plan: CEZ:AV0Z20760514 Keywords : dimensionless analysis * fundamental solution * normal modes Subject RIV: BI - Acoustics Impact factor: 0.701, year: 2012 http://www.tandfonline.com/doi/abs/10.1080/15376494.2011.642936

  8. Influence of positions of the incidence and severity of maxillofacial ...

    African Journals Online (AJOL)

    The most common vehicle involved in RTA was the mini bus, 34.3% followed by motorcycle, 26.5%. Middle seat passengers, drivers and motorcycle passengers and riders sustained more and severe injuries during crashes. The mandible was more frequently fractured at the symphysis (24.6%) than at any other site while ...

  9. An exact algorithm for the N-sheet two dimensional single stock-size ...

    African Journals Online (AJOL)

    with the initial value and step size of β to obtain optimal solutions to 265 difficult cutting stock problems. They reported a fair amount of success with a step size of 0.002 and an initial value of zero for the test problems. ..... time seems to be good when compared to the time measurements as indicated by. Amaral and Wright.

  10. EAMJ Jan. Temporomandibular 10.indd

    African Journals Online (AJOL)

    2010-01-01

    Jan 1, 2010 ... American Academy of Pediatric Dentistry. Treatment of temporomandibular disorders in children. J. Am. Dent. Assoc. 1990; 120: 265-269. 12. Knibble, A., Carter, J.B. and Frokjer, G.M. Postanaesthetic temporomandibular joint dysfunction. Anesth. Prog. 1989; 36: 21-25. 13. Rastogi, N.K. and Vakharia, ...

  11. GenBank blastx search result: AK288311 [KOME

    Lifescience Database Archive (English)

    Full Text Available (UL26), virion scaffolding protein (UL26.5), virion membrane glycoprotein B (gB), DNA cleavage/packaging pro... subunit (pol), nuclear phosphoprotein (UL31), DNA cleavage/packaging (UL32), DNA cleavage/packaging protein

  12. 41 CFR 101-26.506 - Interior planning and design services.

    Science.gov (United States)

    2010-07-01

    ... SOURCES AND PROGRAM 26.5-GSA Procurement Programs § 101-26.506 Interior planning and design services. In... various phases of interior planning and design. These services will be provided either directly or through... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Interior planning and...

  13. Optimal range for the iid test based on integration across the correlation integral

    Czech Academy of Sciences Publication Activity Database

    Kočenda, Evžen; Briatka, Ľuboš

    2005-01-01

    Roč. 24, č. 3 (2005), s. 265-296 ISSN 0747-4938 Grant - others:Grantová agentura Univerzity Karlovy v Praze 346/2005/A-EK Institutional research plan: CEZ:AV0Z70850503 Keywords : chaos * high-frequency economic and financial data * Monte Carlo Subject RIV: AH - Economics http://dx.doi.org/10.1080/07474930500243001

  14. Egyptian Journal of Medical Human Genetics - Vol 14, No 3 (2013)

    African Journals Online (AJOL)

    Conservative therapy versus intra-gastric balloon in treatment of Prader-Willi Syndrome morbid obesity · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HN Ashem, SH Nagib, NS Thabet, 259–265. http://dx.doi.org/10.1016/j.ejmhg.2013.01.003 ...

  15. Studies on asymptomatic malaria, prevention and treatment seeking ...

    African Journals Online (AJOL)

    Studies on asymptomatic malaria, prevention and treatment seeking behaviours in Abeokuta, south-west Nigeria. ... Self-diagnosis for the disease was more common (60.8%) among the participants, compared to other measures; seeking laboratory test (26.5%) and clinical diagnosis (9.1%). A good proportion of the ...

  16. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    First experimental test of Bell inequalities performed using a non-maximally entangled state · M Genovese G Brida C .... pp 245-265 Quantum optics, coherent states and geometric phases. Operator properties of ... Causality, relativity and quantum correlation experiments with moving reference frames · H Zbinden J Brendel ...

  17. Metalografie železných předmětů ze semonické tvrze ve světle studovaných výkovků ze středověkých tvrzí, vesnic a měst

    Czech Academy of Sciences Publication Activity Database

    Hošek, Jiří

    2006-01-01

    Roč. 97, - (2006), s. 265-320 ISSN 0031-0506 R&D Projects: GA ČR GP404/02/P033 Institutional research plan: CEZ:AV0Z80020508 Keywords : Semonice * metallographic examinations * medieval tool-making * medieval town * village * stronghold * castle Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 110; Issue 3. Volume 110, Issue 3. September 2001, pages 185-265. pp 185-190. Ar-Ar age of ... Development of micro-scale joints in volcanic rocks under thermal stress · Susanta Kumar Samanta · More Details Abstract Fulltext PDF. Petrographic studies of ...

  19. External Suction and Fluid Output in Chest Drains After Lobectomy

    DEFF Research Database (Denmark)

    Lijkendijk, Marike; Neckelmann, Kirsten; Licht, Peter B

    2018-01-01

    was delegated to staff nurses: air leakage less than 20 mL/min for 6 hours regardless of fluid output, provided it was serous. The primary end point was fluid output after 24 and 48 hours. RESULTS: Mean fluid output was significantly higher with high suction after both 24 (338 ± 265 mL versus 523 ± 215 m...

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. ZAKI ABU RABI. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 265-274 Article. Interleukin 8 in progression of hormone-dependent early breast cancer · JELENA MILOVANOVIĆ NATAŠA TODOROVIĆ-RAKOVIĆ TIJANA VUJASINOVIĆ ZAKI ABU RABI.