
Sample records for bohrium 263

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: ...

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU


    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 33 CFR 263.12 - References. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 263.12 Section 263.12 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS General § 263.12 References. (a) ER 11-2-201, Civil Works Activities, Funding, Work...

  4. 32 CFR 263.3 - Compliance. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Compliance. 263.3 Section 263.3 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS TRAFFIC AND VEHICLE CONTROL ON CERTAIN DEFENSE MAPPING AGENCY SITES § 263.3 Compliance. (a) All persons entering the...

  5. 33 CFR 117.263 - Banana River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...

  6. 28 CFR 2.63 - Quorum. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Quorum. 2.63 Section 2.63 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS... action authorized by law may be taken on a majority vote of the Commissioners holding office at the time...

  7. Consolidated Checklist for C4 40 CFR 263 (United States)

    No final rules affecting 40 CFR Part 263 were promulgated between June 30, 2002 and December 31, 2002, therefore, this Consolidated Checklist corresponds to 40 CFR Part 263 as published on July 1, 2002.

  8. 27 CFR 26.263 - Determination of tax on beer. (United States)


    ... beer. 26.263 Section 26.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Procedure at Port of Entry From the Virgin Islands § 26.263 Determination of tax on beer. If the certificate prescribed in § 26.205 covers beer, the beer tax will be collected on the basis of the number of barrels of...

  9. 12 CFR 263.8 - Conflicts of interest. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Conflicts of interest. 263.8 Section 263.8... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.8 Conflicts of interest. (a) Conflict of interest in representation. No person shall appear as counsel for another person in an...

  10. 27 CFR 26.3 - Delegations of the Administrator. (United States)


    ... Administrator. 26.3 Section 26.3 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Regulations § 26.3 Delegations of the Administrator. The regulatory authorities of the Administrator contained... 1135.26, Delegation of the Administrator's Authorities in 27 CFR Part 26, Liquors and Articles From...

  11. 12 CFR 263.97 - Proceedings under this subpart. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Proceedings under this subpart. 263.97 Section 263.97 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Practice Before the Board § 263.97 Proceedings under this subpart...

  12. 34 CFR 263.8 - What are the payback requirements? (United States)


    .... (b) The period of time required for a work-related payback is equivalent to the total period of time... 34 Education 1 2010-07-01 2010-07-01 false What are the payback requirements? 263.8 Section 263.8... Program § 263.8 What are the payback requirements? (a) Individuals receiving assistance under the...

  13. 24 CFR 26.3 - Ex parte communications. (United States)


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Ex parte communications. 26.3... Development HEARING PROCEDURES Hearings Before Hearing Officers Hearing Officer § 26.3 Ex parte communications. (a) Definition. An ex parte communication is any communication with a hearing officer, direct or...

  14. 12 CFR 263.65 - Civil penalty inflation adjustments. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Civil penalty inflation adjustments. 263.65... Money Penalties § 263.65 Civil penalty inflation adjustments. (a) Inflation adjustments. In accordance with the Federal Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note), the Board has...

  15. Microstructure stability: Optimisation of 263 Ni-based superalloy

    Directory of Open Access Journals (Sweden)

    Crozet Coraline


    Full Text Available To reduce CO2 emissions on coal-fired power plant, A-ultra supercritical (A-USC power plant whose steam conditions exceed 700 °C are being developed. At these elevated temperatures, the use of Ni-base superalloys becomes necessary. In this context and within the European project NextGenPower, focus is made on commercial Nimonic C-263 as a candidate material for turbine rotors. Nimonic C-263 is known to have low sensitivity to segregation, high workability and high weldability which are major properties for the manufacture of large shafts. Long-term creep strength is also required for this application and unfortunately Nimonic C-263 shows η-phase precipitation after long-time exposure between 700 °C–900 °C which is detrimental for long-term creep properties. The composition of Nimonic C-263 was thus optimised to overcome the formation of η-phase. Trial tests were made in order to study the effect of hardening contribution elements on microstructural and mechanical properties. Then, a 500 mm diameter forged rotor was made from optimised 263 alloy and shows promising properties.

  16. 26 CFR 1.263(a)-0 - Table of contents. (United States)


    ....263(a)-4Amounts paid to acquire or create intangibles. (a) Overview. (b) Capitalization with respect to intangibles. (1) In general. (2) Published guidance. (3) Separate and distinct intangible asset... provisions of the Internal Revenue Code. (i) In general. (ii) Example. (c) Acquired intangibles. (1) In...

  17. 40 CFR 180.263 - Phosalone; tolerances for residues. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Phosalone; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.263 Phosalone; tolerances for residues. (a) General. Tolerances are established for residues of...

  18. 26 CFR 1.263A-11 - Accumulated production expenditures. (United States)


    ... service to complete the improvement. (2) De minimis rule. For purposes of paragraph (e)(1)(ii) of this... Section 1.263A-11 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME... properties acquired for development, and the capitalized cost of planning and design activities are taken...

  19. 38 CFR 3.263 - Corpus of estate; net worth. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Corpus of estate; net....263 Corpus of estate; net worth. (a) General. The following rules are for application in determining the corpus of estate of a parent where dependency is a factor under § 3.250, and the net worth of a...

  20. Parallel H.263 Encoder in Normal Coding Mode


    Cosmas, J; Paker, Y; Pearmain, A


    A parallel H.263 video encoder, which utilises spatial para1 elism, has been modelled using a multi-threaded program. Spatial parallelism is a technique where an image is subdivided into equal parts (as far as physically possible) and each part is proces!;ed by a separate processor by computing motion and texture mding with all processors cach acting on a different part of thc ]mag. This method leads to a performance increase, which is roughly in proportion to the number ...

  1. 31 CFR 26.3 - Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental... (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental Impact Assessments (EIAs). 26.3 Section 26.3 Money and... DEVELOPMENT BANDS (MDBs) § 26.3 Availability of Environmental Impact Assessment Summaries (EIA Summaries) and...

  2. 7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics. (United States)


    ... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to policy...

  3. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    The periodic table of elements, the basic and most important component of research in chemistry and physics is growing continu- ously. It is interesting to note that until the. 16th century, only a handful of elements have been known to mankind (10, to be pre- cise) and during the 18th century, 10 more elements have been ...

  4. Amor: Investigating The Triple Asteroid System 2001 SN263 (United States)

    Jones, T.; Bellerose, Julie; Lee, P.; Prettyman, T.; Lawrence, D.; Smith, P.; Gaffey, M.; Nolan, M.; Goldsten, J.; Thomas, P.; Veverka, J.; Farquhar, R.; Heldmann, J.; Reddy, V.; Williams, B.; Chartres, J.; DeRosee, R.; Dunham, D.


    The Amor mission will rendezvous and land at the triple Near-Earth Asteroid system (153591) 2001 SN263 and execute detailed, in-situ science investigations. The spacecraft reaches 2001 SN263 by using a two-year ΔVEGA (ΔV-Earth Gravity Assist) trajectory with a relatively low launch C3 of 33.5 km2/s2. Rendezvous will enable reconnaissance activities including global and regional imaging, shape modeling, system dynamics, and compositional mapping. After landing, Amor will conduct in-situ imaging (panoramic to microscopic scale) and compositional measurements to include elemental abundance. The main objectives are to 1) establish in-situ the long-hypothesized link between C-type asteroids and the primitive carbonaceous chondrite (CC) meteorites, 2) investigate the nature, origin and evolution of C-type asteroids, and 3) investigate the origin and evolution of a multiple asteroid system. The mission also addresses the distribution of volatiles and organic materials, impact hazards, and resources for future exploration. Amor is managed by NASA Ames Research Center in partnership with Orbital Sciences, KinetX, MDA, and Draper with heritage instruments provided by Ball Aerospace, JHU/APL, and Firestar Engineering. The science team brings experience from NEAR, Hayabusa, Deep Impact, Dawn, LCROSS, Kepler, and Mars missions. In this paper, we describe the science, mission design, and main operational challenges of performing in-situ science at this triple asteroid system. Challenges include landing on the asteroid components, thermal environment, short day-night cycles, and the operation of deployed instruments in a low gravity (10^-5 g) environment.

  5. 34 CFR 263.20 - What definitions apply to the Demonstration Grants for Indian Children program? (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false What definitions apply to the Demonstration Grants for Indian Children program? 263.20 Section 263.20 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION, DEPARTMENT OF EDUCATION INDIAN EDUCATION...

  6. 45 CFR 263.0 - What definitions apply to this part? (United States)


    ... paragraph (b)(1) of this section; (x) Travel costs incurred for official business and not excluded as a... 45 Public Welfare 2 2010-10-01 2010-10-01 false What definitions apply to this part? 263.0 Section... OF STATE AND FEDERAL TANF FUNDS § 263.0 What definitions apply to this part? (a) Except as noted in...

  7. 27 CFR 44.263 - To commercial vessels and aircraft for consumption as supplies. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To commercial vessels and aircraft for consumption as supplies. 44.263 Section 44.263 Alcohol, Tobacco Products and Firearms ALCOHOL... aircraft for consumption as supplies. Where cigars are withdrawn from a customs warehouse for delivery to a...

  8. 26 CFR 1.263(a)-2 - Examples of capital expenditures. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Examples of capital expenditures. 1.263(a)-2...) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(a)-2 Examples of capital expenditures. The following paragraphs of this section include examples of capital expenditures: (a) The cost of...

  9. Single gene microdeletions and microduplication of 3p26.3 in three unrelated families

    DEFF Research Database (Denmark)

    Kashevarova, Anna A; Nazarenko, Lyudmila P; Schultz-Pedersen, Soren


    contain several protein-coding genes and regulatory elements, complicating the understanding of genotype-phenotype correlations. We report two siblings with ID and an unrelated patient with atypical autism who had 3p26.3 microdeletions and one intellectually disabled patient with a 3p26.3 microduplication...

  10. 12 CFR 263.98 - Effect of suspension, debarment or censure. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Effect of suspension, debarment or censure. 263.98 Section 263.98 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE... future representations may be subject to conditions designed to promote high standards of conduct. If a...

  11. 33 CFR 263.26 - Small beach erosion control project authority (Section 103). (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Small beach erosion control project authority (Section 103). 263.26 Section 263.26 Navigation and Navigable Waters CORPS OF ENGINEERS....26 Small beach erosion control project authority (Section 103). (a) Legislative authority. Section...

  12. Mapping orbits around the asteroid 2001SN263 (United States)

    Prado, Antonio F. B. A.


    The present paper has the goal of mapping orbits, with respect to the perturbations, for a spacecraft traveling around the asteroid 2001SN263. This asteroid is a triple system, which center of mass is in an elliptic orbit around the Sun. The perturbations considered in the present model are the ones due to the oblateness of the central body, the gravity field of the two satellite bodies (Beta and Gamma), the Sun, the Moon, the asteroids Vesta, Pallas and Ceres and all the planets of the Solar System. This mapping is important, because it shows the relative importance of each force for a given orbit for the spacecraft, helping to make a decision about which forces need to be included in the model for a given accuracy and nominal orbit. Another important application of this type of mapping is to find orbits that are less perturbed, since it is expected that those orbits have good potential to require a smaller number of station-keeping maneuvers. Simulations under different conditions are made to find those orbits. The main reason to study those trajectories is that, currently, there are several institutions in Brazil studying the possibility to make a mission to send a spacecraft to this asteroid (the so-called ASTER mission), because there are many important scientific studies that can be performed in that system. The results showed that Gamma is the main perturbing body, followed by Beta (10 times smaller) and the group Sun-Mars-oblateness of Alpha, with perturbations 1000 times weaker than the effects of Gamma. The other bodies have perturbations 107 times smaller. The results also showed that circular and polar orbits are less perturbed, when compared to elliptical and equatorial orbits. Regarding the semi-major axis, an internal orbit is the best choice, followed by a larger external orbit. The inclination of the orbit plays an important role, and there are values for the inclination where the perturbations show minimum and maximum values, so it is important to

  13. Hypolipidemic Effects and Safety of Lactobacillus Reuteri 263 in a Hamster Model of Hyperlipidemia

    Directory of Open Access Journals (Sweden)

    Wen-Ching Huang


    Full Text Available We aimed to verify the beneficial effects of probiotic strain Lactobacillus reuteri 263 (Lr263 on hypolipidemic action in hamsters with hyperlipidemia induced by a 0.2% cholesterol and 10% lard diet (i.e., high-cholesterol diet (HCD. Male Golden Syrian hamsters were randomly divided into two groups: normal (n = 8, standard diet (control, and experimental (n = 32, a HCD. After a two-week induction followed by a six-week supplementation with Lr263, the 32 hyperlipidemic hamsters were divided into four groups (n = 8 per group to receive vehicle or Lr263 by oral gavage at 2.1, 4.2, or 10.5 × 109 cells/kg/day for 6 weeks, designated the HCD, 1X, 2X and 5X groups, respectively. The efficacy and safety of Lr263 supplementation were evaluated by lipid profiles of serum, liver and feces and by clinical biochemistry and histopathology. HCD significantly increased serum levels of total cholesterol (TC, triacylglycerol (TG cholesterol, high-density lipoprotein cholesterol (HDL-C, and low-density lipoprotein cholesterol (LDL-C, LDL-C/HDL-C ratio, hepatic and fetal TC and TG levels, and degree of fatty liver as compared with controls. Lr263 supplementation dose dependently increased serum HDL-C level and decreased serum TC, TG, LDL-C levels, LDL-C/HDL-C ratio, hepatic TC and TG levels, and fecal TG level. In addition, Lr263 supplementation had few subchronic toxic effects. Lr263 could be a potential agent with a hypolipidemic pharmacological effect.

  14. A Glio-Protective Role of mir-263a by Tuning Sensitivity to Glutamate

    DEFF Research Database (Denmark)

    Aw, Sherry Shiying; Lim, Isaac Kok Hwee; Tang, Melissa Xue Mei


    Glutamate is a ubiquitous neurotransmitter, mediating information flow between neurons. Defects in the regulation of glutamatergic transmission can result in glutamate toxicity, which is associated with neurodegeneration. Interestingly, glutamate receptors are expressed in glia, but little is known...... about their function, and the effects of their misregulation, in these non-neuronal cells. Here, we report a glio-protective role for Drosophila mir-263a mediated by its regulation of glutamate receptor levels in glia. mir-263a mutants exhibit a pronounced movement defect due to aberrant overexpression...... of CG5621/Grik, Nmdar1, and Nmdar2. mir-263a mutants exhibit excitotoxic death of a subset of astrocyte-like and ensheathing glia in the CNS. Glial-specific normalization of glutamate receptor levels restores cell numbers and suppresses the movement defect. Therefore, microRNA-mediated regulation...

  15. Neuroprotective effects of JGK-263 in transgenic SOD1-G93A mice of amyotrophic lateral sclerosis. (United States)

    Ahn, Suk-Won; Jeon, Gye Sun; Kim, Myung-Jin; Shon, Jee-Heun; Kim, Jee-Eun; Shin, Je-Young; Kim, Sung-Min; Kim, Seung Hyun; Ye, In-Hae; Lee, Kwang-Woo; Hong, Yoon-Ho; Sung, Jung-Joon


    Glycogen synthase kinase-3β (GSK-3β) activity plays a central role in motor neuron degeneration. GSK-3β inhibitors have been shown to prolong motor neuron survival and suppress disease progression in amyotrophic lateral sclerosis (ALS). In this study, we evaluated the therapeutic effects of a new GSK-3b inhibitor, JGK-263, on ALS in G93A SOD1 transgenic mice. Previously, biochemical efficacy of JGK-263 was observed in normal and mutant (G93A) hSOD1-transfected motor neuronal cell lines (NSC34). Based on these previous results, we administered JGK-263 orally to 93 transgenic mice with the human G93A-mutated SOD1 gene. The mice were divided into three groups: a group administered 20mg/kg JGK-263, a group administered 50mg/kg JGK-263, and a control group not administered with JGK-263. Clinical status, rotarod test, and survival rates of transgenic mice with ALS were evaluated. Sixteen mice from each group were selected for further biochemical study that involved examination of motor neuron count, apoptosis, and cell survival signals. JGK-263 administration remarkably improved motor function and prolonged the time until symptom onset, rotarod failure, and death in transgenic mice with ALS compared to control mice. In JGK-263 groups, choline acetyltransferase (ChAT) staining in the ventral horn of the lower lumbar spinal cord showed a large number of motor neurons, suggesting normal morphology. The neuroprotective effects of JGK-263 in ALS mice were also suggested by western blot analysis of spinal cord tissues in transgenic mice. These results suggest that JGK-263, an oral GSK-3β inhibitor, is promising as a novel therapeutic agent for ALS. Still, further biochemical studies on the underlying mechanisms and safety of JGK-263 are necessary. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. 25 CFR 26.3 - What is the purpose of the Job Placement and Training Program? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the purpose of the Job Placement and Training... PLACEMENT AND TRAINING PROGRAM General Applicability § 26.3 What is the purpose of the Job Placement and Training Program? The purpose of the Job Placement and Training Program is to assist eligible applicants to...

  17. 33 CFR 263.23 - Small flood control project authority (Section 205). (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Small flood control project..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS Flood Control Policy § 263.23 Small flood control project authority (Section 205). (a) Legislative authority. Section 205 of the Flood...

  18. Ultra-urban baseflow and stormflow concentrations and fluxes in a watershed undergoing restoration (WS263) (United States)

    Kenneth T. Belt; William P. Stack; Richard V. Pouyat; Kimberly Burgess; Peter M. Groffman; William M. Frost; Sujay S. Kaushal; Guy. Hager


    We discuss the results of sampling baseflow and stormwater runoff in Watershed 263, an ultra-urban catchment in west Baltimore City that is undergoing restoration aimed at both improving water quality as well as the quality of life in its neighborhoods. We focus on urban hydrology and describe the high baseflow and stormwater nutrient, metal, bacterial and other...

  19. A case of de novo duplication of 15q24-q26.3

    Directory of Open Access Journals (Sweden)

    Hye Ran Kim


    Full Text Available Distal duplication, or trisomy 15q, is an extremely rare chromosomal disorder characterized by prenatal and postnatal overgrowth, mental retardation, and craniofacial malformations. Additional abnormalities typically include an unusually short neck, malformations of the fingers and toes, scoliosis and skeletal malformations, genital abnormalities, particularly in affected males, and, in some cases, cardiac defects. The range and severity of symptoms and physical findings may vary from case to case, depending upon the length and location of the duplicated portion of chromosome 15q. Most reported cases of duplication of the long arm of chromosome 15 frequently have more than one segmental imbalance resulting from unbalanced translocations involving chromosome 15 and deletions in another chromosome, as well as other structural chromosomal abnormalities. We report a female newborn with a de novo duplication, 15q24- q26.3, showing intrauterine overgrowth, a narrow asymmetric face with down-slanting palpebral fissures, a large, prominent nose, and micrognathia, arachnodactyly, camptodactyly, congenital heart disease, hydronephrosis, and hydroureter. Chromosomal analysis showed a 46,XX,inv(9(p12q13,dup(15(q24q26.3. Array comparative genomic hybridization analysis revealed a gain of 42 clones on 15q24-q26.3. This case represents the only reported patient with a de novo 15q24-q26.3 duplication that did not result from an unbalanced translocation and did not have a concomitant monosomic component in Korea.

  20. 26 CFR 1.263A-2 - Rules relating to property produced by the taxpayer. (United States)


    ... § 1.263A-1(e)(3)(iii)) that is not required to be capitalized (e.g., selling and distribution costs... revenue ruling or revenue procedure. (d) Cross reference. See § 1.6001-1(a) regarding the duty of...

  1. 12 CFR 263.203 - Procedures for reclassifying a state member bank based on criteria other than capital. (United States)


    ... on unsafe or unsound condition shall include: (i) A statement of the bank's capital measures and... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Procedures for reclassifying a state member bank based on criteria other than capital. 263.203 Section 263.203 Banks and Banking FEDERAL RESERVE...

  2. 26 CFR 1.263A-5 - Exception for qualified creative expenses incurred by certain free-lance authors, photographers... (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Exception for qualified creative expenses incurred by certain free-lance authors, photographers, and artists. 1.263A-5 Section 1.263A-5 Internal...-lance authors, photographers, and artists. ...

  3. 263 Abstract

    African Journals Online (AJOL)


    developing economy has been widely reported. (Kaming et al., 1998; Arditi and Mokhtar, 2000;. Akindele, 2003). ... meet the housing, economic and infrastructure requirements of the emerging megacity. Sample Collection .... schemes are free food vouchers which ranked. 20th among the rank, support for family educational ...

  4. The dolutegravir R263K resistance mutation in HIV-1 integrase is incompatible with the emergence of resistance against raltegravir. (United States)

    Oliveira, Maureen; Mesplède, Thibault; Moïsi, Daniela; Ibanescu, Ruxandra-Ilinca; Brenner, Bluma; Wainberg, Mark A


    Although the integrase inhibitor dolutegravir (DTG) has demonstrated greater resilience than other antiretroviral drugs at withstanding the emergence of HIV-1 resistance mutations, such substitutions can develop, albeit rarely, in treatment-experienced integrase inhibitor-naïve individuals. The most common substitution in integrase under those circumstances is R263K whereas another substitution that was selected against DTG in tissue culture was G118R. The objective of this study was to determine the effects of these DTG-specific resistance substitutions on the ability of HIV-1 to become resistant against either of two other integrase inhibitors, raltegravir (RAL) and elvitegravir (EVG). We performed tissue culture selection experiments using DTG-resistant viruses containing integrase substitutions at positions R263K, H51Y/R263K, E138K/R263K, G118R and H51Y/G118R in the presence of increasing concentrations of either RAL or EVG. Changes in integrase sequences were monitored by genotyping. The presence of the R263K substitution delayed the emergence of resistance against RAL whereas the simultaneous presence of either the H51Y or E138K secondary substitutions in combination with R263K somewhat mitigated this inhibitory effect. In contrast, resistance against EVG appeared earlier than in wild-type virus in viruses containing the R263K and E138K/R263K DTG-associated resistance substitutions. The DTG-resistant R263K substitution antagonized the development of HIV-1 resistance against RAL while partially facilitating the occurrence of resistance against EVG.

  5. A Glio-Protective Role of mir-263a by Tuning Sensitivity to Glutamate

    Directory of Open Access Journals (Sweden)

    Sherry Shiying Aw


    Full Text Available Glutamate is a ubiquitous neurotransmitter, mediating information flow between neurons. Defects in the regulation of glutamatergic transmission can result in glutamate toxicity, which is associated with neurodegeneration. Interestingly, glutamate receptors are expressed in glia, but little is known about their function, and the effects of their misregulation, in these non-neuronal cells. Here, we report a glio-protective role for Drosophila mir-263a mediated by its regulation of glutamate receptor levels in glia. mir-263a mutants exhibit a pronounced movement defect due to aberrant overexpression of CG5621/Grik, Nmdar1, and Nmdar2. mir-263a mutants exhibit excitotoxic death of a subset of astrocyte-like and ensheathing glia in the CNS. Glial-specific normalization of glutamate receptor levels restores cell numbers and suppresses the movement defect. Therefore, microRNA-mediated regulation of glutamate receptor levels protects glia from excitotoxicity, ensuring CNS health. Chronic low-level glutamate receptor overexpression due to mutations affecting microRNA (miRNA regulation might contribute to glial dysfunction and CNS impairment.

  6. Rotational emission-line spectrum of Orion A between 247 and 263 GHZ

    International Nuclear Information System (INIS)

    Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.


    Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data

  7. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Davies, A., E-mail:; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.

  8. Microduplication of 3p26.3 Implicated in Cognitive Development

    Directory of Open Access Journals (Sweden)

    Leah Te Weehi


    Full Text Available We report here a 34-month-old boy with global developmental delay referred for molecular karyotyping and fragile X studies. Molecular karyotype analysis revealed a microduplication in the 3p26.3 region involving part of the CHL1 and CNTN6 genes. Several deletions, one translocation, and one duplication have previously been described in this region of chromosome 3. The CHL1 gene has been proposed as a dosage-sensitive gene with a central role in cognitive development, and so the microduplication reported here appears to be implicated in our patient’s phenotype.

  9. Architecture design of motion estimation for ITU-T H.263 (United States)

    Ku, Chung-Wei; Lin, Gong-Sheng; Chen, Liang-Gee; Lee, Yung-Ping


    Digitalized video and audio system has become the trend of the progress in multimedia, because it provides great performance in quality and feasibility of processing. However, as the huge amount of information is needed while the bandwidth is limitted, data compression plays an important role in the system. Say, for a 176 x 144 monochromic sequence with 10 frames/sec frame rate, the bandwidth is about 2Mbps. This wastes much channel resource and limits the applications. MPEG (moving picttre ezpert groip) standardizes the video codec scheme, and it performs high compression ratio while providing good quality. MPEG-i is used for the frame size about 352 x 240 and 30 frames per second, and MPEG-2 provides scalibility and can be applied on scenes with higher definition, say HDTV (high definition television). On the other hand, some applications concerns the very low bit-rate, such as videophone and video-conferencing. Because the channel bandwidth is much limitted in telephone network, a very high compression ratio must be required. ITU-T announced the H.263 video coding standards to meet the above requirements.8 According to the simulation results of TMN-5,22 it outperforms 11.263 with little overhead of complexity. Since wireless communication is the trend in the near future, low power design of the video codec is an important issue for portable visual telephone. Motion estimation is the most computation consuming parts in the whole video codec. About 60% of the computation is spent on this parts for the encoder. Several architectures were proposed for efficient processing of block matching algorithms. In this paper, in order to meet the requirements of 11.263 and the expectation of low power consumption, a modified sandwich architecture in21 is proposed. Based on the parallel processing philosophy, low power is expected and the generation of either one motion vector or four motion vectors with half-pixel accuracy is achieved concurrently. In addition, we will

  10. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam. (United States)

    Davies, A; Haberberger, D; Boni, R; Ivancic, S; Brown, R; Froula, D H


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.

  11. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam

    International Nuclear Information System (INIS)

    Davies, A.; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H.


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry

  12. Deformed potential energy of $^{263}Db$ in a generalized liquid drop model

    CERN Document Server

    Chen Bao Qiu; Zhao Yao Lin; 10.1088/0256-307X/20/11/009


    The macroscopic deformed potential energy for super-heavy nuclei /sup 263/Db, which governs the entrance and alpha decay channels, is determined within a generalized liquid drop model (GLDM). A quasi- molecular shape is assumed in the GLDM, which includes volume-, surface-, and Coulomb-energies, proximity effects, mass asymmetry, and an accurate nuclear radius. The microscopic single particle energies derived from a shell model in an axially deformed Woods- Saxon potential with a quasi-molecular shape. The shell correction is calculated by the Strutinsky method. The total deformed potential energy of a nucleus can be calculated by the macro-microscopic method as the summation of the liquid-drop energy and the Strutinsky shell correction. The theory is applied to predict the deformed potential energy of the experiment /sup 22/Ne+/sup 241/Am to /sup 263/Db* to /sup 259/Db+4 n, which was performed on the Heavy Ion Accelerator in Lanzhou. It is found that the neck in the quasi-molecular shape is responsible for t...


    Directory of Open Access Journals (Sweden)

    Oka Widyantara


    Full Text Available Mode baseline encoder video H.263 menerapkan teknik estimasi dan kompensasi gerak dengan satu vector gerak untuk setiap macroblock. Prosedur area pencarian menggunakan pencarian penuh dengan akurasi setengah pixel pada bidang [16,15.5] membuat prediksi di tepian frame tidak dapat diprediksi dengan baik. Peningkatan unjuk kerja pengkodean prediksi interframe encoder video H.263 dengan optimalisasi teknik estimasi dan kompensasi gerak diimplementasikan dengan penambahan area pencarian [31.5,31.5] (unrestricted motion vector, Annex D dan 4 motion vector (advanced prediction mode, Annex F. Hasil penelitian menunjukkan bahwa advanced mode mampu meningkatkan nilai SNR sebesar 0.03 dB untuk sequence video claire, 0.2 dB untuk sequence video foreman, 0.041 dB untuk sequence video Glasgow, dan juga mampu menurunkan bit rate pengkodean sebesar 2.3 % untuk video Claire, 15.63 % untuk video Foreman,  dan 9.8% untuk video Glasgow dibandingkan dengan implementasi 1 motion vector pada pengkodean baseline mode.

  14. A Study of the Orbital Dynamics of and Around the Asteroid 2001 SN263 (United States)

    Araujo, Rosana; Winter, O. C.; Sukhanov, A.; Prado, A. F. B.


    The asteroid 2001 SN263 was revealed in February 2008 as the first known near-Earth triple asteroidal system (Nolan, 2008). Using preliminary information about the orbit and the physical composition of such asteroid (Becker et. al, 2009), we have performed numerical integrations in order to study the orbital dynamics of the system, and the effects of the gravitational perturbations of the planets Mars, Earth and Jupiter on such system. We discuss the evolution of each body when only the three asteroids are considered (mutual perturbation), and the effects due to Jupiter and Mars, and also due close-approaches between the triple asteroid and the Earth. Then, we analyze a system composed by seven bodies: Sun, triple asteroidal system, Mars, Earth and Jupiter, in order to identify equilibrium regions and propose several orbits for a spacecraft in a potential space mission to explore this system.

  15. Improvement of surface integrity of Nimonic C 263 super alloy produced by WEDM through various post-processing techniques

    Czech Academy of Sciences Publication Activity Database

    Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.


    Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools Impact factor: 2.209, year: 2016

  16. 7 CFR 868.261 - Grade and grade requirements for the classes of brown rice for processing. (See also § 868.263.) (United States)


    ... rice for processing. (See also § 868.263.) 868.261 Section 868.261 Agriculture Regulations of the... Standards § 868.261 Grade and grade requirements for the classes of brown rice for processing. (See also... brown rice for processing, see § 868.263(a). 2 For the special grade Glutinous brown rice for processing...

  17. 26 CFR 1.263(a)-5 - Amounts paid or incurred to facilitate an acquisition of a trade or business, a change in the... (United States)


    ... stock to fund future growth. Y pays $5,000,000 in professional fees for investment banking services... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Amounts paid or incurred to facilitate an... transactions. 1.263(a)-5 Section 1.263(a)-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE...

  18. 20 CFR 1002.263 - Does the employee pay interest when he or she makes up missed contributions or elective deferrals? (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Does the employee pay interest when he or she makes up missed contributions or elective deferrals? 1002.263 Section 1002.263 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF LABOR REGULATIONS UNDER THE UNIFORMED SERVICES...

  19. Analysis of impulsive maneuvers to keep orbits around the asteroid 2001SN263 (United States)

    Santos, Willer G.; Prado, Antonio F. B. A.; Oliveira, Geraldo M. C.; Santos, Leonardo B. T.


    The strongly perturbed environment of a small body, such as an asteroid, can complicate the prediction of orbits used for close proximity operations. Inaccurate predictions may make the spacecraft collide with the asteroid or escape to the deep space. The main forces acting in the dynamics come from the solar radiation pressure and from the body's weak gravity field. This paper investigates the feasibility of using bi-impulsive maneuvers to avoid the aforementioned non-desired phenomena (collisions and escapes) by connecting orbits around the triple system asteroid 2001SN263, which is the target of a proposed Brazilian space mission. In terms of a mathematical formulation, a recently presented rotating dipole model is considered with oblateness in both primaries. In addition, a "two-point boundary value problem" is solved to find a proper transfer trajectory. The results presented here give support to identifying the best strategy to find orbits for close proximity operations, in terms of long orbital lifetimes and low delta-V consumptions. Numerical results have also demonstrated the significant influence of the spacecraft orbital elements (semi-major axis and eccentricity), angular position of the Sun and spacecraft area-to-mass ratio, in the performance of the bi-impulsive maneuver.

  20. Subtotal coronoid ostectomy for treatment of medial coronoid disease in 263 dogs. (United States)

    Fitzpatrick, Noel; Smith, Thomas J; Evans, Richard B; O'Riordan, Jerry; Yeadon, Russell


    To document clinical outcomes after subtotal coronoid ostectomy (SCO) for treatment of medial coronoid disease (MCD). Prospective clinical study. Dogs (n=263) with MCD. MCD was treated by a combination of SCO via mini-arthrotomy, cage confinement (6 weeks), leash restricted exercise (12 weeks) and pentosan polysulfate administration. Outcomes were assessed by clinical examination in the short-term (324 elbows), owner questionnaires (146 dogs), clinical examination (90 dogs), subjective assessment of gait (110 elbows) and radiographic examination (180 elbows), 4 months to 7 years 7 months after surgery. One intraoperative complication occurred (1 elbow with fissuring of the ulna) and 8.2% elbows had immediate postoperative complications, the most common being wound infection (7%). Improvement in subjective lameness assessment to a score of 0 was noted at 5 weeks in 74.4% of elbows (veterinary) and 45.6% (owner) and at 12 weeks in 71.5% (veterinary), and 91.2% (owner). Subjective assessments of outcomes in the medium-term revealed 81.9% dogs remained sound, with significantly (Pdogs received no NSAID. Clinical examination revealed good limb function and subjective assessment showed 51% of limbs were free from lameness. Radiographic progression of osteophytosis occurred on average by one grade. Management of MCD using the described management regime, including SCO via mini-arthrotomy, deserves consideration and comparison with existing treatment methods. Management of MCD by SCO can be considered when gross fissuring or fragmentation of the MCP is not evident. This technique does not require specialized instrumentation.

  1. The role of particle ripening on the creep acceleration of Nimonic 263 superalloy

    Directory of Open Access Journals (Sweden)

    Angella Giuliano


    Full Text Available Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C Nimonic 263, a polycrystalline nickel base superalloy used for combustion chambers of gas turbines. The experimental results suggest that the reinforcing particle evolution is not the main reason for the creep acceleration that seems to be better described by a strain correlated damage, such as the accumulation of mobile dislocations or the grain boundary cavitation. The coarsened microstructure, obtained by overageing the alloy at high temperature before creep testing, mainly influences the initial stage of the creep, resulting in a higher minimum creep rate and a corresponding reduction of the creep resistance.

  2. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D. [Laboratory for Laser Energetics, University of Rochester, 250 E. River Rd., Rochester, New York 14616 (United States); Kugland, N. L.; Rushford, M. C. [Lawrence Livermore National Laboratory, University of California, P. O. Box 808, Livermore, California 94551 (United States)


    A 10-ps, 263-nm (4{omega}) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution ({approx}1 -{mu}m full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10{sup 4} with respect to all wavelengths outside of the 263 {+-} 2 nm measurement range.

  3. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (~1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 104 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  4. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    International Nuclear Information System (INIS)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75–80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (∼1 −μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10 4 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  5. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam. (United States)

    Froula, D H; Boni, R; Bedzyk, M; Craxton, R S; Ehrne, F; Ivancic, S; Jungquist, R; Shoup, M J; Theobald, W; Weiner, D; Kugland, N L; Rushford, M C


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (~1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10(4) with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  6. Heat Killed Lactobacillus reuteri GMNL-263 Reduces Fibrosis Effects on the Liver and Heart in High Fat Diet-Hamsters via TGF-β Suppression

    Directory of Open Access Journals (Sweden)

    Wei-Jen Ting


    Full Text Available Obesity is one of the major risk factors for nonalcoholic fatty liver disease (NAFLD, and NAFLD is highly associated with an increased risk of cardiovascular disease (CVD. Scholars have suggested that certain probiotics may significantly impact cardiovascular health, particularly certain Lactobacillus species, such as Lactobacillus reuteri GMNL-263 (Lr263 probiotics, which have been shown to reduce obesity and arteriosclerosis in vivo. In the present study, we examined the potential of heat-killed bacteria to attenuate high fat diet (HFD-induced hepatic and cardiac damages and the possible underlying mechanism of the positive effects of heat-killed Lr263 oral supplements. Heat-killed Lr263 treatments (625 and 3125 mg/kg-hamster/day were provided as a daily supplement by oral gavage to HFD-fed hamsters for eight weeks. The results show that heat-killed Lr263 treatments reduce fatty liver syndrome. Moreover, heat-killed Lactobacillus reuteri GMNL-263 supplementation in HFD hamsters also reduced fibrosis in the liver and heart by reducing transforming growth factor β (TGF-β expression levels. In conclusion, heat-killed Lr263 can reduce lipid metabolic stress in HFD hamsters and decrease the risk of fatty liver and cardiovascular disease.

  7. American Association of Physicists in Medicine Task Group 263: Standardizing Nomenclatures in Radiation Oncology. (United States)

    Mayo, Charles S; Moran, Jean M; Bosch, Walter; Xiao, Ying; McNutt, Todd; Popple, Richard; Michalski, Jeff; Feng, Mary; Marks, Lawrence B; Fuller, Clifton D; Yorke, Ellen; Palta, Jatinder; Gabriel, Peter E; Molineu, Andrea; Matuszak, Martha M; Covington, Elizabeth; Masi, Kathryn; Richardson, Susan L; Ritter, Timothy; Morgas, Tomasz; Flampouri, Stella; Santanam, Lakshmi; Moore, Joseph A; Purdie, Thomas G; Miller, Robert C; Hurkmans, Coen; Adams, Judy; Jackie Wu, Qing-Rong; Fox, Colleen J; Siochi, Ramon Alfredo; Brown, Norman L; Verbakel, Wilko; Archambault, Yves; Chmura, Steven J; Dekker, Andre L; Eagle, Don G; Fitzgerald, Thomas J; Hong, Theodore; Kapoor, Rishabh; Lansing, Beth; Jolly, Shruti; Napolitano, Mary E; Percy, James; Rose, Mark S; Siddiqui, Salim; Schadt, Christof; Simon, William E; Straube, William L; St James, Sara T; Ulin, Kenneth; Yom, Sue S; Yock, Torunn I


    A substantial barrier to the single- and multi-institutional aggregation of data to supporting clinical trials, practice quality improvement efforts, and development of big data analytics resource systems is the lack of standardized nomenclatures for expressing dosimetric data. To address this issue, the American Association of Physicists in Medicine (AAPM) Task Group 263 was charged with providing nomenclature guidelines and values in radiation oncology for use in clinical trials, data-pooling initiatives, population-based studies, and routine clinical care by standardizing: (1) structure names across image processing and treatment planning system platforms; (2) nomenclature for dosimetric data (eg, dose-volume histogram [DVH]-based metrics); (3) templates for clinical trial groups and users of an initial subset of software platforms to facilitate adoption of the standards; (4) formalism for nomenclature schema, which can accommodate the addition of other structures defined in the future. A multisociety, multidisciplinary, multinational group of 57 members representing stake holders ranging from large academic centers to community clinics and vendors was assembled, including physicists, physicians, dosimetrists, and vendors. The stakeholder groups represented in the membership included the AAPM, American Society for Radiation Oncology (ASTRO), NRG Oncology, European Society for Radiation Oncology (ESTRO), Radiation Therapy Oncology Group (RTOG), Children's Oncology Group (COG), Integrating Healthcare Enterprise in Radiation Oncology (IHE-RO), and Digital Imaging and Communications in Medicine working group (DICOM WG); A nomenclature system for target and organ at risk volumes and DVH nomenclature was developed and piloted to demonstrate viability across a range of clinics and within the framework of clinical trials. The final report was approved by AAPM in October 2017. The approval process included review by 8 AAPM committees, with additional review by ASTRO

  8. Data on the DNA damaging and mutagenic potential of the BH3-mimetics ABT-263/Navitoclax and TW-37


    Green, Maja M.; Shekhar, Tanmay M.; Hawkins, Christine J.


    Unfortunately, the mutagenic activities of chemotherapy and radiotherapy can provoke development of therapy-induced malignancies in cancer survivors. Non-mutagenic anti-cancer therapies may be less likely to trigger subsequent malignant neoplasms. Here we present data regarding the DNA damaging and mutagenic potential of two drugs that antagonize proteins within the Bcl-2 family: ABT-263/Navitoclax and TW-37. Our data reveal that concentrations of these agents that stimulated Bax/Bak-dependen...

  9. Improvement of surface integrity of Nimonic C 263 super alloy produced by WEDM through various post-processing techniques

    Czech Academy of Sciences Publication Activity Database

    Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.


    Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016

  10. Supplementary heat-killed Lactobacillus reuteri GMNL-263 ameliorates hyperlipidaemic and cardiac apoptosis in high-fat diet-fed hamsters to maintain cardiovascular function. (United States)

    Ting, Wei-Jen; Kuo, Wei-Wen; Kuo, Chia-Hua; Yeh, Yu-Lan; Shen, Chia-Yao; Chen, Ya-Hui; Ho, Tsung-Jung; Viswanadha, Vijaya Padma; Chen, Yi-Hsing; Huang, Chih-Yang


    Obesity and hyperlipidaemia increase the risk of CVD. Some strains of probiotics have been suggested to have potential applications in cardiovascular health by lowering serum LDL-cholesterol. In this work, high-fat diet-induced hyperlipidaemia in hamsters was treated with different doses (5×108 and 2·5×109 cells/kg per d) of heat-killed Lactobacillus reuteri GMNL-263 (Lr263) by oral gavage for 8 weeks. The serum lipid profile analysis showed that LDL-cholesterol and plasma malondialdehyde (P-MDA) were reduced in the GMNL-263 5×108 cells/kg per d treatment group. Total cholesterol and P-MDA were reduced in the GMNL-263 2·5×109 cells/kg per d treatment group. In terms of heart function, the GMNL-263 2·5×109 cells/kg per d treatments improved the ejection fraction from 85·71 to 91·81 % and fractional shortening from 46·93 to 57·92 % in the high-fat diet-fed hamster hearts. Moreover, the GMNL-263-treated, high-fat diet-fed hamster hearts exhibited reduced Fas-induced myocardial apoptosis and a reactivated IGF1R/PI3K/Akt cell survival pathway. Interestingly, the GMNL-263 treatments also enhanced the heat-shock protein 27 expression in a dose-dependent manner, but the mechanism for this increase remains unclear. In conclusion, supplementary heat-killed L. reuteri GMNL-263 can slightly reduce serum cholesterol. The anti-hyperlipidaemia effects of GMNL-263 may reactivate the IGF1R/PI3K/Akt cell survival pathway and reduce Fas-induced myocardial apoptosis in high-fat diet-fed hamster hearts.

  11. Antiobesity effect of Lactobacillus reuteri 263 associated with energy metabolism remodeling of white adipose tissue in high-energy-diet-fed rats. (United States)

    Chen, Li-Han; Chen, Yi-Hsing; Cheng, Kuan-Chen; Chien, Ting-Yi; Chan, Ching-Hung; Tsao, Shu-Ping; Huang, Hui-Yu


    Obesity is a serious and costly issue to the medical welfare worldwide. Probiotics have been suggested as one of the candidates to resolve the obesity-associated problems, but how they combat obesity is not fully understood. Herein, we investigated the effects of Lactobacillus reuteri 263 (L. reuteri 263) on antiobesity using four groups of Sprague-Dawley rats (n=10/group), namely, C (normal diet with vehicle treatment), HE [high-energy diet (HED) with vehicle treatment], 1X (HED with 2.1×10 9 CFU/kg/day of L. reuteri 263) and 5X (HED with 1.05×10 10 CFU/kg/day of L. reuteri 263), for 8 weeks. L. reuteri 263 improved the phenomenon of obesity, serum levels of proinflammatory factors and antioxidant enzymes. More importantly, L. reuteri 263 increased oxygen consumption in white adipose tissue (WAT). The mRNA expressions of thermogenesis genes uncoupling protein-1, uncoupling protein-3, carnitine palmitoyltransferase-1 and cell death-inducing DFFA-like effector-a were up-regulated in WAT of the 5X group. Moreover, L. reuteri 263 might induce browning of WAT due to the higher mRNA levels of browning-related genes peroxisome proliferator-activated receptor-γ, PR domain containing-16, Pparγ coactivator-1α, bone morphogenetic protein-7 and fibroblast growth factor-21 in the 1X and 5X groups compared to the HE group. Finally, L. reuteri 263 altered the expressions of genes involved in glucose and lipid metabolisms in WAT, including increasing the levels of glucose transporter type 4 and carbohydrate-responsive element-binding protein and decreasing the expression of Acetyl-CoA carboxylase-1. The results suggest that L. reuteri 263 may treat obesity through energy metabolism remodeling of WAT in the high-energy-diet-induced obese rats. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. The Oblateness Effect On The Dynamics And Stability Of The Triple System 2001SN263. (United States)

    Araujo, Rosana; Winter, O. C.; Prado, A. F. B.; Sukhanov, A.


    The asteroidal system 2001SN263 is composed by three asteroids of about 3.0 km, 1.0 km and 0.5 km (2008; Nolan et al.). An interesting characteristic of this system is that it crosses the orbit of Mars and approaches the orbit of the Earth. In 2009 we presented a study about the dynamics of such system (2009, Araujo et al.), where we discussed the effects in the asteroids’ orbits due to their mutual gravitational interaction and due to the gravitational perturbation from the planets Earth, Mars and Jupiter (close-approach effects and resonances with the planets). In such study the central asteroid was considered spherical (J2=0.0), but according to Becker et al. (2009) there is an uncertainty about the shape of this body, which allows a configuration of maximum value of J2=0.08. In the present work we made a similar study of the dynamics of the asteroids presented in 2009, but now taking into account the oblateness of the central body, considering values for J2 in the interval 0.0<=J2<=0.08. We also present a study in which we found regions of stability and instability inside such system. For that, we have performed numerical integrations considering seven massive bodies (Sun, Earth, Mars, Jupiter and the three asteroids) and thousands of particles randomly distributed in the neighborhood of the three asteroids, in two cases: i) considering the central-body spherical (J2=0.0) and ii) considering the oblateness of the central body with the maximum value of J2=0.08. We analyzed the orbital evolution of such particles in the system, monitoring cases where collisions or escapes happen, and what are the particles that survive in a given time span. These different possible behaviors are considered to determinate the regions of stability and instability. The determination of such regions is extremely relevant when planning spacecraft missions to visit this system.

  13. The R263K mutation in HIV integrase that is selected by dolutegravir may actually prevent clinically relevant resistance to this compound. (United States)

    Wainberg, Mark; Anstett, Kaitlin; Mesplede, Thibault; Quashie, Peter; Han, Yingshan; Oliveira, Maureen


    Drug resistance against dolutegravir (DTG) or the nucleosides with which it has been co-administered has never been observed in patients receiving this drug in first-line therapy. In contrast, a R263K mutation that confers low-level resistance (3-4 fold) to DTG has been selected by DTG in culture. Our group has ascribed the absence of resistance to DTG to the high fitness cost exacted by the R263K mutation and an inability of HIV to generate compensatory mutations. We generated recombinant integrase enzymes and viruses containing various combinations of mutations and studied these enzymatically and in culture. We also selected for resistance against raltegravir (RAL) using viruses containing the R263K mutation. The R263K mutation alone conferred an approximate 3-fold level of resistance to DTG and a 40% loss in viral replicative capacity and recombinant integrase activity. Secondary mutations selected at positions H51Y or E138K did not individually affect either enzyme activity or DTG resistance, but the combination of R263K together with H51Y or E138K increased DTG resistance to about 7-fold accompanied by a ≈75% loss in each of viral replication capacity, and both in vitro and in vivo integrase activity. Conversely, combinations of R263K together with multiple resistance mutations for RAL and/or EVG at positions 92,143, 148 and 155 resulted in even further diminished enzymatic activity that may be incompatible with viral survival. Modelling of the 3-dimensional structure of integrase suggests that R263K is located in a region that may not permit further mutagenesis if secondary mutations at H51Y or E138K are also present. Moreover, integrase that contains R263K together with substitutions at positions 92, 143, 148 and 155 may be enzymatically inactive. The use of the R263K-containing virus to select for resistance to RAL led to the appearance of RAL-containing mutations but the loss of R263K. Secondary mutations to R263K following selection with DTG have all

  14. Lactobacillus paracasei GMNL-32, Lactobacillus reuteri GMNL-89 and L. reuteri GMNL-263 ameliorate hepatic injuries in lupus-prone mice. (United States)

    Hsu, Tsai-Ching; Huang, Chih-Yang; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Tzang, Bor-Show


    Probiotics are known to regulate host immunity by interacting with systemic and mucosal immune cells as well as intestinal epithelial cells. Supplementation with certain probiotics has been reported to be effective against various disorders, including immune-related diseases. However, little is known about the effectiveness of Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263) in the management of autoimmune diseases, especially systemic lupus erythematosus (SLE). NZB/W F1 mice, which are a lupus-prone animal model, were orally gavaged with GMNL-32, GMNL-89 or GMNL-263 to investigate the effects of these Lactobacillus strains on liver injuries in NZB/W F1 mice. The results thus obtained reveal that supplementary GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice ameliorates hepatic apoptosis and inflammatory indicators, such as matrix metalloproteinase-9 activity and C-reactive protein and inducible nitric oxide synthase expressions. In addition, supplementation with GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice reduced the expressions of hepatic IL-1β, IL-6 and TNF-α proteins by suppressing the mitogen-activated protein kinase and NF-κB signalling pathways. These findings, presented here for the first time, reveal that GMNL-32, GMNL-89 and GMNL-263 mitigate hepatic inflammation and apoptosis in lupus-prone mice and may support an alternative remedy for liver disorders in cases of SLE.

  15. Synthesis research of squalene synthetase inhibitor CP-263, 114. How is skeleton construction carried out?; Sukuaren gosei koso sogaizai CP-263,114 no gosei kenkyu - ikanishite kokkaku kochiku wo okonauka?

    Energy Technology Data Exchange (ETDEWEB)

    Matsushima, Y. [Tokyo Inst. of Tech., Tokyo (Japan)


    CP-263, 114 isolated as a squalene synthetase inhibitor and the decyclization of CP-225, 917 was not only expected to be a lead chemical compound of the hypercholesterolemia medicine, but also have collected the attention of the organic synthetic chemistry researchers all over the world from the ring structure of advanced oxygen functionalization. In the CP- chemical compound, the constructive method of the bicyclo ring structure is a key of the synthesis, there are three reports to use the intramolecular Diels-Alder reaction (Fukuyama) and the siloxy-Cope rearrangement (Leighton), intramolecular Heck reaction (Danishefsky) as a result of succeeding in including the foothold to the side-chain lactol ring. Recently, Nicolaou et al. succeeded for the first time in the total synthesis racemic modification shell. They carried out the skeleton construction by the intramolecular Diels-Alder reaction, and constructed the maleic anhydride structure in taking the ketone as a foothold. (NEDO)

  16. Data on the DNA damaging and mutagenic potential of the BH3-mimetics ABT-263/Navitoclax and TW-37. (United States)

    Green, Maja M; Shekhar, Tanmay M; Hawkins, Christine J


    Unfortunately, the mutagenic activities of chemotherapy and radiotherapy can provoke development of therapy-induced malignancies in cancer survivors. Non-mutagenic anti-cancer therapies may be less likely to trigger subsequent malignant neoplasms. Here we present data regarding the DNA damaging and mutagenic potential of two drugs that antagonize proteins within the Bcl-2 family: ABT-263/Navitoclax and TW-37. Our data reveal that concentrations of these agents that stimulated Bax/Bak-dependent signaling provoked little DNA damage and failed to trigger mutations in surviving cells. The data supplied in this article is related to the research work entitled "Inhibition of Bcl-2 or IAP proteins does not provoke mutations in surviving cells" [1].

  17. Data on the DNA damaging and mutagenic potential of the BH3-mimetics ABT-263/Navitoclax and TW-37

    Directory of Open Access Journals (Sweden)

    Maja M. Green


    Full Text Available Unfortunately, the mutagenic activities of chemotherapy and radiotherapy can provoke development of therapy-induced malignancies in cancer survivors. Non-mutagenic anti-cancer therapies may be less likely to trigger subsequent malignant neoplasms. Here we present data regarding the DNA damaging and mutagenic potential of two drugs that antagonize proteins within the Bcl-2 family: ABT-263/Navitoclax and TW-37. Our data reveal that concentrations of these agents that stimulated Bax/Bak-dependent signaling provoked little DNA damage and failed to trigger mutations in surviving cells. The data supplied in this article is related to the research work entitled "Inhibition of Bcl-2 or IAP proteins does not provoke mutations in surviving cells" [1].

  18. Scrapie Agent (Strain 263K) can transmit disease via the oral route after persistence in soil over years. (United States)

    Seidel, Bjoern; Thomzig, Achim; Buschmann, Anne; Groschup, Martin H; Peters, Rainer; Beekes, Michael; Terytze, Konstantin


    The persistence of infectious biomolecules in soil constitutes a substantial challenge. This holds particularly true with respect to prions, the causative agents of transmissible spongiform encephalopathies (TSEs) such as scrapie, bovine spongiform encephalopathy (BSE), or chronic wasting disease (CWD). Various studies have indicated that prions are able to persist in soil for years without losing their pathogenic activity. Dissemination of prions into the environment can occur from several sources, e.g., infectious placenta or amniotic fluid of sheep. Furthermore, environmental contamination by saliva, excrements or non-sterilized agricultural organic fertilizer is conceivable. Natural transmission of scrapie in the field seems to occur via the alimentary tract in the majority of cases, and scrapie-free sheep flocks can become infected on pastures where outbreaks of scrapie had been observed before. These findings point to a sustained contagion in the environment, and notably the soil. By using outdoor lysimeters, we simulated a contamination of standard soil with hamster-adapted 263K scrapie prions, and analyzed the presence and biological activity of the soil-associated PrP(Sc) and infectivity by Western blotting and hamster bioassay, respectively. Our results showed that 263K scrapie agent can persist in soil at least over 29 months. Strikingly, not only the contaminated soil itself retained high levels of infectivity, as evidenced by oral administration to Syrian hamsters, but also feeding of aqueous soil extracts was able to induce disease in the reporter animals. We could also demonstrate that PrP(Sc) in soil, extracted after 21 months, provides a catalytically active seed in the protein misfolding cyclic amplification (PMCA) reaction. PMCA opens therefore a perspective for considerably improving the detectability of prions in soil samples from the field.

  19. Evaluation of efficacy of prion reduction filters using blood from an endogenously infected 263K scrapie hamster model. (United States)

    McLeod, Neil P; Nugent, Philip; Dixon, Douglas; Dennis, Mike; Cornwall, Mark; Mallinson, Gary; Watkins, Nicholas; Thomas, Stephen; Sutton, J Mark


    The P-Capt prion reduction filter (MacoPharma) removes prion infectivity in model systems. This independent evaluation assesses prion removal from endogenously infected animal blood, using CE-marked P-Capt filters, and replicates the proposed use of the filter within the UK Blood Services. Two units of blood, generated from 263K scrapie-infected hamsters, were processed using leukoreduction filters (LXT-quadruple, MacoPharma). Approximately 100 mL of the removed plasma was added back to the red blood cells (RBCs) and the blood was filtered through a P-Capt filter. Samples of unfiltered whole blood, the prion filter input (RBCs plus plasma and SAGM [RBCPS]), and prion-filtered leukoreduced blood (PFB) were injected intracranially into hamsters. Clinical symptoms were monitored for 500 ± 1 day, and brains were assessed for spongiosis and prion protein deposit. In Filtration Run 1, none of the 50 challenged animals were diagnosed with scrapie after inoculation with the RBCPS fraction, while two of 190 hamsters injected with PFB were infected. In Filtration Run 2, one of 49 animals injected with RBCPS and two of 193 hamsters injected with PFB were infected. Run 1 reduced the infectious dose (ID) by 1.467 log (>1.187 log and <0.280 log for leukoreduction and prion filtration, respectively). Run 2 reduced prion infectivity by 1.424 log (1.127 and 0.297 log, respectively). Residual infectivity was estimated at 0.212 ± 0.149 IDs/mL (Run 1) and 0.208 ± 0.147 IDs/mL (Run 2). Leukoreduction removed the majority of infectivity from 263K scrapie hamster blood. The P-Capt filter removed a proportion of the remaining infectivity, but residual infectivity was observed in two independent processes. © 2015 AABB.

  20. Chromosome 15q overgrowth syndrome: Prenatal diagnosis, molecular cytogenetic characterization, and perinatal findings in a fetus with dup(15(q26.2q26.3

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen


    Conclusion: The present case provides evidence for prenatal overgrowth, craniosynostosis, and characteristic facial dysmorphism in association with a duplication of 15q26.2→q26.3 and a duplication of the IGF1R gene. Prenatal diagnosis of fetal overgrowth should include a differential diagnosis of the chromosome 15q overgrowth syndrome.

  1. Outbreak of Invasive Infections From Subtype emm26.3 Group A Streptococcus Among Homeless Adults-Anchorage, Alaska, 2016-2017. (United States)

    Mosites, Emily; Frick, Anna; Gounder, Prabhu; Castrodale, Louisa; Li, Yuan; Rudolph, Karen; Hurlburt, Debby; Lecy, Kristen D; Zulz, Tammy; Adebanjo, Tolu; Onukwube, Jennifer; Beall, Bernard; Van Beneden, Chris A; Hennessy, Thomas; McLaughlin, Joseph; Bruce, Michael G


    In 2016, we detected an outbreak of group A Streptococcus (GAS) invasive infections among the estimated 1000 persons experiencing homelessness (PEH) in Anchorage, Alaska. We characterized the outbreak and implemented a mass antibiotic intervention at homeless service facilities. We identified cases through the Alaska GAS laboratory-based surveillance system. We conducted emm typing, antimicrobial susceptibility testing, and whole-genome sequencing on all invasive isolates and compared medical record data of patients infected with emm26.3 and other emm types. In February 2017, we offered PEH at 6 facilities in Anchorage a single dose of 1 g of azithromycin. We collected oropharyngeal and nonintact skin swabs on a subset of participants concurrent with the intervention and 4 weeks afterward. From July 2016 through April 2017, we detected 42 invasive emm26.3 cases in Anchorage, 35 of which were in PEH. The emm26.3 isolates differed on average by only 2 single-nucleotide polymorphisms. Compared to other emm types, infection with emm26.3 was associated with cellulitis (odds ratio [OR], 2.5; P = .04) and necrotizing fasciitis (OR, 4.4; P = .02). We dispensed antibiotics to 391 PEH. Colonization with emm26.3 decreased from 4% of 277 at baseline to 1% of 287 at follow-up (P = .05). Invasive GAS incidence decreased from 1.5 cases per 1000 PEH/week in the 6 weeks prior to the intervention to 0.2 cases per 1000 PEH/week in the 6 weeks after (P = .01). In an invasive GAS outbreak in PEH in Anchorage, mass antibiotic administration was temporally associated with reduced invasive disease cases and colonization prevalence.

  2. miR-71 and miR-263 Jointly Regulate Target Genes Chitin synthase and Chitinase to Control Locust Molting. (United States)

    Yang, Meiling; Wang, Yanli; Jiang, Feng; Song, Tianqi; Wang, Huimin; Liu, Qing; Zhang, Jie; Zhang, Jianzhen; Kang, Le


    Chitin synthase and chitinase play crucial roles in chitin biosynthesis and degradation during insect molting. Silencing of Dicer-1 results in reduced levels of mature miRNAs and severely blocks molting in the migratory locust. However, the regulatory mechanism of miRNAs in the molting process of locusts has remained elusive. In this study, we found that in chitin metabolism, two crucial enzymes, chitin synthase (CHS) and chitinase (CHT) were regulated by miR-71 and miR-263 during nymph molting. The coding sequence of CHS1 and the 3'-untranslated region of CHT10 contain functional binding sites for miR-71 and miR-263, respectively. miR-71/miR-263 displayed cellular co-localization with their target genes in epidermal cells and directly interacted with CHS1 and CHT10 in the locust integument, respectively. Injections of miR-71 and miR-263 agomirs suppressed the expression of CHS1 and CHT10, which consequently altered chitin production of new and old cuticles and resulted in a molting-defective phenotype in locusts. Unexpectedly, reduced expression of miR-71 and miR-263 increased CHS1 and CHT10 mRNA expression and led to molting defects similar to those induced by miRNA delivery. This study reveals a novel function and balancing modulation pattern of two miRNAs in chitin biosynthesis and degradation, and it provides insight into the underlying molecular mechanisms of the molting process in locusts.

  3. Relationships of damaged starch granules and particle size distribution with pasting and thermal profiles of milled MR263 rice flour. (United States)

    Asmeda, R; Noorlaila, A; Norziah, M H


    This research was conducted to investigate the effects of different grinding techniques (dry, semi-wet and wet) of milled rice grains on the damaged starch and particle size distribution of flour produced from a new variety, MR263, specifically related to the pasting and thermal profiles. The results indicated that grinding techniques significantly (pflour. Wet grinding process yields flour with lowest percentage of starch damage (7.37%) and finest average particle size (8.52μm). Pasting and gelatinization temperature was found in the range of 84.45-89.63°C and 59.86-75.31°C, respectively. Dry ground flour attained the lowest pasting and gelatinization temperature as shown by the thermal and pasting profiles. Correlation analysis revealed that percentage of damaged starch granules had a significant, negative relationship with pasting temperature while average particle size distribution had a significant, strong negative relationship with gelatinization temperature. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Total conversion coefficient of the 263 keV (21/sup 2//2->13/sup +//2) transition in sup(93m)Mo

    Energy Technology Data Exchange (ETDEWEB)

    Suryanaryana, C.; Venkateswara Rao, M.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.


    The total conversion coefficient of the 263 keV gamma transition in the decay scheme of sup(93m)Mo is measured by intensity balance method using a HP Ge spectrometer system. The experimental value of ..cap alpha..sub(T)(263 keV) is found to be 0.696 +- 0.05 which is in agreement with the theoretical values 0.72 and 0.7. The transition probability T(E4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate. A good agreement is noted between the theory and the experiment for the value of T(E4).

  5. Reviewed plan of the ALR, the laser rangefinder for the ASTER deep space mission to the triple asteroid 2001-SN263 (United States)

    de Brum, A. G. V.; da Cruz, F. C.


    The Brazilian deep space mission ASTER plans to send a small spacecraft to investigate the triple asteroid 2001-SN263. The launch is expected to occur in June, 2020. The main motivation of the mission is the development of technology and expertise to leverage the national space sector. The main scientific goal is the investigation of the triple asteroid 2001-SN263. To aggregate the widest possible Brazilian involvement in all mission sectors, some instruments for the mission are planned to be developed in partnership among Brazilian institutions. In this effort, a preliminary design of a laser altimeter to meet the mission needs was created and presented in 2010–2011. Since then, many studies were conducted and new information on the target asteroid was gathered. To take this into account, a review of that plan was conducted and the current results for the instrument design parameters are presented.

  6. {sup 57}Fe Moessbauer spectroscopy study of organic rich sediment (source rocks) from test well K-263 of Cambay Basin, India

    Energy Technology Data Exchange (ETDEWEB)

    Tripathi, Amita [J.N.V. University Jodhpur, Department of Physics (India); Kulshreshtha, Abhijit [Jodhpur Engineering College and Research Center (India); Patel, K. R. [J.N.V. University Jodhpur, Department of Physics (India); Sharma, Y. K. [University of Rajasthan, Department of Physics (India); Tripathi, R. P., E-mail: [J.N.V. University Jodhpur, Department of Physics (India)


    {sup 57}Fe Moessbauer Spectroscopy study was carried out on the samples collected from different depth interval of a representative well K-263 of the North Cambay basin (India). The results obtained were compared with the basins already studied. Comparison show that general trend of relative distribution of iron containing minerals as a function of depth for well K-263 is more or less similar to that reported for Eastern Krishna Godavari Basin. Interestingly both these basins have similar hydrocarbon prospecting (hence nature of organic content) also. On the other hand we found that distribution pattern of iron minerals of Cambay basin is markedly different from the basins (viz North Sea and Jaisalmer) having different prospecting and organic properties in comparison to Cambay Basin. So some correlation exists between distribution of iron minerals and prospects of a basin.

  7. Molecular characterization of NRXN1 deletions from 19,263 clinical microarray cases identifies exons important for neurodevelopmental disease expression (United States)

    Lowther, Chelsea; Speevak, Marsha; Armour, Christine M.; Goh, Elaine S.; Graham, Gail E.; Li, Chumei; Zeesman, Susan; Nowaczyk, Malgorzata J.M.; Schultz, Lee-Anne; Morra, Antonella; Nicolson, Rob; Bikangaga, Peter; Samdup, Dawa; Zaazou, Mostafa; Boyd, Kerry; Jung, Jack H.; Siu, Victoria; Rajguru, Manjulata; Goobie, Sharan; Tarnopolsky, Mark A.; Prasad, Chitra; Dick, Paul T.; Hussain, Asmaa S.; Walinga, Margreet; Reijenga, Renske G.; Gazzellone, Matthew; Lionel, Anath C.; Marshall, Christian R.; Scherer, Stephen W.; Stavropoulos, Dimitri J.; McCready, Elizabeth; Bassett, Anne S.


    Purpose The purpose of the current study was to assess the penetrance of NRXN1 deletions. Methods We compared the prevalence and genomic extent of NRXN1 deletions identified among 19,263 clinically referred cases to that of 15,264 controls. The burden of additional clinically relevant CNVs was used as a proxy to estimate the relative penetrance of NRXN1 deletions. Results We identified 41 (0.21%) previously unreported exonic NRXN1 deletions ascertained for developmental delay/intellectual disability, significantly greater than in controls [OR=8.14 (95% CI 2.91–22.72), p< 0.0001)]. Ten (22.7%) of these had a second clinically relevant CNV. Subjects with a deletion near the 3′ end of NRXN1 were significantly more likely to have a second rare CNV than subjects with a 5′ NRXN1 deletion [OR=7.47 (95% CI 2.36–23.61), p=0.0006]. The prevalence of intronic NRXN1 deletions was not statistically different between cases and controls (p=0.618). The majority (63.2%) of intronic NRXN1 deletion cases had a second rare CNV, a two-fold greater prevalence than for exonic NRXN1 deletion cases (p=0.0035). Conclusions The results support the importance of exons near the 5′ end of NRXN1 in the expression of neurodevelopmental disorders. Intronic NRXN1 deletions do not appear to substantially increase the risk for clinical phenotypes. PMID:27195815

  8. Microarray based analysis of an inherited terminal 3p26.3 deletion, containing only the CHL1 gene, from a normal father to his two affected children

    Directory of Open Access Journals (Sweden)

    Lerone Margherita


    Full Text Available Abstract Background terminal deletions of the distal portion of the short arm of chromosome 3 cause a rare contiguous gene disorder characterized by growth retardation, developmental delay, mental retardation, dysmorphisms, microcephaly and ptosis. The phenotype of individuals with deletions varies from normal to severe. It was suggested that a 1,5 Mb minimal terminal deletion including the two genes CRBN and CNTN4 is sufficient to cause the syndrome. In addition the CHL1 gene, mapping at 3p26.3 distally to CRBN and CNTN4, was proposed as candidate gene for a non specific mental retardation because of its high level of expression in the brain. Methods and Results we describe two affected siblings in which array-CGH analysis disclosed an identical discontinuous terminal 3p26.3 deletion spanning less than 1 Mb. The deletion was transmitted from their normal father and included only the CHL1 gene. The two brothers present microcephaly, light mental retardation, learning and language difficulties but not the typical phenotype manifestations described in 3p- syndrome. Conclusion a terminal 3p26.3 deletion including only the CHL1 gene is a very rare finding previously reported only in one family. The phenotype of the affected individuals in the two families is very similar and the deletion has been inherited from an apparently normal parent. As already described for others recurrent syndromes with variable phenotype, these findings are challenging in genetic counselling because of an evident variable penetrance.

  9. Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263 (United States)

    Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.


    Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.

  10. Analysis of polymorphic TGFB1 codons 10, 25, and 263 in a German patient group with non-syndromic cleft lip, alveolus, and palate compared with healthy adults

    Directory of Open Access Journals (Sweden)

    Gressner Axel M


    Full Text Available Abstract Background Clefts of the lip, alveolus, and palate (CLPs rank among the most frequent and significant congenital malformations. Leu10Pro and Arg25Pro polymorphisms in the precursor region and Thr263Ile polymorphism in the prodomain of the transforming growth factor β1 (TGF-β1 gene have proved to be crucial to predisposition of several disorders. Methods In this study, polymorphism analysis was performed by real-time polymerase chain reaction (LightCycler and TGF-β1 levels determined by enzyme-linked immunosorbent assay. Results Only 2/60 Caucasian non-syndromic patients with CLP (3.3% carried the Arg25Pro and another 2/60 patients (3.3% the Thr263Ile genotypes, whereas, in a control group of 60 healthy Caucasian blood donors, these heterozygous genotypes were more frequent 16.7% having Arg25Pro (10/60; p Conclusions The genetic differences in codons 25 and 263 suggest that TGF-β1 could play an important role in occurrence of CLP, however, functional experiments will be required to confirm the mechanisms of disturbed development.

  11. Desempeño del modelo rothc-26.3 a nivel de parcela en México

    Directory of Open Access Journals (Sweden)

    Lucila González Molina


    Full Text Available De acuerdo con el Panel Intergubernamental sobre el Cambio Climático (PICC, deben reportarse los almacenes y cambios del carbono orgánico del suelo (COS en el tiempo. El modelo RothC-26.3 (RothC es uno de los más usados en el mundo para estudiar la dinámica del C en diferentes sistemas. Se evaluó el desempeño del RothC en la simulación de los cambios del COS, a nivel de parcela, en experimentos de corta duración. Se evaluaron nueve sitios y los sistemas: agrícola con residuos vegetales (A+R, agrícola sin residuos (A-R, forestales (F, praderas (PR y agostaderos (AGOS. Las parcelas experimentales se ubicaron en los estados de México, Tlaxcala, Michoacán, Guanajuato, Oaxaca, Jalisco y Nuevo León. El RothC se ejecutó (i con el COSinicial, medido en cada punto de muestreo (*CIPUN en parcelas de la Sierra Norte de Oaxaca y, (ii con el COSinicial promedio medido por parcela (*CIPAR en el resto de los sitios. Se midieron y estimaron los parámetros de entrada al modelo, como residuos vegetales y abonos orgánicos. El grado de asociación entre el COS medido y el simulado fue de 0.76 y hasta 1.0 en todos los sitios. La eficiencia del modelo (EF varió entre 0.53 y 0.93, excepto en el Batán, donde se evaluaron sistemas de labranza (EF= −0.60. La r, en ambas formas de simulación, varió entre 0.63 y 0.97, excepto en AGOS; EF en los agrícolas fue de 0.48 a 0.84 y de 0.81 en F *CIPAR. La EF fue insatisfactoria obtenida para los AGOS (*CIPAR y forestales y praderas (*CPUN. Considerando los resultados de los sitios y sistemas y, la forma de simulación *CIPAR, el modelo RothC se puede usar con buena aceptación para simular los cambios de COS a nivel de parcela en los sistemas agrícolas y forestales, mediana en praderas y baja en agostaderos.

  12. Extended and filamentary Lyα emission from the formation of a protogalactic halo at z = 2.63 (United States)

    Rauch, Michael; Becker, George D.; Haehnelt, Martin G.; Gauthier, Jean-Rene; Sargent, Wallace L. W.


    We report the observation of a further asymmetric, extended Lyα emitting halo at z = 2.63, from our ultra-deep, long-slit spectroscopic survey of faint high-redshift emitters, undertaken with Magellan LDSS3 in the GOODS-S field. The Lyα emission, detected over more than 30 kpc, is spatially coincident with a statistically significant concentration of galaxies visible in deep broad-band imaging. While these faint galaxies without spectroscopic redshifts cannot all with certainty be associated with one another or with the Lyα emission, there are a number of compelling reasons why they very probably form a Milky Way halo-mass group at the Lyα redshift. Filamentary structure, possibly consisting of Lyα emission with very high equivalent width, blue stellar continua and evidence for disturbed stellar populations, suggest that the properties of the emitting region reflect ongoing galaxy assembly, with recent galaxy mergers and star formation occurring in the group. The Lyα emission may be powered by cooling radiation or spatially extended star formation in the halo, but is unlikely to be fluorescence driven by either an active galactic nucleus or one of the galaxies. A comparison with the Lyα surface brightness profiles of more typical, bright Lyα emitters or Lyman break galaxies from similarly deep two-dimensional spectra shows them to be conspicuously different from the extended, asymmetric object studied here. This is consistent with the picture that typical Lyα emitters represent Lyα resonantly scattering from single, kinematically quiescent, compact sources of ionizing radiation, whereas extended emission of the kind seen in the current halo reflect a more active, kinematically disturbed stage in the galaxy formation process. Hence, unusual Lyα emission as observed here may provide unique insights into what is probably a key mode of galaxy formation at high redshifts. Our observations provide further, circumstantial evidence that galaxy mergers may

  13. Exclusion of Linkage to the CDL1 Gene Region on Chromosome 3q26.3 in Some Familial Cases of Cornelia de Lange Syndrome (United States)

    Krantz, Ian D.; Tonkin, Emma; Smith, Melanie; Devoto, Marcella; Bottani, Armand; Simpson, Claire; Hofreiter, Mary; Abraham, Vinod; Jukofsky, Lori; Conti, Brian P.; Strachan, Tom; Jackson, Laird


    Cornelia de Lange Syndrome (CdLS) is a complex developmental disorder consisting of characteristic facial features, limb abnormalities, hirsutism, ophthalmologic involvement, gastroesophageal dysfunction, hearing loss, as well as growth and neuro-developmental retardation. Most cases of CdLS appear to be sporadic. Familial cases are rare and indicate autosomal dominant inheritance. Several individuals with CdLS have been reported with chromosomal abnormalities, suggesting candidate genomic regions within which the causative gene(s) may lie. A CdLS gene location (CDL1) has been assigned to 3q26.3 based on phenotypic overlap with the duplication 3q syndrome (critical region 3q26.2-q27) and the report of a CdLS individual with a balanced de novo t(3;17)(q26.3;q23.1). It has been postulated that a gene within the dup3q critical region results in the CdLS when deleted or mutated. We have performed a linkage analysis to the minimal critical region for the dup3q syndrome (that encompasses the translocation breakpoint) on chromosome 3q in 10 rare familial cases of CdLS. Nineteen markers spanning a region of approximately 40 Mb (37 cM) were used. Results of a multipoint linkage analysis demonstrated total lod-scores that were negative across the chromosome 3q26-q27 region. In 4/10 families, lod-scores were less than −2 in the 2 cM region encompassing the translocation, while in the remaining 6/10 families, lod-scores could not exclude linkage to this region. These studies indicate that in some multicase families, the disease gene does not map to the CDL1 region at 3q26.3. PMID:11391654

  14. Preliminary development plan of the ALR, the laser rangefinder for the ASTER deep space mission to the 2001 SN263 asteroid

    Directory of Open Access Journals (Sweden)

    Antonio Gil Vicente de Brum


    Full Text Available The Brazilian deep space mission ASTER, as temporarily named, plans to send a small spacecraft to encounter and investigate the triple asteroid 2001-SN263. The launch is scheduled (initially to occur in 2015, arriving in 2018. The main motivation of the mission is the development of technology and expertise to leverage the national space sector. Within the scientific goals, the investigation of the still unknown asteroid 2001-SN263. The main project guideline is to aggregate the widest possible Brazilian involvement in the platform, the development and operation of subsystems, integration, payload, as well as in the tracking, navigation, guidance and control of the probe. To meet this guideline, among others, the decision for the development of a laser altimeter in Brazil to fly in the mission was taken. This effort is currently coordinated by a group of researchers from the aerospace engineering personnel of UFABC. This article presents the preliminary development plan for the design of this instrument, which was called ALR (ASTER Laser Rangefinder.

  15. Assessment of prion reduction filters in decreasing infectivity of ultracentrifuged 263K scrapie-infected brain homogenates in "spiked" human blood and red blood cells. (United States)

    Cardone, Franco; Sowemimo-Coker, Samuel; Abdel-Haq, Hanin; Sbriccoli, Marco; Graziano, Silvia; Valanzano, Angelina; Berardi, Vito Angelo; Galeno, Roberta; Puopolo, Maria; Pocchiari, Maurizio


    The safety of red blood cells (RBCs) is of concern because of the occurrence of four transfusion-transmitted variant Creutzfeldt-Jakob disease (vCJD) cases in the United Kingdom. The absence of validated screening tests requires the use of procedures to remove prions from blood to minimize the risk of transmission. These procedures must be validated using infectious prions in a form that is as close as possible to one in blood. Units of human whole blood (WB) and RBCs were spiked with high-speed supernatants of 263K scrapie-infected hamster brain homogenates. Spiked samples were leukoreduced and then passed through prion-removing filters (Pall Corporation). In another experiment, RBCs from 263K scrapie-infected hamsters were treated as above, and residual infectivity was measured by bioassay. The overall removal of infectivity by the filters from prion-spiked WB and RBCs was approximately two orders of magnitude. No infectivity was detected in filtered hamster RBCs endogenously infected with scrapie. The use of prion-removing filters may help to reduce the risk of transfusion-transmitted vCJD. To avoid overestimation of prion removal efficiency in validation studies, it may be more appropriate to use supernates from ultracentrifugation of scrapie-infected hamster brain homogenate rather than the current standard brain homogenates. © 2013 American Association of Blood Banks.

  16. Human Pluripotent Stem Cells and Derived Neuroprogenitors Display Differential Degrees of Susceptibility to BH3 Mimetics ABT-263, WEHI-539 and ABT-199.

    Directory of Open Access Journals (Sweden)

    Carolina Paola García

    Full Text Available Human embryonic stem cells (hESCs are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs and hESCs-derived neuroprogenitors (NP. We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help

  17. Alpha-1 antitrypsin deficiency caused by a novel mutation (p.Leu263Pro: Pi*ZQ0gaia – Q0gaia allele

    Directory of Open Access Journals (Sweden)

    M.J. Oliveira


    Full Text Available Severe alpha-1 antitrypsin deficiency (AATD is generally associated with PI*ZZ genotype and less often with combinations of PI*Z, PI*S, and other rarer deficiency or null (Q0 alleles. Severe AATD predisposes patients to various diseases, including pulmonary emphysema. Presented here is a case report of a young man with COPD and AATD. The investigation of the AATD showed a novel mutation p.Leu263Pro (c.860T>C, which was named Q0gaia (Pi*ZQ0gaia. Q0gaia is associated with very low or no detectable serum concentrations of AAT. Keywords: Alpha-1 antitrypsin deficiency, Null allele, COPD

  18. Expansion of the clinical phenotype of the distal 10q26.3 deletion syndrome to include ataxia and hyperemia of the hands and feet. (United States)

    Lacaria, Melanie; Srour, Myriam; Michaud, Jacques L; Doja, Asif; Miller, Elka; Schwartzentruber, Jeremy; Goldsmith, Claire; Majewski, Jacek; Boycott, Kym M


    Distal deletion of the long arm of chromosome 10 is associated with a dysmorphic craniofacial appearance, microcephaly, behavioral issues, developmental delay, intellectual disability, and ocular, urogenital, and limb abnormalities. Herein, we present clinical, molecular, and cytogenetic investigations of four patients, including two siblings, with nearly identical terminal deletions of 10q26.3, all of whom have an atypical presentation of this syndrome. Their prominent features include ataxia, mild-to-moderate intellectual disability, and hyperemia of the hands and feet, and they do not display many of the other features commonly associated with deletions of this region. These results point to a novel gene locus associated with ataxia and highlight the variability of the clinical presentation of patients with deletions of this region. © 2017 Wiley Periodicals, Inc.

  19. Addition of E138K to R263K in HIV integrase increases resistance to dolutegravir, but fails to restore activity of the HIV integrase enzyme and viral replication capacity. (United States)

    Mesplède, Thibault; Osman, Nathan; Wares, Melissa; Quashie, Peter K; Hassounah, Said; Anstett, Kaitlin; Han, Yingshan; Singhroy, Diane N; Wainberg, Mark A


    The results of several clinical trials suggest that the integrase inhibitor dolutegravir may be less prone than other drugs to the emergence of HIV drug resistance mutations in treatment-naive patients. We have shown that the R263K mutation commonly emerged during tissue culture selection studies with dolutegravir and conferred low levels of resistance to this drug while simultaneously diminishing both HIV replication capacity and integrase enzymatic activity. E138K has been identified as a secondary mutation for dolutegravir in selection studies and has also been observed as a secondary mutation in the clinic for the integrase inhibitors raltegravir and elvitegravir. We used biochemical cell-free strand-transfer assays and tissue culture assays to characterize the effects of the E138K/R263K combination of mutations on resistance to dolutegravir, integrase enzyme activity and HIV-1 replication capacity. We show here that the addition of the E138K substitution to R263K increased the resistance of HIV-1 to dolutegravir but failed to restore viral replication capacity, integrase strand-transfer activity and integration within cellular DNA. We also show that the addition of E138K to R263K did not increase the resistance to raltegravir or elvitegravir. The addition of the E138K substitution to R263K was also less detrimental to integrase strand-transfer activity and integration than a different secondary mutation at position H51Y that had also been selected in culture. The E138K substitution failed to restore the defect in viral replication capacity that is associated with R263K, confirming previous selection studies that failed to identify compensatory mutation(s) for the latter primary mutation. This study suggests that the R263K resistance pathway may represent an evolutionary dead end for HIV in treatment-naive individuals who are treated with dolutegravir and will need to be confirmed by the long-term use of dolutegravir in the clinic. © The Author 2014. Published

  20. The Combination of the R263K and T66I Resistance Substitutions in HIV-1 Integrase Is Incompatible with High-Level Viral Replication and the Development of High-Level Drug Resistance. (United States)

    Liang, Jiaming; Mesplède, Thibault; Oliveira, Maureen; Anstett, Kaitlin; Wainberg, Mark A


    The R263K substitution in integrase has been selected in tissue culture with dolutegravir (DTG) and has been reported for several treatment-experienced individuals receiving DTG as part of salvage therapy. The R263K substitution seems to be incompatible with the presence of common resistance mutations associated with raltegravir (RAL), a different integrase strand transfer inhibitor (INSTI). T66I is a substitution that is common in individuals who have developed resistance against a different INSTI termed elvitegravir (EVG), but it is not known whether these two mutations might be compatible in the context of resistance against DTG or what impact the combination of these substitutions might have on resistance against INSTIs. E138K is a common secondary substitution observed with various primary resistance substitutions in RAL- and EVG-treated individuals. Viral infectivity, replicative capacity, and resistance against INSTIs were measured in cell-based assays. Strand transfer and 3' processing activities were measured biochemically. The combination of the R263K and T66I substitutions decreased HIV-1 infectivity, replicative capacity, and strand transfer activity. The addition of the E138K substitution partially compensated for these deficits and resulted in high levels of resistance against EVG but not against DTG or RAL. These findings suggest that the presence of the T66I substitution will not compromise the activity of DTG and may also help to prevent the additional generation of the R263K mutation. Our observations support the use of DTG in second-line therapy for individuals who experience treatment failure with EVG due to the T66I substitution. The integrase strand transfer inhibitors (INSTIs) elvitegravir and dolutegravir are newly developed inhibitors against human immunodeficiency virus type 1 (HIV-1). HIV drug-resistant mutations in integrase that can arise in individuals treated with elvitegravir commonly include the T66I substitution, whereas R263K is a

  1. Measurements of (vapour + liquid) equilibrium data for {trifluoroiodomethane (R13I1) + isobutane (R600a)} at temperatures between (263.150 and 293.150) K

    International Nuclear Information System (INIS)

    Guo, Hao; Gong, Maoqiong; Dong, Xueqiang; Wu, Jianfeng


    Highlights: ► VLE data for {R13I1 + R600a} system were measured at four temperatures. ► Experiments adopt the static–analytic method. ► Correlation of VLE data was made using PR–HV–NRTL model. ► A zeotropic behaviour was observed. -- Abstract: This paper contains the measurements of isothermal VLE data for the binary system {trifluoroiodomethane (R13I1) + isobutane (R600a)} at four temperatures from (263.15 to 293.15) K. The measurements are performed by means of an apparatus based on the static–analytic method. The combined standard uncertainties of the measured results are ±5 mK for temperature, ±0.00025 MPa for pressure, ±0.005 for mole fraction of the liquid and vapour composition. The VLE data are correlated with the Peng–Robinson equation of state and the Huron–Vidal mixing rules involving the NRTL activity coefficient model. The model is successfully verified to be suitable for calculating the VLE data of the system measured. The experimental results show that {trifluoroiodomethane (R13I1) + isobutane (R600a)} is a zeotropic system

  2. Fabrication of High Transparency Diamond-Like Carbon Film Coating on D263T Glass at Room Temperature as an Antireflection Layer

    Directory of Open Access Journals (Sweden)

    Chii-Ruey Lin


    Full Text Available This study intends to deposit high transmittance diamond-like carbon (DLC thin films on D263T glass substrate at room temperature via a diamond powder target using the radio frequency (RF magnetron sputtering technique. Moreover, various process parameters were used to tune the properties of the thin films by using the Taguchi method. Experimental results show that the content of sp3 bonded carbon decreases in accordance with the effect of the substrate temperature. In addition, the hardness of all as-deposited single-layer DLC films ranges from 13.2 to 22.5 GPa, and the RMS surface roughness was improved significantly with the decrease in sputtering pressure. The water repellent of the deposited DLC films improved significantly with the increase of the sp3 content, and its contact angle was larger than that of the noncoated one by 1.45 times. Furthermore, the refraction index (n of all as-deposited DLC films ranges from 1.95 to 2.1 at λ = 600 nm. These results demonstrate that the thickness increased as the reflectance increased. DLC film under an RF power of 150 W possesses high transmissive ability (>81% and low average reflectance ability (<9.5% in the visible wavelengths (at λ = 400–700 nm.

  3. Developing the "Precessing Inclined Bi-Elliptical Four-Body Problem with Radiation Pressure" to search for orbits in the triple asteroid 2001SN263 (United States)

    Masago, Bruna Yukiko Pinheiro Lopes; Prado, Antonio Fernando Bertachini de Almeida; Chiaradia, Ana Paula Marins; Gomes, Vivian Martins


    Space missions to visit small bodies of the Solar System are important steps to improve our knowledge of the Solar System. Usually those bodies do not have well known characteristics, as their gravity field, which make the mission planning a difficult task. The present paper has the goal of studying orbits around the triple asteroid 2001SN263, a Near-Earth Asteroid (NEA). A mission to this system allows the exploration of three bodies in the same trip. The distances reached by the spacecraft from those three bodies have fundamental importance in the quality of their observations. Therefore, the present research has two main goals: (i) to develop a semi-analytical mathematical model, which is simple, but able to represent the main characteristics of that system; (ii) to use this model to find orbits for a spacecraft with the goal of remaining the maximum possible time near the three bodies of the system, without the need of space maneuvers. This model is called ;Precessing Inclined Bi-Elliptical Problem with Radiation Pressure; (PIBEPRP). The use of this model allow us to find important natural orbits for the exploration of one, two or even the three bodies of the system. These trajectories can be used individually or combined in two or more parts using orbital maneuvers.

  4. The Oswestry Disability Index, confirmatory factor analysis in a sample of 35,263 verifies a one-factor structure but practicality issues remain. (United States)

    Gabel, Charles Philip; Cuesta-Vargas, Antonio; Qian, Meihua; Vengust, Rok; Berlemann, Ulrich; Aghayev, Emin; Melloh, Markus


    To analyze the factor structure of the Oswestry Disability Index (ODI) in a large symptomatic low back pain (LBP) population using exploratory (EFA) and confirmatory factor analysis (CFA). Analysis of pooled baseline ODI LBP patient data from the international Spine Tango registry of EUROSPINE, the Spine Society of Europe. The sample, with n = 35,263 (55.2% female; age 15-99, median 59 years), included 76.1% of patients with a degenerative disease, and 23.9% of the patients with various other spinal conditions. The initial EFA provided a hypothetical construct for consideration. Subsequent CFA was considered in three scenarios: the full sample and separate genders. Models were compared empirically for best fit. The EFA indicated a one-factor solution accounting for 54% of the total variance. The CFA analysis based on the full sample confirmed this one-factor structure. Sub-group analyses by gender achieved good model fit for configural and partial metric invariance, but not scalar invariance. A possible two-construct model solution as outlined by previous researchers: dynamic-activities (personal care, lifting, walking, sex and social) and static-activities (pain, sleep, standing, travelling and sitting) was not preferred. The ODI demonstrated a one-factor structure in a large LBP sample. A potential two-factor model was considered, but not found appropriate for constructs of dynamic and static activity. The use of the single summary score for the ODI is psychometrically supported. However, practicality limitations were reported for use in the clinical and research settings. Researchers are encouraged to consider a shift towards newer, more sensitive and robustly developed instruments.

  5. Oxygen-18 exchange as a measure of accessibility of CO2 and HCO3- to carbonic anhydrase in Chlorella vulgaris (UTEX 263)

    International Nuclear Information System (INIS)

    Tu, C.K.; Acevedo-Duncan, M.; Wynns, G.C.; Silverman, D.N.


    The exchange of 18 O between CO 2 and H 2 O in stirred suspensions of Chlorella vulgaris (UTEX 263) was measured using a membrane inlet to a mass spectrometer. The depletion of 18 O from CO 2 in the fluid outside the cells provides a method to study CO 2 and HCO 3 - kinetics in suspensions of algae that contain carbonic anhydrase since 18 O loss to H 2 O is catalyzed inside the cells but not in the external fluid. Low-CO 2 cells of Chlorella vulgaris (grown with air) were added to a solution containing 18 O enriched CO 2 and HCO 3 - with 2 to 15 millimolar total inorganic carbon. The observed depletion of 18 O from CO 2 was biphasic and the resulting 18 O content of CO 2 was much less than the 18 O content of HCO 3 - in the external solution. Analysis of the slopes showed that the Fick's law rate constant for entry of HCO 3 - into the cell was experimentally indistinguishable from zero (bicarbonate impermeable) with an upper limit of 3 x 10 -4 s -1 due to experimental errors. The Fick's law rate constant for entry of CO 2 to the sites of intracellular carbonic anhydrase was large, 0.013 per second, but not as great as calculated for no membrane barrier to CO 2 flux (6 per second). The experimental value may be explained by a nonhomogeneous distribution of carbonic anhydrase in the cell (such as membrane-bound enzyme) or by a membrane barrier to CO 2 entry into the cell or both. The CO 2 hydration activity inside the cells was 160 times the uncatalyzed CO 2 hydration rate

  6. Cardiovascular disease risk factor profiles of 263,356 older Australians according to region of birth and acculturation, with a focus on migrants born in Asia.

    Directory of Open Access Journals (Sweden)

    Shuyu Guo

    Full Text Available Risk factors for cardiovascular disease (CVD, such as obesity, diabetes, hypertension and physical inactivity, are common in Australia, but the prevalence varies according to cultural background. We examined the relationship between region of birth, measures of acculturation, and CVD risk profiles in immigrant, compared to Australian-born, older Australians. Cross-sectional data from 263,356 participants aged 45 and over joining the population-based 45 and Up Study cohort from 2006-2008 were used. Prevalence ratios for CVD risk factors in Australian- versus overseas-born participants were calculated using modified Poisson regression, adjusting for age, sex and socioeconomic factors and focusing on Asian migrants. The association between time resident in Australia and age at migration and CVD risk factors in Asian migrants was also examined. Migrants from Northeast (n = 3,213 and Southeast Asia (n = 3,942 had lower levels of overweight/obesity, physical activity and female smoking than Australian-born participants (n = 199,356, although differences in prevalence of overweight/obesity were sensitive to body-mass-index cut-offs used. Compared to Australian-born participants, migrants from Northeast Asia were 20-30% less likely, and from Southeast Asia 10-20% more likely, to report being treated for hypertension and/or hypercholesterolaemia; Southeast Asian migrants were 40-60% more likely to report diabetes. Northeast Asian-born individuals were less likely than Australian-born to have 3 or more CVD risk factors. Diabetes, treated hypertension and hypercholesterolaemia occurred at relatively low average body-mass-index in Southeast Asian migrants. The CVD risk factor profiles of migrants tended to approximate those of Australian-born with increasing acculturation, in both favourable (e.g., increased physical activity and unfavourable directions (e.g., increased female smoking. Minimizing CVD risk in migrant populations may be achieved through

  7. Using thallium isotopes in the 2.63 Ga Jeerinah Formation from Hamersley Basin, Western Australia, to constrain ancient seafloor oxygenation (United States)

    Holdaway, B. J.; Owens, J. D.; Nielsen, S.; Anbar, A. D.; Ostrander, C. M.


    , suggest oceanic oxygenation penetrated minor expanses of the global sediment-water interface, coeval with a "whiff" of O2 at 2.5 Ga. Here we probe deeper into the ancient rock record prior to the "whiff", applying high resolution Tl isotope measurements to the anoxic and euxinic 2.63 Ga Roy Hill Shale.

  8. Cardiovascular Disease Risk Factor Profiles of 263,356 Older Australians According to Region of Birth and Acculturation, with a Focus on Migrants Born in Asia (United States)

    Guo, Shuyu; Lucas, Robyn M.; Joshy, Grace; Banks, Emily


    Risk factors for cardiovascular disease (CVD), such as obesity, diabetes, hypertension and physical inactivity, are common in Australia, but the prevalence varies according to cultural background. We examined the relationship between region of birth, measures of acculturation, and CVD risk profiles in immigrant, compared to Australian-born, older Australians. Cross-sectional data from 263,356 participants aged 45 and over joining the population-based 45 and Up Study cohort from 2006–2008 were used. Prevalence ratios for CVD risk factors in Australian- versus overseas-born participants were calculated using modified Poisson regression, adjusting for age, sex and socioeconomic factors and focusing on Asian migrants. The association between time resident in Australia and age at migration and CVD risk factors in Asian migrants was also examined. Migrants from Northeast (n = 3,213) and Southeast Asia (n = 3,942) had lower levels of overweight/obesity, physical activity and female smoking than Australian-born participants (n = 199,356), although differences in prevalence of overweight/obesity were sensitive to body-mass-index cut-offs used. Compared to Australian-born participants, migrants from Northeast Asia were 20–30% less likely, and from Southeast Asia 10–20% more likely, to report being treated for hypertension and/or hypercholesterolaemia; Southeast Asian migrants were 40–60% more likely to report diabetes. Northeast Asian-born individuals were less likely than Australian-born to have 3 or more CVD risk factors. Diabetes, treated hypertension and hypercholesterolaemia occurred at relatively low average body-mass-index in Southeast Asian migrants. The CVD risk factor profiles of migrants tended to approximate those of Australian-born with increasing acculturation, in both favourable (e.g., increased physical activity) and unfavourable directions (e.g., increased female smoking). Minimizing CVD risk in migrant populations may be achieved through efforts to

  9. Characterization, molecular modeling and antimicrobial activity of metal complexes of tridentate Schiff base derived from 5-acetyl-4-hydroxy-2H-1,3-thiazine-2,6(3H)-dione and 2-aminophenol (United States)

    Adly, Omima M. I.

    Metal complexes of Ni(II), Co(II), Cd(II), VO(IV) and UO2(VI) as well as several Cu(II) salts, including Cl,NO3-,AcO,ClO4- and SO4-2 with a tridentate O2N donor Schiff base ligand (H2L), synthesized by condensation of 5-acetyl-4-hydroxy-2H-1,3-thiazine-2,6(3H)-dione with 2-aminophenol, were prepared and characterized on the basis of elemental analyses, spectral, magnetic, molar conductance and thermal gravimetric analysis. Square planar, tetrahedral and octahedral geometries have been assigned to the prepared complexes. Molecular parameters of the ligand and its metal complexes have been calculated and correlated with the experimental data, and the changes of bond lengths are linearly correlated with IR data. The antimicrobial activities of the synthesized compounds were tested in vitro against the sensitive organisms Staphylococcus aureus as Gram positive bacteria, Proteus vulgaris as Gram negative bacteria and Candida albicans as fungus strain, and the results are discussed.

  10. Publications | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Conversation: Celia Reyes on the importance of timely economic information. Asia is the largest developing region in the world both in terms of land mass and population. More than 70 % of the people in the developing world live in Asia. Over the past three decades the region has created.

  11. 49 CFR 234.263 - Relays. (United States)


    .... (b)(1) Alternating current vane type relays, direct current polar type relays, and relays with soft iron magnetic structure shall be tested at least once every two years. (2) Alternating current...

  12. 10 CFR 26.3 - Scope. (United States)


    ... corporation, firm, partnership, limited liability company, association, or other organization who obtains a... a limited work authorization under § 50.10(e), if the limited work authorization authorizes the... structures, systems, and components (SSCs) under the limited work authorization; (2) Combined license holders...

  13. 12 CFR 263.36 - Evidence. (United States)


    ... unduly repetitive is admissible to the fullest extent authorized by the Administrative Procedure Act and... pursuant to this subpart if such evidence is relevant, material, reliable and not unduly repetitive. (b... examination, supervisory activity, inspection or visitation, prepared by an appropriate Federal financial...

  14. Publications | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Francisco Manyanga Secondary School in Maputo, Mozambique, she is responsible for the 7000 students, 210 teachers, and 64 support staff who walk through the front doors of her.

  15. No. 263-Maternity Leave in Normal Pregnancy. (United States)

    Leduc, Dean


    To assist maternity care providers in recognizing and discussing health- and illness-related issues in pregnancy and their relationship to maternity benefits. Published literature was retrieved through searches of PubMed or Medline, CINAHL, and The Cochrane Library in 2009 using appropriate controlled vocabulary (e.g., maternity benefits) and key words (e.g., maternity, benefits, pregnancy). Results were restricted to systematic reviews, randomized controlled trials/controlled clinical trials, and observational studies. There were no date or language restrictions. Searches were updated on a regular basis and incorporated in the guideline to December 2009. Grey (unpublished) literature was identified through searching the web sites of health technology assessment and health technology assessment-related agencies, clinical practice guideline collections, clinical trial registries, and national and international medical specialty societies. Copyright © 2017. Published by Elsevier Inc.

  16. 33 CFR 263.15 - Program policies. (United States)


    ... personal attention of the Chief of Engineers, the Director of Civil Works is authorized to approve or... accomplished by the Director of Civil Works, for the Chief of Engineers. ... costs of investigations, planning, design and construction, to include those incurred prior to...

  17. 29 CFR 1910.263 - Bakery equipment. (United States)


    ...] (d) Control circuits for magnetic controllers shall be so arranged that the opening of any one of... that unit. (ii) [Reserved] (2) Bag chutes and bag lifts (bag-arm elevators). (i) Bag chutes (gravity... lifts shall be prohibited in bakeries. Bag or barrel lifts shall not be used as man lifts. (3) Dumpbin...

  18. 47 CFR 87.263 - Frequencies. (United States)


    ... 6661.0 17904.0 (4) South Pacific (SP): kHz 3467.0 10084.0 5559.0 11327.0 5643.0 13300.0 8867.0 17904.0....0 8897.0 (11) Middle East (MID): kHz 2944.0 6631.0 2992.0 8918.0 3467.0 8951.0 3473.0 10018.0 4669.0... 3419.0 8903.0 3425.0 8894.0 3467.0 11300.0 4657.0 11330.0 5493.0 13273.0 5652.0 13288.0 5658.0 13294.0...

  19. 26 CFR 1.263A-7 - Changing a method of accounting under section 263A. (United States)


    ... similar fashion. M applies the weighted average increase determined for Product #2 (18.18 percent) to the... end of 1996 under the specific goods LIFO inventory method: LIFO Product and layer Number Cost Carryingvalues Product #1: 1993 150 $5.00 $750 1994 100 6.00 600 1995 100 6.50 650 1996 50 7.00 350 $2,350...

  20. 26 CFR 1.263A-0 - Outline of regulations under section 263A. (United States)


    ... capitalization. (1) In general. (2) Direct costs. (i) Producers. (A) Direct material costs. (B) Direct labor... allocation methods. (g) Allocating categories of costs. (1) Direct materials. (2) Direct labor. (3) Indirect... be capitalized. (A) Indirect labor costs. (B) Officers' compensation. (C) Pension and other related...

  1. 10 CFR 431.263 - Materials incorporated by reference. (United States)


    ... part 51. Any subsequent amendment to this material by the standard-setting organization will not affect... Society for Testing and Materials (ASTM) Standard F2324-03, “Standard Test Method for Prerinse Spray..., Forrestal Building, Room 1J-018 (Resource Room of the Building Technologies Program), 1000 Independence...

  2. BKR 26(3) pp. 94-98 (Yousuf)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... Transitional elements form coordinate covalent bonds, with a unique ability to form stable coordination complexes or chelates. The primary chelated minerals used in livestock production include iron, manganese, zinc, copper, cobalt and nickel. (Adeloye and Yousuf, 2001; Bao et al. 2007). Chelated.

  3. 263-IJBCS-Article-Dr Didier S DIBONG

    African Journals Online (AJOL)

    Dr Gatsing

    3 Laboratoire de Parasitologie végétale, Université Pierre et Marie Curie (Paris VI), 4 place. Jussieu, case courrier 155, 75252 Paris Cedex 05, France. 4 Département de Biologie et Physiologie Végétales, B. P. 812, Université de Yaoundé I, Cameroun. * Auteur correspondant, E-mail : didierdibong RESUME.

  4. 12 CFR 263.12 - Construction of time limits. (United States)


    ... mail, add three calendar days to the prescribed period; (2) If service is made by express mail or overnight delivery service, add one calendar day to the prescribed period; or (3) If service is made by electronic media transmission, add one calendar day to the prescribed period, unless otherwise determined by...

  5. 12 CFR 263.35 - Conduct of hearings. (United States)


    ...) General rules. (1) Hearings shall be conducted so as to provide a fair and expeditious presentation of the..., respondents may agree among themselves as to their order of presentation of their cases, but if they do not...

  6. 12 CFR 263.103 - Eligibility of applicants. (United States)


    ... will be presumed to have been made for this purpose. (3) The net worth of a financial institution shall... guidelines on the financial institution's financial report to its supervisory agency for the last reporting....103 Eligibility of applicants. (a) General rule. To be eligible for an award under this subpart, an...

  7. 25 CFR 700.263 - Assuring integrity of records. (United States)


    ... that records subject to the Act be maintained with appropriate administrative, technical and physical..., subject to safeguards based on those recommended in the National Bureau of Standards booklet “Computer..., which are adequate and appropriate to assuring the integrity of records in the system. (d) Civil Service...

  8. 12 CFR 263.17 - Collateral attacks on adjudicatory proceeding. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Collateral attacks on adjudicatory proceeding... Collateral attacks on adjudicatory proceeding. If an interlocutory appeal or collateral attack is brought in... shall be excused based on the pendency before any court of any interlocutory appeal or collateral attack. ...

  9. 12 CFR 263.106 - Measure of awards. (United States)


    ... issues in the proceeding; and (5) Such other factors as may bear on the value of the services provided. (c) Awards for studies. The reasonable cost of any study, analysis, test, project, or similar matter... exceed the prevailing rate payable for similar services, and the study or other matter was necessary...

  10. BKR 26(3) pp. 85-87 (Osadolor)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... 1Department of Medical Laboratory Science, University of Benin, P.M.B 1154, Benin City, Edo State, Nigeria. 2Department of Medical Laboratory Science, Ambrose Alli University, P.M.B 14, Ekpoma, Edo State, Nigeria. *Corresponding author: .... Becker H (1986) Botany of European mistletoe (Viscum.

  11. 33 CFR 263.17 - Planning, design and construction procedures. (United States)


    ... approval normally will be accomplished by the Director of Civil Works, for the Chief of Engineers, in.... Any deviation shall be submitted to DAEN-CWP for approval by the Director of Civil Works, for the... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Planning, design and construction...

  12. 34 CFR 263.9 - When does payback begin? (United States)


    ... Secretary may defer the payback requirement until the participant has completed his or her educational... institution the student will be attending; (ii) A copy of the letter of admission from the institution; (iii...

  13. 40 CFR 98.263 - Calculating GHG emissions. (United States)


    ... this part (General Stationary Fuel Combustion Sources). (b) Calculate and report under this subpart the... phosphate rock by origin i obtained during month n, from the carbon analysis results (percent by weight, expressed as a decimal fraction). Pn,i = Mass of phosphate rock by origin i consumed in month n by wet...

  14. 263 The Decalogue and Igbo Traditional Ethics: Essential Values for ...

    African Journals Online (AJOL)

    nationalities have their lands and languages beautifying earth's landscape. Thus one hears of Igboland, ..... web of the people in a manner that discourages simple and individual self-seeking relativism in ethical ... duplicity, deep rooted anger that has the quality of poisoning relationship, inability to restore what has been ...

  15. All projects related to | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    Latin American Security, Drugs and Democracy (LASDD) Fellowship Program. Project. This grant will support a program of fellowships and workshops on the link between security, organized crime, drugs and democracy in Latin America and the Caribbean (LAC). Start Date: January 17, 2012. End Date: January 15, 2014.

  16. BKR 26(3) pp. 88-93 (Akachukwu)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... synthesis of prostaglandins that regulate the contraction and relaxation of smooth muscle tissue (Nelson, 2005). Serum enzyme measurements are a valuable tool in clinical diagnosis that provides information on the effect and nature of pathological damage to any tissue. Alanine aminotransferase and ...

  17. Dicty_cDB: VHK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kd*snnlvagsfrsfpqdswssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns...swssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns

  18. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian


    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py......CSP simulator is able to simulate 220 Monte Carlo simulations in less than 35 seconds in the smallest BPU simulation....

  19. 26 CFR 1.263A-3 - Rules relating to property acquired for resale. (United States)


    ..., depreciation, and insurance of vehicles and equipment; tools; telephone; travel; and the general and... dealership physically separated by an alley or an access road would generally be considered one retail sales...

  20. 34 CFR 263.21 - What priority is given to certain projects and applicants? (United States)


    ... notice published in the Federal Register. (1) School readiness projects that provide age appropriate educational programs and language skills to three- and four-year-old Indian students to prepare them for..., including family-based preschool programs, emphasizing school readiness and parental skills. (3) College...

  1. 26 CFR 1.263A-4 - Rules for property produced in a farming business. (United States)


    ... agricultural or horticultural commodity. Examples include the trade or business of operating a nursery or sod... of this paragraph (a)(4): Example 1. Individual A operates a retail nursery. Individual A has three... purposes of determining the year of planting. (3) Time and manner of making the election—(i) Automatic...

  2. 45 CFR 263.20 - What definitions apply to Individual Development Accounts (IDAs)? (United States)


    ... means any business that does not contravene State law or public policy. Qualified business... purposes. Notwithstanding any other provision of law (other than the Internal Revenue Code of 1986), the... in any Federal means-tested programs. Post-secondary educational expenses means a student's tuition...

  3. 26 CFR 1.263A-8 - Requirement to capitalize interest. (United States)


    ..., such as walls, partitions, doors, wiring, plumbing, central air conditioning and heating systems, pipes..., roads, bridges, tunnels, paved parking areas and other pavements, special foundations, wharves and docks...

  4. 40 CFR 52.263 - Priority treatment for buses and carpools-Los Angeles Region. (United States)


    ... preferential treatment on arterial surface streets from Vermont Avenue to the Los Angeles central business... intervals and at each intersection of entry ramps. (3) Bus/carpool lanes must be prominently indicated by distinctive painted, pylon, or physical barriers. (4) Vehicles using a bus/carpool lane shall have the right...

  5. Nuclear Technology. Course 26: Nondestructive Examination (NDE) Techniques I. Module 26-3, Hydrostatic Tests. (United States)

    Pelton, Rick; Espy, John

    This third in a series of seven modules for a course titled Nondestructive Examination (NDE) Techniques I describes the principles and practices associated with hydrostatic testing. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student,…

  6. : tous les projets | Page 263 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2011. End Date: 1 juillet 2013. Sujet: PUBLIC SERVICES, WATER SUPPLY, SANITATION SERVICES, SOCIAL PARTICIPATION, INFORMATION TECHNOLOGY, CONSUMER PROTECTION. Région: Peru, South America, El Salvador, North and Central America. Programme: Gouvernance et justice.

  7. 49 CFR 26.3 - To whom does this part apply? (United States)


    ... Transportation Office of the Secretary of Transportation PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN... funds authorized by Titles I, III, V and VI of ISTEA, Pub. L. 102-240 or by Federal transit laws in... authorized by 49 U.S.C. 47101, et seq. (b) [Reserved] (c) If you are letting a contract, and that contract is...

  8. E331 TP HF RW O3 SHC2.63 SCID: A-bvqk (United States)

    U.S. Environmental Protection Agency — Data for differing physiological measures of dams on high fat or control diet with/without exercise and physiological effects on male and female offspring. This...

  9. SU-E-J-263: Dosimetric Analysis On Breast Brachytherapy Based On Deformable Image Registration

    Energy Technology Data Exchange (ETDEWEB)

    Chen, T; Nie, K; Narra, V; Zou, J; Zhang, M; Khan, A; Haffty, B; Yue, N [Rutgers - Cancer Institute of New Jersey, New Brunswick, NJ (United States)


    Purpose: To quantitatively compare and evaluate the dosimetry difference between breast brachytherapy protocols with different fractionation using deformable image registration. Methods: The accumulative dose distribution for multiple breast brachytherapy patients using four different applicators: Contura, Mammosite, Savi, and interstitial catheters, under two treatment protocols: 340cGy by 10 fractions in 5 days and 825cGy by 3 fractions in 2days has been reconstructed using a two stage deformable image registration approach. For all patients, daily CT was acquired with the same slice thickness (2.5mm). In the first stage, the daily CT images were rigidly registered to the initial planning CT using the registration module in Eclipse (Varian) to align the applicators. In the second stage, the tissues surrounding the applicator in the rigidly registered daily CT image were non-rigidly registered to the initial CT using a combination of image force and the local constraint that enforce zero normal motion on the surface of the applicator, using a software developed in house. We calculated the dose distribution in the daily CTs and deformed them using the final registration to convert into the image domain of the initial planning CT. The accumulative dose distributions were evaluated by dosimetry parameters including D90, V150 and V200, as well as DVH. Results: Dose reconstruction results showed that the two day treatment has a significant dosimetry improvement over the five day protocols. An average daily drop of D90 at 1.3% of the prescription dose has been observed on multiple brachytherapy patients. There is no significant difference on V150 and V200 between those two protocols. Conclusion: Brachytherapy with higher fractional dose and less fractions has an improved performance on being conformal to the dose distribution in the initial plan. Elongated brachytherapy treatments need to consider the dose uncertainty caused by the temporal changes of the soft tissue.

  10. 34 CFR 263.6 - How does the Secretary evaluate applications for the Professional Development program? (United States)


    ... research and effective practices on how to improve teaching and learning to support student proficiency in...-based research and effective practice; (2) The extent to which the training or professional development... effective strategies for teaching and student achievement; (2) The likelihood that the proposed project will...

  11. 27 CFR 25.263 - Production of concentrate and reconstitution of beer. (United States)


    ... or reconstitute beer only at a brewery. (b) Marking of containers. Containers of concentrate... be marked, branded and labeled in the same manner as prescribed for containers of beer in subpart J of this part. All containers shall be identified as containers of beer concentrate. (c) Mingling with...

  12. E331 Behavior TP HF RW O3 SHC2.63 (United States)

    U.S. Environmental Protection Agency — Human and animal studies indicate that maternal obesity can negatively impact aspects of metabolism and neurodevelopment in the offspring. Not known, however, is...

  13. SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies

    International Nuclear Information System (INIS)

    Schwartz, J; Humm, J; Nehmeh, S; Schoder, H


    Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be

  14. 26 CFR 1.263(a)-4 - Amounts paid to acquire or create intangibles. (United States)


    ... the process of investigating or otherwise pursuing the creation of an agreement described in paragraph... acquisition or creation of an intangible described in paragraph (b)(1)(i), (ii), (iii) or (iv) of this section... measurable value in money's worth that is subject to protection under applicable State, Federal or foreign...

  15. People and things. CERN Courier, Apr 1986, v. 26(3)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva

  16. Schizogony and gametogony of the vaccine, oocyst-deficient, strain T-263 of Toxoplasma gondii (United States)

    Oocysts are important stage for the spread of Toxoplasma gondii because they are environmentally resistant. Among all hosts of T. gondii, only felids can excrete oocysts. Cats that have excreted T. gondii oocysts after primary infection become immune to re-excretion of oocysts, and this immunity app...

  17. 26 CFR 1.263A-1 - Uniform capitalization of costs. (United States)


    ... costs and direct labor costs. (A) Direct material costs include the costs of those materials that become... property produced. (B) Direct labor costs include the costs of labor that can be identified or associated.... Direct labor costs include all elements of compensation other than employee benefit costs described in...

  18. 34 CFR 263.3 - What definitions apply to the Professional Development program? (United States)


    ... load; and (3) Is not employed for more than 20 hours a week. Good standing means a cumulative grade point average of at least 2.0 on a 4.0 grade point scale in which failing grades are computed as part of the average, or another appropriate standard established by the institution. Graduate degree means a...

  19. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...... in the cases where we were not able to gain any performance boost by specialization, the added cost, for kernel generation and extra bookkeeping, is minimal. Many of the lessons learned developing and optimizing the Bohrium GPU vector engine has proven to be valuable in a broader perspective, which has made...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF. pp 101-102 Book Review. Fixed Points - From Russia with Love - A Primer of Fixed Point Theory · A K Vijaykumar · More Details Fulltext PDF. pp 102-103 Book Review. The Medusa and the Snail.

  1. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    64 Fulfilling Mendeleev's Dream. A G Samuelson. 67 Glenn Seaborg 1912-1999. Gregory J Butera. RESEARCH EWS. 91 Nobel Prize in Physiology or Medicine 1999. Utpal Tatu. 95 Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. BO K REV EWS. Fixed Points. From Russia with Love - A Primer of ...

  3. AFSC/RACE/EcoFOCI: 2011 Gulf of Alaska IERP Cruise TN263/1TT11 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A total of 105 stations were occupied. There were two sample grids (southeast Alaska and Yakutat Bay) and two transects in the vicinity of Kayak Island. At each...

  4. 77 FR 263 - Certain Cut-To-Length Carbon-Quality Steel Plate From Italy and Japan: Revocation of Antidumping... (United States)


    ...) and NK-EH-500 (NK Everhard 500). NK-EH-360 has the following specifications: (a) Physical Properties... specifications: (a) Physical Properties: Thickness ranging from 6-50 mm, Brinell Hardness: 477 min.; (b) Heat... liquidation and collection of cash deposits on entries of the subject merchandise, entered or withdrawn from...

  5. A Report of Archaeological Testing at Site 3CT263 Within the Proposed Edmondson Wastewater Pond, Crittendon County, Arkansas (United States)


    Mariana Islands, Micronesia and Barbados, West Indies. Publications and Major Manuscripts Foster, Lee A., and Guy G. Weaver 1990 A Cultural...Harrisburg, Illinois. Garrow & Associates, Inc., Atlanta. Weaver, Guy G. 1989 Archaeological Data Recovery at La Iglesia de Maraquez (Site P0-39...34 In Archaeological Investigations on Rota, Mariana Islands, Micronesia, edited by Brian Butler, pp. 255-278. Micronesian Archaeological Survey Report

  6. 45 CFR 263.2 - What kinds of State expenditures count toward meeting a State's basic MOE expenditure requirement? (United States)


    ... healthy marriage and responsible fatherhood activities enumerated in part IV-A of the Act, sections 403(a... funds used to meet the Healthy Marriage Promotion and Responsible Fatherhood Grant match requirement may...

  7. Physical modeling of triple near-Earth Asteroid (153591) 2001 SN263 from radar and optical light curve observations

    Czech Academy of Sciences Publication Activity Database

    Becker, T.M.; Howell, E. S.; Nolan, M. C.; Magri, C.; Pravec, Petr; Taylor, P.A.; Oey, J.; Higgins, D.; Világi, J.; Kornoš, L.; Galád, A.; Gajdoš, Š.; Gaftonyuk, N. M.; Krugly, Yu. N.; Molotov, I.E.; Hicks, M. D.; Carbognani, A.; Warner, B. D.; Vachier, F.; Marchis, F.; Pollock, J.


    Roč. 248, March (2015), s. 499-515 ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229 Grant - others:SAV(SK) Vega1/0670/13 Institutional support: RVO:67985815 Keywords : asteroids * near-Earth objects * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  8. 40 CFR 421.263 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the... (United States)


    ... solvent extraction Copper 0.806 0.384 Cyanide (total) 0.126 0.050 Zinc 0.643 0.265 Combined metals 0.189... 1.020 0.420 Combined metals 0.300 Ammonia (as N) 133.300 58.600 (f) Gold solvent extraction..., incinerated or smelted Copper 5.760 2.745 Cyanide (total) 0.900 0.360 Zinc 4.590 1.890 Combined metals 1.350...

  9. SU-F-T-263: Dosimetric Characteristics of the Cine Acquisition Mode of An A-Si EPID

    Energy Technology Data Exchange (ETDEWEB)

    Bawazeer, O; Deb, P [RMIT University, Melbourne, VIC (Australia); Sarasanandarajah, S [Peter MacCallum Cancer Institute, Melbourne, Victoria (Australia); Herath, S; Kron, T [Peter MacCallum Cancer Institute, Melbourne, VIC (Australia)


    Purpose: To investigate the dosimetric characteristics of Varian a-Si-500 electronic portal imaging device (EPID) operated in cine mode particularly considering linearity with delivered dose, dose rate, field size, phantom thickness, MLC speed and common IMRT fields. Methods: The EPID that attached to a Varian Clinac 21iX linear accelerator, was irradiated with 6 and 18 MV using 600 MU/min. Image acquisition is controlled by the IAS3 software, Trigger delay was 6 ms, BeamOnDelay and FrameStartDelay were zero. Different frame rates were utilized. Cine mode response was calculated using MATLAB as summation of mean pixel values in a region of interest of the acquired images. The performance of cine mode was compared to integrated mode and dose measurements in water using CC13 ionization chamber. Results: Figure1 illustrates that cine mode has nonlinear response for small MU, when delivering 10 MU was about 0.5 and 0.64 for 6 and 18 MV respectively. This is because the missing acquired images that were calculated around four images missing in each delivery. With the increase MU the response became linear and comparable with integrated mode and ionization chamber within 2%. Figure 2 shows that cine mode has comparable response with integrated mode and ionization chamber within 2% with changing dose rate for 10 MU delivered. This indicates that the dose rate change has no effect on nonlinearity of cine mode response. Except nonlinearity, cine mode is well matched to integrated mode response within 2% for field size, phantom thickness, MLC speed dependences. Conclusion: Cine mode has similar dosimetric characteristics to integrated mode with open and IMRT fields, and the main limitation with cine mode is missing images. Therefore, the calibration of EPID images with this mode should be run with large MU, and when IMRT verification field has low MU, the correction for missing images are required.

  10. SU-F-T-263: Dosimetric Characteristics of the Cine Acquisition Mode of An A-Si EPID

    International Nuclear Information System (INIS)

    Bawazeer, O; Deb, P; Sarasanandarajah, S; Herath, S; Kron, T


    Purpose: To investigate the dosimetric characteristics of Varian a-Si-500 electronic portal imaging device (EPID) operated in cine mode particularly considering linearity with delivered dose, dose rate, field size, phantom thickness, MLC speed and common IMRT fields. Methods: The EPID that attached to a Varian Clinac 21iX linear accelerator, was irradiated with 6 and 18 MV using 600 MU/min. Image acquisition is controlled by the IAS3 software, Trigger delay was 6 ms, BeamOnDelay and FrameStartDelay were zero. Different frame rates were utilized. Cine mode response was calculated using MATLAB as summation of mean pixel values in a region of interest of the acquired images. The performance of cine mode was compared to integrated mode and dose measurements in water using CC13 ionization chamber. Results: Figure1 illustrates that cine mode has nonlinear response for small MU, when delivering 10 MU was about 0.5 and 0.64 for 6 and 18 MV respectively. This is because the missing acquired images that were calculated around four images missing in each delivery. With the increase MU the response became linear and comparable with integrated mode and ionization chamber within 2%. Figure 2 shows that cine mode has comparable response with integrated mode and ionization chamber within 2% with changing dose rate for 10 MU delivered. This indicates that the dose rate change has no effect on nonlinearity of cine mode response. Except nonlinearity, cine mode is well matched to integrated mode response within 2% for field size, phantom thickness, MLC speed dependences. Conclusion: Cine mode has similar dosimetric characteristics to integrated mode with open and IMRT fields, and the main limitation with cine mode is missing images. Therefore, the calibration of EPID images with this mode should be run with large MU, and when IMRT verification field has low MU, the correction for missing images are required.

  11. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval (United States)


    ..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...

  12. 26 CFR 1.401(a)(26)-3 - Rules applicable to a defined benefit plan's prior benefit structure. (United States)


    ... structure satisfies this paragraph if the plan provides meaningful benefits to a group of employees that... benefits for a small group of employees and thereby functions more as an individual plan for the small... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Rules applicable to a defined benefit plan's...

  13. Interchromosomal insertional translocation at Xq26.3 alters SOX3 expression in an individual with XX male sex reversal. (United States)

    Haines, Bryan; Hughes, James; Corbett, Mark; Shaw, Marie; Innes, Josie; Patel, Leena; Gecz, Jozef; Clayton-Smith, Jill; Thomas, Paul


    46,XX male sex reversal occurs in approximately 1: 20 000 live births and is most commonly caused by interchromosomal translocations of the Y-linked sex-determining gene, SRY. Rearrangements of the closely related SOX3 gene on the X chromosome are also associated with 46,XX male sex reversal. It has been hypothesized that sex reversal in the latter is caused by ectopic expression of SOX3 in the developing urogenital ridge where it triggers male development by acting as an analog of SRY. However, altered regulation of SOX3 in individuals with XX male sex reversal has not been demonstrated. Here we report a boy with SRY-negative XX male sex reversal who was diagnosed at birth with a small phallus, mixed gonads, and borderline-normal T. Molecular characterization of the affected individual was performed using array comparative genomic hybridization, fluorescent in situ hybridization of metaphase chromosomes, whole-genome sequencing, and RT-PCR expression analysis of lymphoblast cell lines. The affected male carries ∼774-kb insertion translocation from chromosome 1 into a human-specific palindromic sequence 82 kb distal to SOX3. Importantly, robust SOX3 expression was identified in cells derived from the affected individual but not from control XX or XY cells, indicating that the translocation has a direct effect on SOX3 regulation. This is the first demonstration of altered SOX3 expression in an individual with XX male sex reversal and suggests that SOX3 can substitute for SRY to initiate male development in humans.

  14. The coding polymorphism T263I in TGF-beta1 is associated with otosclerosis in two independent populations.

    NARCIS (Netherlands)

    Thys, M.; Schrauwen, I.; Vanderstraeten, K.; Janssens, K.; Dieltjens, N.; Bogaert, K. van den; Fransen, E.; Chen, W.; Ealy, M.; Claustres, M.; Cremers, C.W.R.J.; Dhooge, I.J.; Declau, F.; Claes, J.; Heyning, P. van de; Vincent, R.; Somers, T.; Offeciers, E.E.; Smith, R.J.H.; Camp, G. van


    Otosclerosis is a progressive hearing loss characterized by an abnormal bone homeostasis of the otic capsule that leads to stapes fixation. Although its etiology remains unknown, otosclerosis can be considered a complex disease. Transforming growth factor-beta 1 (TGF-beta1) was chosen for a

  15. 33 CFR 263.27 - Authority for mitigation of shore damage attributable to navigation works (Section 111). (United States)


    ... scope of section 111 remedied at local cost. (d) Cost limitations. Section 111 provides that the Chief.... The limitation on costs does not include the cost of project maintenance. The project must be planned... Engineers is authorized to investigate, study, and construct projects for the prevention or mitigation of...

  16. 33 CFR 263.25 - Authority for emergency streambank and shoreline protection of public works and nonprofit public... (United States)


    ...-to-market roads. (1) Work under this authority is not limited in engineering scope but the design must be an integrally complete within itself project that does not require additional work for effective and successful operation. The cost limitation on Federal participation may require that local...

  17. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels


    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  18. Health Manpower Source Book. Manpower Supply and Educational Statistics for Selected Health Occupations: 1968. Public Health Service Publication Number 263, Section 20. (United States)

    National Institutes of Health (DHEW), Bethesda, MD. Bureau of Health Professions Education and Manpower Training.

    This publication is a compilation of statistics on supply and education of health manpower in medicine and osteopathy, dentistry, optometry, pharmacy, podiatry, veterinary medicine, nursing, public health, and eight selected allied health occupations. The material is organized by occupations and the following information is presented for each…

  19. Evaluation of nitrogenous media components by Plackett-Burman statistical design for beta-d-fructofuranosidase production by Saccharomyces sp. strain GVT263. (United States)

    Venkateshwar, M; Chaitanya, K; Altaf, M D; Hameeda, B; Ghopal Reddy, M


    beta-d-Fructofuranosidase (FFase), an important enzyme of the confectionery and fructose syrup industry, is produced by several microorganisms. However, yeasts are the most used source because of their high sucrose fermentation capacity. In this work, production of FFase was carried out in submerged fermentation using a high enzyme-producing yeast strain. Plackett-Burman statistical experimental design was applied to evaluate the fermentation medium components. The effects of 10 nitrogen sources were studied in a 16-run experimental design. Beef extract, yeast extract, N-Z-amine, tryptone, meat extract, and ammonium acetate were found to have significant effects on enzyme production. Among these, yeast extract, N-Z-amine, and ammonium acetate were the most significant. A maximum FFase activity of 299.4 U/mL was obtained after a 24 h fermentation period.

  20. Investigations on ideal mode of cell disruption in extremely halophilic Actinopolyspora halophila (MTCC 263 for efficient release of glycine betaine and trehalose

    Directory of Open Access Journals (Sweden)

    Jayaranjan R. Kar


    Full Text Available Actinopolyspora halophila produces glycine betaine and trehalose intracellularly in considerable quantities. These biomolecules are commercially important as they have applications in food, pharmaceuticals, and agricultural sector. Development of an efficient cell disruption technique is an important step for the release of these biomolecules. In this study, various cell disruption methods such as chemical, enzymatic, physico-mechanical and physical methods were evaluated. Cell disruption by osmotic shock was found to be the best suited method for A. halophila which also has a potential to be industrially scaled up. Cell bursting pressure that is generated during osmotic shock in A. halophila was computed using Morse equation and was found to be π = 238.37 ± 29.54 atm or 2.35 ± 0.29 kPa. In addition, it was found that osmotic shock followed a first order release rate kinetics in A. halophila. The findings can be used for commercially important biomolecules from other halophilic and/or halotolerant microbes.

  1. Days-lost to training and competition in relation to workload in 263 elite show-jumping horses in four European countries

    NARCIS (Netherlands)

    Egenvall, A; Tranquille, C A; Lönnell, A C; Bitschnau, C; Oomen, A|info:eu-repo/dai/nl/314417311; Hernlund, E; Montavon, S; Franko, M A; Murray, R C; Weishaupt, M A; Weeren, van R; Roepstorff, L; van Weeren, René|info:eu-repo/dai/nl/074628550


    Orthopaedic, or other, injuries in sports medicine can be quantified using the 'days-lost to training' concept. Both the training regimen and the surface used in training and racing can affect the health of racehorses. Our aim was to associate 'days-lost to training' in elite-level show-jumpers to

  2. Multibeam collection for TN263: Multibeam data collected aboard Thomas G. Thompson from 2011-04-30 to 2011-05-21, Seattle, WA to Seattle, WA (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Rezension zu: David T. Sugimoto (Hrsg.), Transformation of a Goddess. Ishtar – Astarte – Aphrodite, Orbis Biblicus et Orientalis 263 (Fribourg – Göttingen 2014)


    Bolder-Boos, Marion


    Das anzuzeigende Buch ist eine Aufsatzsammlung basierend auf einer internationalen Konferenz, die 2011 an der Keio Universität Tokio stattgefunden hat. Von den insgesamt elf Konferenzbeiträgen sind neun in dieser Sammlung vorgelegt. In seiner Einleitung gibt David Sugimoto die Beweggründe für die Wahl des Themas an und erklärt, weshalb die drei Göttinnen im Buchtitel als eine Göttin dargestellt werden, auch wenn er sogleich einräumt, dass noch weitere Göttinnen – Inanna, Isis, Hathor, Tanit u...

  4. 45 CFR 263.13 - Is there a limit on the amount of Federal TANF funds that a State may spend on administrative costs? (United States)


    ..., support or operate the portions of information technology or computer systems used for tracking and... those portions of information technology or computer systems used for tracking or monitoring. ... Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN...

  5. Estimação do fator de condição de peixes da espécie Tracydoras paraguayensis: uma perspectiva bayesiana - DOI: 10.4025/actascianimsci.v29i1.263 Estimate of the condition factor of fish of the Tracydoras paraguayensis species: a Bayesian perspective - DOI: 10.4025/actascianimsci.v29i1.263

    Directory of Open Access Journals (Sweden)

    Vanderly Janeiro


    Full Text Available O fator de condição de peixes, expressa a relação peso-comprimento e é aceitacomo um indicador da avaliação do “bem-estar” do animal; quanto maior o peso, melhor deveser sua condição de sobrevivência. Este trabalho objetivou ajustar um modelo Gama, da família exponencial com função de ligação potência, a dados de medidas de comprimento e peso depeixes da espécie Trachydoras paraguayensis, observados na bacia do Rio Paraná, Paraná-Brasil. Asestimativas dos parâmetros do modelo foram obtidos por dois processos distintos: pelométodo clássico da máxima verossimilhança e pelo método Bayesiano (MCMC. Observou-seque todas as estimativas Bayesianas (médias à posteriori para os parâmetros de locação foramsimilares as estimativas clássicas, contudo o parâmetro de dispersão é inferior ao obtido pela aestimativa clássica, além de fornecer um erro padrão 30% menor.The factor of fish condition expresses the weight-lengthrelationship and it is accepted as an indicator for the evaluation of the animal "well-being";as larger the weight, best should be your survival condition. This work aims to fit a Gammamodel, from the exponential family with power link function, to data of lengthmeasurements and weight of fish from the Trachydoras paraguayensis species, observed in thebasin of the Paraná River, Paraná-Brazil. The estimates of the parameters of the model wereobtained by two different processes: by a classic method (maximum likelihood and byBayesian method (MCMC. It was observed that the Bayesians estimates (posterior meanof the parameters of interest were similar to the classic estimates, the dispersion parameter,it underestimated the classic estimate, however the dispersion parameter is inferior to theobtained by the classic estimate, besides supplying a standard mistake 30% smaller.

  6. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.


    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  7. Cytokine-induced inside-out activation of FcaR (CD89) is mediated by a single serine residue (S263) in the intracellular domain of the receptor

    NARCIS (Netherlands)

    Bracke, M.S.G.M.; Lammers, J.W.J.; Coffer, P.J.; Koenderman, L.


    Fc receptors play an important role in leukocyte activation and the modulation of ligand binding ("activation") is a criti-cal point of regulation. Previous studies demonstrated that the Fc receptor for IgA (FcaRI/CD89) is regulated by cytokine stimulation, switching it to a

  8. Quality of Student Paper Sources Improves after Individual Consultation with Librarians. A Review of: Reinsfelder, T. L. (2012. Citation analysis as a tool to measure the impact of individual research consultations. College & Research Libraries, 73(3, 263-277.

    Directory of Open Access Journals (Sweden)

    Laura Newton Miller


    Full Text Available Objective – To determine whether the quality of sources used for a research paper will improve after a student receives one-on-one instruction with a librarian. To test citation analysis and a rating scale as means for measuring effectiveness of one-on-one consultations.Design – Citation analysis.Setting – Academic library of a large American university.Subjects – Papers from 10 courses were evaluated. In total, 76 students were asked to meet with librarians. Of these, 61 actually participated. Another 36 students from the control group were not asked to meet with a librarian (although 1 partook in a consultation.Methods – Librarians invited faculty to participate in a new service to help improve quality of student research papers. Eligible courses included those with a required research paper component where papers could be evaluated at different times in the project. Faculty instructed students in the class to meet with the librarian after a first draft of a paper was written. Students from seven courses were asked to meet with a librarian. Courses included English Composition (2, Geography (1, Child Development (1, Occupational Therapy (1, Marketing (1 and Women Writers (1. Three courses acted as control groups (all English Composition. After meeting with students to make recommendations, librarians used a rating scale (measuring relevancy, authority, appropriate dates and scope to review the quality of sources in both drafts and final papers.Main Results – One-on-one consultations with a librarian resulted in sources being of a higher quality in the final paper. With the exception of authority, the differences between draft and final paper were statistically significant in all measures (overall quality, relevance, dates and scope. Those in the control group showed no improvement in quality of sources between draft and final paper.Conclusion – Quality of sources in final paper improves after one-on-one consultations with librarians. The use of a rating scale is helpful in objectively measuring quality of sources, although there is potential for subjective interpretation.

  9. SU-E-T-263: Point Dose Variation Using a Single Ir-192 HDR Brachytherapy Plan for Two Treatments with a Single Tandem-Ovoid Insertion for Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Liang, X; Morrill, S; Hardee, M; Han, E; Penagaricano, J; Zhang, X; Vaneerat, R [University of Arkansas Medical Science, Little Rock, AR (United States)


    Purpose: To evaluate the point dose variations between Ir-192 HDR treatments on two consecutive days using a single tandem-ovoid insertion without replanning in cervical cancer patients. Methods: This study includes eleven cervical cancer patients undergoing HDR brachytherapy with a prescribed dose of 28 Gy in 4 fractions. Each patient had two tandemovoid insertions one week apart. Each insertion was treated on consecutive days with rescanning and replanning prior to each treatment. To study the effect of no replanning for day 2 treatments, the day 1 plan dwell position and dwell time with decay were applied to the day 2 CT dataset. The point dose variations on the prescription point H (defined according to American Brachytherapy Society), and normal tissue doses at point B, bladder, rectum and vaginal mucosa (based on ICRU Report 38) were obtained. Results: Without replanning, the mean point H dose variation was 4.6 ± 10.7% on the left; 2.3 ± 2.9% on the right. The mean B point variation was 3.8 ± 4.9% on the left; 3.6 ± 4.7% on the right. The variation in the left vaginal mucosal point was 12.2 ± 10.7%; 9.5 ± 12.5% on the right; the bladder point 5.5 ± 7.4%; and the rectal point 7.9 ± 9.1%. Conclusion: Without replanning, there are variations both in the prescription point and the normal tissue point doses. The latter can vary as much as 10% or more. This is likely due to the steep dose gradient from brachytherapy compounded by shifts in the positions of the applicator in relationship to the patients anatomy. Imaging prior to each treatment and replanning ensure effective and safe brachytherapy are recommended.

  10. Spectroscopic, thermal, antimicrobial and molecular modeling studies of mononuclear pentafunctional Schiff base metal chelates derived from 5-acetyl-4-hydroxy-2H-1,3-thiazine-2,6(3H)-dione (United States)

    Adly, Omima M. I.; Taha, Ali; Fahmy, Shery A.


    A new pentafunctional N3O2 Schiff base, H2L ligand, and its metal chelates with Cu(II), Ni(II), Co(II), VO(IV), Zn(II), Cd(II), Ce(III), Cr(III), Fe(III) and UO2(VI) have been synthesized and characterized by elemental analysis, spectral, molar conductance, magnetic and thermal gravimetric studies. The results showed that the complexes have octahedral geometry except UO2 complex which has pentagonal bipyramidal arrangement. The TGA analyses suggest high stability for most complexes followed by thermal decomposition in different steps. The kinetic and thermodynamic parameters for decomposition steps of metal complexes thermograms have been calculated. Molecular orbital calculations were performed for the ligand and its metal complexes by means of hyperchem 7.52 program on the bases of semiempirical PM3 level and the results were correlated with the experimental data. The antimicrobial activity of the synthesized compounds were tested in vitro against some Gram-positive and Gram-negative bacteria; yeast and fungus strains and the results were discussed in terms of extended Lewis acid-base interactions.

  11. A High Performance Backend for Array-Oriented Programming on Next-Generation Processing Units

    DEFF Research Database (Denmark)

    Lund, Simon Andreas Frimann

    are analyzed and experimentally tested. Resulting in the design and implementation of Bohrium a runtime-system for transforming, scheduling and executing array-oriented programs. Multiple interfaces for existing languages such as Python, C++, C#, and F# have been built which utilize the backend. A suite...... and the efficient execution of them on high performance systems. This work investigates the requirements for, and the implementation of, a high performance backend supporting these goals. This involves an outline of the hardware available today, in the near future and how to program it for high performance....... The main challenge is to bridge the gaps between performance, productivity and portability. A declarative high-level array-oriented programming model is explored to achieve this goal and a backend implemented to support it. Different strategies to the backend design and application of optimizations...

  12. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.


    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  13. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. Scent of a break-up: phylogeography and reproductive trait divergences in the red-tailed bumblebee (Bombus lapidarius)

    Czech Academy of Sciences Publication Activity Database

    Lecocq, T.; Dellicour, S.; Michez, D.; Lhomme, P.; Vanderplanck, M.; Valterová, Irena; Rasplus, J. Y.; Rasmont, P.


    Roč. 13, č. 263 (2013), 263/1-263/17 ISSN 1471-2148 Grant - others:Seventh Framework Programme(XE) FP7-244090 Institutional support: RVO:61388963 Keywords : phylogeography * reproductive traits * genetic differentiation * bumblebees Subject RIV: CC - Organic Chemistry Impact factor: 3.407, year: 2013

  15. Gclust Server: 120676 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 120676 ATH_AT3G61450_18412010 Cluster Sequences Related Sequences(21) 263 SYP73 (SYNTAXIN OF PLANTS...equence length 263 Representative annotation SYP73 (SYNTAXIN OF PLANTS 73) Number

  16. Gclust Server: 85848 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 85848 CEL_C08H9.5_17535345 Cluster Sequences Related Sequences(263) 502 old-1: Overexpression...ences Related Sequences(263) Sequence length 502 Representative annotation old-1: Overexpression

  17. Reference Librarians use Electronic Sources Six Times More than Print Sources to Answer Patrons' Questions. A review of: Bradford, Jane T., Barbara Costello, and Robert Lenholt. “Reference Service in the Digital Age: An Analysis of Sources Used to Answer Reference Questions.” The Journal of Academic Librarianship 31.3 (May 2005: 263-72.

    Directory of Open Access Journals (Sweden)

    Lorie A. Kloda


    Full Text Available Objective – To test the hypothesis that electronic sources are used by librarians more often than print sources to answer questions at the reference desk. Design – Use study. Setting – Small, private university in the United States. Subjects – Five full-time and two part‐time librarians working at the reference desk for four months (two months in the fall of 2002, and two months in the spring of 2003. Methods – The study recorded every question asked by library patrons during the two study periods, with the exception of non‐library related directional questions and hardware problems. For each question recorded, librarians, while working solo at the reference desk, paraphrased the question and recorded the source(s used to answer each question. Although questions were recorded regardless of source – in person, via email, or by telephone – the medium in which each question was asked and answered was not recorded. For the first half of the study period (fall 2002 semester, librarians kept manual records that were subsequently transcribed into a spreadsheet by a student assistant. In the second half of the study period (spring 2003 semester, the librarians entered data directly into a spreadsheet. The study’s data monitor (who was also a study participant was responsible for ensuring the integrity of the data and for assigning a category to each source. The source category ‘librarian’ was problematic in that it was unclear whether or not the actual source of the answer was the librarian or a source located by the librarian. After the first half of the study, the procedure was changed to require that a reference librarian was to label a source used to answer a question as ‘librarian’ only if the answer came from a librarian’s own knowledge, and if it did not require consultation of an outside source. Categories were generated on the fly, as the data monitor reviewed the recorded questions and sources. By the end of the study, 23 categories had emerged. While all sources for answers were categorized, questions themselves were not. During the second part of the study, the gender of the patron asking the question at the reference desk was also recorded. Main results –The results for the fall 2002 and spring 2003 semesters were similar. For the entire study period, librarians used a total of 3,487 sources to answer 2,491 questions. Sources fell into 23 different categories. The top 5 categories used to answer reference questions were databases (23.92%, librarians (23.6%, library catalogue (15.03%, internal Web page (12.27%, and reference books (9.38%. The top five categories accounted for 84.2% of all sources used. For 75% of the questions, librarians referred to a single source for an answer. Almost 60% of the sources used to answer questions were electronic. Of the internal Web pages used to answer questions, the library’s online journal title listings accounted for 76%. Reference books were used to answer questions in less than 10% of cases. Less than 2% of the library’s print reference collection (173 of 9,587 titles was consulted to answer reference questions during the study period. The approximate 60:40 ratio of questions asked by female to male patrons corresponded to the university’s student body ratio. Conclusion – The results of this study confirm the researchers’ hypothesis that librarians use electronic sources with greater frequency than they use print sources to answer patrons’ reference questions. The surprising finding in this study is the proportion (approximately one quarter of reference questions answered by the librarians themselves, without the need to consult an outside source, either print or electronic. The study suggests that a large proportion of the reference collection goes unused in answering patrons’ questions and that librarians often answer a question using only a single a source of information. A reshelving study analyzing use of the reference collection is underway to supplement the results of the current study.

  18. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook


    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  19. Statistical Measures Alone Cannot Determine Which Database (BNI, CINAHL, MEDLINE, or EMBASE Is the Most Useful for Searching Undergraduate Nursing Topics. A Review of: Stokes, P., Foster, A., & Urquhart, C. (2009. Beyond relevance and recall: Testing new user-centred measures of database performance. Health Information and Libraries Journal, 26(3, 220-231.

    Directory of Open Access Journals (Sweden)

    Giovanna Badia


    Full Text Available Objective – The research project sought to determine which of four databases was the most useful for searching undergraduate nursing topics. Design – Comparative database evaluation. Setting – Nursing and midwifery students at Homerton School of Health Studies (now part of Anglia Ruskin University, Cambridge, United Kingdom, in 2005-2006. Subjects – The subjects were four databases: British Nursing Index (BNI, CINAHL, MEDLINE, and EMBASE.Methods – This was a comparative study using title searches to compare BNI (BritishNursing Index, CINAHL, MEDLINE and EMBASE.According to the authors, this is the first study to compare BNI with other databases. BNI is a database produced by British libraries that indexes the nursing and midwifery literature. It covers over 240 British journals, and includes references to articles from health sciences journals that are relevant to nurses and midwives (British Nursing Index, n.d..The researchers performed keyword searches in the title field of the four databases for the dissertation topics of nine nursing and midwifery students enrolled in undergraduate dissertation modules. The list of titles of journals articles on their topics were given to the students and they were asked to judge the relevancy of the citations. The title searches were evaluated in each of the databases using the following criteria: • precision (the number of relevant results obtained in the database for a search topic, divided by the total number of results obtained in the database search;• recall (the number of relevant results obtained in the database for a search topic, divided by the total number of relevant results obtained on that topic from all four database searches;• novelty (the number of relevant results that were unique in the database search, which was calculated as a percentage of the total number of relevant results found in the database;• originality (the number of unique relevant results obtained in the database for a search topic, which was calculated as a percentage of the total number of unique results found in all four database searches;• availability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant results found in the database;• retrievability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant full text articles found from all four database searches;• effectiveness (the probable odds that a database will obtain relevant search results;• efficiency (the probable odds that a database will obtain both unique and relevant search results; and• accessibility (the probable odds that the full text of the relevant references obtained from the database search are available electronically or in print via the user’s library.Students decided whether the search results were relevant to their topic by using a “yes/no” scale. Only record titles were used to make relevancy judgments.Main Results – Friedman’s Test and odds ratios were used to compare the performance of BNI, CINAHL, MEDLINE, and EMBASE when searching for information about nursing topics.These two statistical measures demonstrated the following:• BNI had the best average score for the precision, availability, effectiveness, and accessibility of search results;• CINAHL scored the highest for the novelty, retrievability, and efficiency of results, and ranked second place for all the other criteria;• MEDLINE excelled in the areas of recall and originality, and ranked second place for novelty and retrievability; and• EMBASE did not obtain the highest, or second highest score, for any of the criteria.Conclusion – According to the authors, these results suggest that none of the databases studied can be considered the most useful for searching undergraduate nursing topics. CINAHL and MEDLINE emerge as consistently good performers, but both databases are needed to find relevant material on a topic.Friedman’s Test clearly differentiated between the databases for the accessibility of search results. Odds ratio testing may assist librarians to make decisions about database purchases. BNI scored the highest for availability of results and CINAHL ranked the highest for retrievability. Statistical measures need to be supplemented with qualitative data about user preferences in order to determine which database is the most useful to our users.

  20. Non-stationarity of the quasi-perpendicular bow shock: comparison between Cluster observations and simulations

    Czech Academy of Sciences Publication Activity Database

    Comisel, H.; Scholer, M.; Souček, Jan; Matsukiyo, S.


    Roč. 29, č. 2 (2011), s. 263-274 ISSN 0992-7689 Institutional research plan: CEZ:AV0Z30420517 Keywords : bow shock * Cluster * plasma waves * shock waves Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.842, year: 2011

  1. Comparative Effect of an Addition of a Surface Term to Woods-Saxon Potential on Thermodynamics of a Nucleon (United States)

    Lütfüoğlu, B. C.


    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schrödinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an α particle confined in Bohrium-270 nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared for both wells. The internal energy and the specific heat capacity increase as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the number of available states. Supported by the Turkish Science and Research Council (TÜBİTAK) and Akdeniz University

  2. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.


    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  3. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)


  4. ORF Alignment: NC_003361 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  7. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)


    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  8. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  9. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.


    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  10. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 22; Issue 4. Volume 22, Issue 4. December 2001, pages 263-349. pp 263-282. Variability of Extragalactic Objects in Relation to Redshift, Color, Radio Spectral Index and Absorption Lines · D. Basu · More Details Abstract Fulltext PDF.

  11. Why immigrants manage to grab more social benefits? Empirical cross - country analysis

    Czech Academy of Sciences Publication Activity Database

    Anastassova, Lubomira; Paligorova, Teodora

    -, č. 263 (2005), s. 1-42 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : immigration * European Union * social income Subject RIV: AH - Economics

  12. see Safdar M 581 Ambika G Delay or anticipatory synchronization in ...

    Indian Academy of Sciences (India)

    Abdelzaher M. Seasonal variation of radon level and radon effective doses in the Catacomb of Kom EI-. Shuqafa, Alexandria, Egypt. 749. Abdollahzadeh H see Bahrami B Salim. 263. Abdollahzadeh M see Bahrami B Salim. 263. Abdulwahhab Muhammad A. On the Lie point symmetry analysis and solu- tions of the inviscid ...

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    Cheon Taksu. 311. Datta Animesh. 425. Dattagupta Sushanta. 203. Deepak P N. 175. Edamatsu Keiichi. 165. Ganesh Pradeep. 263. Ghose Partha. 417,425. Ghosh Rupamanjari. 189. Gillies G T. 369. Gisin Nicolas. 181. Goswami Debabrata. 235. Hara Koh'ichiro. 405. Hari Dass N D. 263,303. Home Dipankar. 229,289,321.

  14. 26 CFR 301.9100-7T - Time and manner of making certain elections under the Tax Reform Act of 1986. (United States)


    ... additional information with respect to elections may be required by future regulations or revenue procedures... cash method of accounting for loans, leases and related party transactions Loans, leases and related... section.] 803(a) 263A(d)(3) Election to have rules of Code section 263A (relating to capitalization and...

  15. African Journal of Social Work: Journal Sponsorship

    African Journals Online (AJOL)

    Publisher. Publisher contact person: NASWZ President, Noel Muridzo. Email: Phone: +263 778 165 490. Fax: +263 4 779000/1. Mailing address: National Association of Social Workers Makombe Government Complex Block 3, Room 83, Harare, Zimbabwe. National Association of Social Workers, ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 263 of 263 ... Vol 16, No 2 (2015), Training accountants in developing countries: The relevance of information and communication technology, Abstract PDF. Godson Okwuchukwu Okafor, Okenwa CY Ogbodo. Vol 17, No 3 (2017), Transition and the Problems of Modern Nigerian Poetry: An Overview of Selected ...

  17. Local predators attack exotic aphid Brachycaudus divaricatae in Lithuania

    Czech Academy of Sciences Publication Activity Database

    Danilov, J.; Rakauskas, R.; Havelka, Jan; Starý, Petr


    Roč. 69, č. 2 (2016), s. 263-269 ISSN 1721-8861 Institutional support: RVO:60077344 Keywords : Prunus * Aphids * Brachycaudus divaricatae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.051, year: 2016

  18. 76 FR 78248 - Procurement List; Addition and Deletions (United States)


    ... Rehabilitation, Inc., McMinnville, OR. Contracting Activity: Defense Logistics Agency Land and Maritime, Columbus, OH. Line, Tent NSNs: 8340-00-252-2291; 8340-00-263-0254; 8340-00-263-0255. NPAs: ASPIRO, Inc., Green... Logistics Agency Troop Support, Philadelphia, PA. Services Service Type/Location: Janitorial/Custodial...

  19. 26 CFR 1.446-1 - General rule for methods of accounting. (United States)


    ... form of cash. It is sufficient that such items can be valued in terms of money. For general rules... kind is an income-producing factor, merchandise on hand (including finished goods, work in process, raw..., under section 263 or 263A, a liability that relates to the creation of an asset having a useful life...

  20. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Department of Molecular Biology and Genetic Engineering, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India; Department of Molecular Biology and Genetic Engineering, College of Basic Science and Humanities, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India ...

  1. 77 FR 54482 - Allocation of Costs Under the Simplified Methods (United States)


    ... that direct costs for producers are direct material costs and direct labor costs. Section 1.263A-1(e)(2... capitalize the direct costs and indirect costs that are properly allocable to: (1) Real or tangible personal.... Section 1.263A-1(e)(3)(i) defines indirect costs as all costs other than direct material costs and direct...

  2. Oak woodland vegetation of Turkey-a first overview based on multivariate statistics

    Czech Academy of Sciences Publication Activity Database

    Ugurlu, E.; Roleček, Jan; Bergmeier, E.


    Roč. 15, č. 4 (2012), s. 590-608 ISSN 1402-2001 Institutional support: RVO:67985939 Keywords : gradient analysis * phytogeography * vegetation classification Subject RIV: EF - Botanics Impact factor: 2.263, year: 2012

  3. Beyond Hofmeister

    Czech Academy of Sciences Publication Activity Database

    Jungwirth, Pavel; Cremer, P. S.


    Roč. 6, č. 4 (2014), s. 261-263 ISSN 1755-4330 Institutional support: RVO:61388963 Keywords : ions * proteins * Hofmeister series Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 25.325, year: 2014

  4. Impacts of microcystin, a cyanobacterial toxin, on laboratory rodents in vivo

    Czech Academy of Sciences Publication Activity Database

    Ziková, Andrea; Kopp, Radovan


    Roč. 56, č. 5 (2008), s. 263-273 ISSN 1211-8516 Institutional research plan: CEZ:AV0Z60050516 Keywords : microcystin * mice, rats * intraperitoneal, oral, intratracheal application Subject RIV: EF - Botanics

  5. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Abraham F Jalbout1 Md Abul Haider Shipar2. Instituto de Quimica, Universidad Nacional Autonoma de Mexico, Mexico City, Mexico; Faculty of Engineering, Chiba University, Inage-ku, Chiba 263-8522, Japan ...

  6. ASTER: A Brazilian Mission to an Asteroid. (United States)

    Winter, O. C.; Macau, E. E. N.; de Campos Velho, H.; Carruba, V.


    The first Brazilian mission to an asteroid is being planned. The target is the asteroid 2001 SN263, which has a NEA orbit of class AMOR. The mission is scheduled to be launched in 2015, reaching the asteroid in 2019.

  7. Super-Resolution Still and Video Reconstruction from MPEG Coded Video

    National Research Council Canada - National Science Library

    Altunbasak, Yucel


    Transform coding is a popular and effective compression method for both still images and video sequences, as is evident from its widespread use in international media coding standards such as MPEG, H.263 and JPEG...

  8. Seed yield and quality of okra as influenced by sowing dates

    African Journals Online (AJOL)



    Abelmoschus esculentus (L) Moench) .... The economic analysis of seed pro- duction of okra was worked out on the basis of prevailing ..... A text book of economic botany. Macmillan Indian Ltd., pp. 263-264. Koay SH, Chua SE ...

  9. Conjunctival Lymphoma

    DEFF Research Database (Denmark)

    Kirkegaard, Marina M; Rasmussen, Peter K; Coupland, Sarah E


    AND RELEVANCE: Conjunctival lymphoma consists of mainly 4 subtypes of B-cell non-Hodgkin lymphoma: EMZL, FL, MCL, and DLBCL. Mantle cell lymphoma is characterized by a particularly high frequency of secondary disease of stage IVE and bilateral manifestation. The histological subtype is the main outcome......IMPORTANCE: To date, the clinical features of the various subtypes of conjunctival lymphoma (CL) have not been previously evaluated in a large cohort. OBJECTIVE: To characterize subtype-specific clinical features of CL and their effect on patient outcome. DESIGN, SETTING, AND PARTICIPANTS...... age was 61.3 years, and 55.1% (145 of 263) were female. All lymphomas were of B-cell type. The most frequent subtype was extranodal marginal zone lymphoma (EMZL) (68.4% [180 of 263]), followed by follicular lymphoma (FL) (16.3% [43 of 263]), mantle cell lymphoma (MCL) (6.8% [18 of 263]), and diffuse...

  10. Migrace v české etnologii: náměty k obohacení migrační teorie

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk


    Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Triphala, a formulation of traditional Ayurvedic medicine, shows ...

    Indian Academy of Sciences (India)

    0027, Japan; Ichiban Life Corporation, Kanagawa 231-0048, Japan; Department of Biochemistry, Primeasia University, Dhaka 1213, Bangladesh; National Institute of Radiological Sciences, Chiba 263-8555, Japan; Yokohama City University ...

  12. 78 FR 25292 - Announcement of Funding Awards; Office of Native American Programs Training and Technical... (United States)


    ... nonprofit organizations, as well as for-profit entities to provide Training & Technical Assistance to the...,000.00 146 Hekili Street, 203, Kailua, HI 96734-2873, organizations, or for- (808) 263-0083. profit...

  13. 75 FR 5925 - Proposed Flood Elevation Determinations (United States)


    ... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...

  14. 75 FR 78617 - Final Flood Elevation Determinations (United States)


    .... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...

  15. 77 FR 45592 - Marine Mammals; File No. 17157 (United States)


    .... SUMMARY: Notice is hereby given that a permit has been issued to Stephen John Trumble, Ph.D., Baylor...; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312...

  16. 77 FR 29966 - Marine Mammals; File No. 17157 (United States)


    ...., Baylor University, 101 Bagby Ave., Waco, TX 76706, has applied in due form for a permit to import, export...; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701...

  17. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Statement Policies and Procedures for Identifying and Resolving Conflicts of Interest Physician Resources Physician Resources From The ... for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail mediaonly@ ...

  18. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 142 VDAVLSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_002755 gi|15843206 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  19. ORF Alignment: NC_001264 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 237 RVSLLVQEVGGPVLSSLNTSRPLAVGSTFKLAVLGEVQAQ... NC_001264 gi|15807905 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  20. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 156 VDAALSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_000962 gi|15610729 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  1. Dicty_cDB: VFM511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A Score E Sequences producing significant alignments: (bits) Value N AF222688 |AF222688.1 Dictyostelium discoideum dynaco...222688_1( AF222688 |pid:none) Dictyostelium discoideum dynacorti... 263 2e-69 A53

  2. Foliar N concentration and d15N signature reflect the herb layer species diversity and composition in oak-dominated forests

    Czech Academy of Sciences Publication Activity Database

    Hofmeister, J.; Hošek, J.; Bůzek, F.; Roleček, Jan


    Roč. 15, č. 3 (2012), s. 318-328 ISSN 1402-2001 Institutional support: RVO:67985939 Keywords : soil nutriens * species composition * species richness Subject RIV: EF - Botanics Impact factor: 2.263, year: 2012

  3. Occurrences of pathogenic Vibrio parahaemolyticus from Vellar ...

    African Journals Online (AJOL)



    2001). Vibrio vulnificus as a health hazard for shrimp consumers. Revista do Instituto de Medicina Tropical de Sao Paulo. 43: 263- 266. Sambrook J, Fritsch EF, Maniatis T (1989). Molecular Cloning: A. Laboratory Manual, 2nd ed.

  4. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... ACG welcomes inquiries about digestive health from the media and can make experts available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  5. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Findings from The American Journal of Gastroenterology Annual Scientific Meeting Meeting ... for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  6. Sur, a former late-glacial and Holocene lake at the westernmost margin of the Carpathians

    Czech Academy of Sciences Publication Activity Database

    Petr, L.; Žáčková, P.; Matys Grygar, Tomáš; Píšková, Anna; Křížek, M.; Treml, V.


    Roč. 85, č. 3 (2013), s. 239-263 ISSN 0032-7786 Institutional support: RVO:61388980 Keywords : Geochemistry * Geomorphology * Multi-proxy reconstruction * Palaeobotany * Palaeolimnology * Pannonia Subject RIV: DD - Geochemistry Impact factor: 2.778, year: 2013

  7. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... and physicians alike. About the Institute Mission and Leadership Institute Annual Reports Donation Form ACG Visiting Professor ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  8. First record of Philometra katsuwoni (Nematoda, Philometridae), a parasite of skipjack tuna Katsuwonus pelamis (Perciformes, Scombridae), off South American Atlantic coast

    Czech Academy of Sciences Publication Activity Database

    Cárdenas, M. Q.; Moravec, František; Kohn, A.


    Roč. 9, č. 2 (2009), s. 263-266 ISSN 1676-0611 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Katsuwonus * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  9. Pholiota highlandensis var. citrinosquamulosa (Fungi, Agaricales) is conspecific with Pholiota gallica

    Czech Academy of Sciences Publication Activity Database

    Holec, J.; Kolařík, Miroslav; Borgarino, D.; Bidaud, A.; Moreau, P.A.


    Roč. 103, 1-2 (2016), s. 251-263 ISSN 0029-5035 Institutional support: RVO:61388971 Keywords : Basidiomycota * Strophariaceae * phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 0.941, year: 2016

  10. Žena ve vědě: Alena Lengerová

    Czech Academy of Sciences Publication Activity Database

    Bahenská, Marie


    Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Sciences Subject RIV: AB - History

  11. Photographic observations of fireballs in Tajikistan

    Czech Academy of Sciences Publication Activity Database

    Babadzhanov, P.B.; Kokhirova, G.I.; Borovička, Jiří; Spurný, Pavel


    Roč. 43, č. 4 (2009), s. 353-363 ISSN 0038-0946 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.263, year: 2009

  12. Customer Overview of Pulsed Laser Heating for Evaluation of Gun Bore Materials (United States)


    03002, February 2003. 5. J. Warrender, C. Mulligan , and J. Underwood, “Analysis of thermo-mechanical cracking in refractory coatings using variable pulse duration laser pulse heating,” Wear 263 1540 (2007).

  13. East African Medical Journal - Vol 92, No 5 (2015)

    African Journals Online (AJOL)

    Uterine Rupture in a Primigravida with Mullerian Anomaly at 27 Weeks Gestation · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Kunuthia, A Kihara, RJ Kosgei, AN Bosire, 260-263 ...

  14. Drug: D02679 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available psychiatric agent ... DG01905 ... Phenothiazine antipsychotics ... Phenothiazine derivative ... CAS: 3819-00-9 PubChem: 17396848 ChEMBL: CHEMBL1584 LigandBox: D02679 NIKKAJI: J8.263E ...

  15. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... tailored for GI Fellows. Resident/Trainee Resources Membership Benefits Trainee Events and Meetings Training Committee Board Review ... for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail mediaonly@ ...

  16. Nález zásobnic ze střední doby hradištní u závrtu ZMF (Tetín, okr. Beroun)

    Czech Academy of Sciences Publication Activity Database

    Vencl, Slavomil


    Roč. 19, č. 1 (2015), s. 263-269 ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Middle Hillfort Period * storage jars * Bohemian Karst Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. The effect of full agonist/antagonist of D1 receptor on cognitive function in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Stuchlík, Aleš; Valeš, Karel


    Roč. 11, Suppl.1 (2008), s. 263-263 ISSN 1461-1457. [CINP Congress /26./. 13.07.2008-17.07.2008, Munich] R&D Projects: GA MŠk(CZ) 1M0517; GA MZd(CZ) NR9178; GA ČR(CZ) GA309/07/0341 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * D1 receptor * schizophrenia * cognitive function Subject RIV: FH - Neurology

  18. Pulsed laser-induced phase transformations in CdTe single crystals

    Czech Academy of Sciences Publication Activity Database

    Gatskevich, E.; Ivlev, G.; Přikryl, Petr; Černý, R.; Cháb, Vladimír; Cibulka, O.


    Roč. 248, - (2005), s. 259-263 ISSN 0169-4332. [International Conference on Photo-Exeited Processes and Applications 4 - ICPEPA /4./. Lecce, 05.09.2004-09.09.2004] R&D Projects: GA ČR(CZ) GA201/04/1503 Institutional research plan: CEZ:AV0Z10190503 Keywords : II-VI semiconductor * laser irradiation * phase change Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.263, year: 2005

  19. Variation in NAT2 acetylation phenotypes is associated with differences in food-producing subsistence modes and ecoregions in Africa

    Czech Academy of Sciences Publication Activity Database

    Podgorná, Eliška; Diallo, I.; Vangenot, Ch.; Sanchez-Mazas, A.; Sabbagh, A.; Černý, Viktor; Poloni, E. S.


    Roč. 15, č. 263 (2015) ISSN 1471-2148 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : NAT2 * acetylation polymorphism * African Sahel * pastoral nomads * subsistence mode * ecoregion * natural selection Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.406, year: 2015

  20. Effect on HIV-1 viral replication capacity of DTG-resistance mutations in NRTI/NNRTI resistant viruses. (United States)

    Pham, Hanh T; Mesplède, Thibault; Wainberg, Mark A


    Recommended regimens for HIV-positive individuals include the co-administration of dolutegravir (DTG) with two reverse transcriptase inhibitors (RTIs). Although rare, emerging resistance against DTG is often associated with the R263K substitution in integrase. In-vitro-selected R263K was associated with impaired viral replication capacity, DNA integration, and integrase strand-transfer activity, especially when accompanied by the secondary mutation H51Y. Given the reduced fitness of RTI-resistant viruses, we investigated potential impacts on viral replication of combining R263K and H51Y/R263K with major RTI-resistance substitutions including K65R, L74V, K103N, E138K, and M184I/V. We combined the R263K or H51Y/R263K with RTI-resistance mutations into the proviral plasmid pNL4.3 and measured the resulting viral infectiousness, replication capacity, and ability to integrate viral DNA into host cells. Infectiousness was determined by luciferase assay in TZM-bl cells. Replicative capacity was monitored over 7 days and viral DNA integration was studied by real-time Alu-qPCR in PM1 cells. We found that viral infectiousness, replication capacities and integration levels were greatly reduced in triple mutants, i.e. H51Y/R263K plus a RT mutation, and moderately reduced in double mutants, i.e. R263K plus a RT mutation, compared to wild-type and single RT-mutant viruses. Our findings help to explain the absence of RTI mutations in individuals who experienced DTG-treatment failure.

  1. The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy

    DEFF Research Database (Denmark)

    Crabtree, Andrew


    Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7......Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7...

  2. (2-oxo-2H-chromen-3-yl)carbonyl

    Indian Academy of Sciences (India)

    ), 175 (26.3), 144 (100),. 104 (26.3), 71 (71.4), 55 (74.2), 57 (94.1). Anal. Calcd. (%) for C25H17NO7 (443.42): C, 67.72; H, 3.86; N,. 3.16. Found (%): C, 67.60; H, 3.80; N, 3.10. N. O. O. N. O. OH. CH3. O. 2. Toluene / Heat. O. O. CH3. H3C. OH2.

  3. Fibrin nanostructures for biomedical applications

    Czech Academy of Sciences Publication Activity Database

    Riedelová-Reicheltová, Zuzana; Brynda, Eduard; Riedel, Tomáš


    Roč. 65, Suppl. 2 (2016), S263-S272 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : fibrinogen * fibrin-bound thrombin * nanostructures Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016

  4. Radiologische Befunde bei Dissektionen der Zervikalgefäße:vergleichende Bildanalyse von Digitaler Subtraktionsangiographie, Spiral-Computertomographie und Magnetresonanztomographie


    Bauer-Conrad, L. (Luise)


    Retrospektiv wurden anhand der bildgebenden Befunde von 38 Patienten (47 dissektierte Gefäße) spezifische und unspezifische radiologische Zeichen einer Dissektion der hirnversorgenden Gefäße in der Angiographie, der Computertomographie (CT), sowie der Magnetresonanztomographie (MRT) und -angiographie (MRA) ausgewertet. Ergebnisse Angiographie: Doppellumen (0%), KM-depot (26,7%), String Sign (40%) und Intimaler Flap (0%). In der CT: exzentr. Lumen (26,3%), Wandverdickung (26,3%), Quotient „äuß...

  5. Inhibition of highly pathogenic PRRSV replication in MARC-145 cells by artificial microRNAs

    Directory of Open Access Journals (Sweden)

    Wang Liangliang


    Full Text Available Abstract Background Highly pathogenic porcine reproductive and respiratory syndrome (HP-PRRS has caused large economic losses in swine industry in recent years. However, current antiviral strategy could not effectively prevent and control this disease. In this research, five artificial microRNAs (amiRNAs respectively targeted towards ORF5 (amirGP5-243, -370 and ORF6 (amirM-82, -217,-263 were designed and incorporated into a miRNA-based vector that mimics the backbone of murine miR-155 and permits high expression of amiRNAs in a GFP fused form mediated by RNA Pol II promoter CMV. Results It was found that amirGP5-370 could effectively inhibit H-PRRSV replication. The amirM-263-M-263, which was a dual pre-amiRNA expression cassette where two amirM-263s were chained, showed stronger virus inhibitory effects than single amirM-263. H-PRRSV replication was inhibited up to 120 hours in the MARC-145 cells which were stably transduced by recombinant lentiviruses (Lenti-amirGP5-370, -amirM-263-M-263. Additionally, efficacious dose of amirGP5-370 and amirM-263 expression did not trigger the innate interferon response. Conclusions Our study is the first attempt to suppress H-PRRSV replication in MARC-145 cells through vector-based and lentiviral mediated amiRNAs targeting GP5 or M proteins coding sequences of PRRSV, which indicated that artificial microRNAs and recombinant lentiviruses might be applied to be a new potent anti-PRRSV strategy.

  6. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)


    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  7. A critical HA1 neutralizing domain of H5N1 influenza in an optimal conformation induces strong cross-protection.

    Directory of Open Access Journals (Sweden)

    Lanying Du

    Full Text Available The highly pathogenic avian influenza (HPAI H5N1 viruses, especially the laboratory-generated H5N1 mutants, have demonstrated the potential to cross the species barrier and infect mammals and humans. Consequently, the design of an effective and safe anti-H5N1 vaccine is essential. We previously demonstrated that the full-length hemagglutinin 1 (HA1 could induce significant neutralizing antibody response and protection. Here, we intended to identify the critical neutralizing domain (CND in an optimal conformation that can elicit strong cross-neutralizing antibodies and protection against divergent H5N1 strains. We thus constructed six recombinant proteins covering different regions of HA1 of A/Anhui/1/2005(H5N1, each of which was fused with foldon (Fd and Fc of human IgG. We found that the critical fragment fused with Fd/Fc (HA-13-263-Fdc, H5 numbering that could elicit the strongest neutralizing antibody response is located in the N-terminal region of HA1 (residues 13-263, which covers the receptor-binding domain (RBD, residues 112-263. We then constructed three additional recombinants fused with Fd plus His tag (HA-13-263-Fd-His, Fc only (HA-13-263-Fc, and His tag only (HA-13-263-His, respectively. We found that the HA-13-263-Fdc, which formed an oligomeric conformation, induced the strongest neutralizing antibody response and cross-protection against challenges of two tested H5N1 virus strains covering clade 1: A/VietNam/1194/2004 (VN/1194 or clade 2.3.4: A/Shenzhen/406H/06 (SZ/406H, while HA-13-263-Fc dimer and HA-13-263-Fd-His trimer elicited higher neutralizing antibody response and protection than HA-13-263-His monomer. These results suggest that the oligomeric form of the CND containing the RBD can be further developed as an effective and safe vaccine for cross-protection against divergent strains of H5N1 viruses.

  8. PI3K and Bcl-2 inhibition primes glioblastoma cells to apoptosis through downregulation of Mcl-1 and Phospho-BAD. (United States)

    Pareja, Fresia; Macleod, David; Shu, Chang; Crary, John F; Canoll, Peter D; Ross, Alonzo H; Siegelin, Markus D


    Glioblastoma multiforme (GBM) is a highly malignant human brain neoplasm with limited therapeutic options. GBMs display a deregulated apoptotic pathway with high levels of the antiapoptotic Bcl-2 family of proteins and overt activity of the phosphatidylinositol 3-kinase (PI3K) signaling pathway. Therefore, combined interference of the PI3K pathway and the Bcl-2 family of proteins is a reasonable therapeutic strategy. ABT-263 (Navitoclax), an orally available small-molecule Bcl-2 inhibitor, and GDC-0941, a PI3K inhibitor, were used to treat established glioblastoma and glioblastoma neurosphere cells, alone or in combination. Although GDC-0941 alone had a modest effect on cell viability, treatment with ABT-263 displayed a marked reduction of cell viability and induction of apoptotic cell death. Moreover, combinatorial therapy using ABT-263 and GDC-0941 showed an enhanced effect, with a further decrease in cellular viability. Furthermore, combination treatment abrogated the ability of stem cell-like glioma cells to form neurospheres. ABT-263 and GDC-0941, in combination, resulted in a consistent and significant increase of Annexin V positive cells and loss of mitochondrial membrane potential compared with either monotherapy. The combination treatment led to enhanced cleavage of both initiator and effector caspases. Mechanistically, GDC-0941 depleted pAKT (Serine 473) levels and suppressed Mcl-1 protein levels, lowering the threshold for the cytotoxic actions of ABT-263. GDC-0941 decreased Mcl-1 in a posttranslational manner and significantly decreased the half-life of Mcl-1 protein. Ectopic expression of human Mcl-1 mitigated apoptotic cell death induced by the drug combination. Furthermore, GDC-0941 modulated the phosphorylation status of BAD, thereby further enhancing ABT-263-mediated cell death. Combination therapy with ABT-263 and GDC-0941 has novel therapeutic potential by specifically targeting aberrantly active, deregulated pathways in GBM, overcoming

  9. Gut hormone pharmacology of a novel GPR119 agonist (GSK1292263, metformin, and sitagliptin in type 2 diabetes mellitus: results from two randomized studies.

    Directory of Open Access Journals (Sweden)

    Derek J Nunez

    Full Text Available GPR119 receptor agonists improve glucose metabolism and alter gut hormone profiles in animal models and healthy subjects. We therefore investigated the pharmacology of GSK1292263 (GSK263, a selective GPR119 agonist, in two randomized, placebo-controlled studies that enrolled subjects with type 2 diabetes. Study 1 had drug-naive subjects or subjects who had stopped their diabetic medications, and Study 2 had subjects taking metformin. GSK263 was administered as single (25-800 mg; n = 45 or multiple doses (100-600 mg/day for 14 days; n = 96. Placebo and sitagliptin 100 mg/day were administered as comparators. In Study 1, sitagliptin was co-administered with GSK263 or placebo on Day 14 of dosing. Oral glucose and meal challenges were used to assess the effects on plasma glucose, insulin, C-peptide, glucagon, peptide tyrosine-tyrosine (PYY, glucagon-like peptide-1 (GLP-1 and glucose-dependent insulinotropic peptide (GIP. After 13 days of dosing, GSK263 significantly increased plasma total PYY levels by ∼ five-fold compared with placebo, reaching peak concentrations of ∼ 50 pM after each of the three standardized meals with the 300 mg BID dose. Co-dosing of GSK263 and metformin augmented peak concentrations to ∼ 100 pM at lunchtime. GSK263 had no effect on active or total GLP-1 or GIP, but co-dosing with metformin increased post-prandial total GLP-1, with little effect on active GLP-1. Sitagliptin increased active GLP-1, but caused a profound suppression of total PYY, GLP-1, and GIP when dosed alone or with GSK263. This suppression of peptides was reduced when sitagliptin was co-dosed with metformin. GSK263 had no significant effect on circulating glucose, insulin, C-peptide or glucagon levels. We conclude that GSK263 did not improve glucose control in type 2 diabetics, but it had profound effects on circulating PYY. The gut hormone effects of this GPR119 agonist were modulated when co-dosed with metformin and sitagliptin. Metformin may

  10. Effects of storage environment on the moisture content and microbial growth of food waste. (United States)

    Chen, Ying-Chu; Hsu, Yi-Cheng; Wang, Chung-Ting


    Food waste (FW) has become a critical issue in sustainable development as the world's population has increased. Direct incineration of FW remains the primary treatment option. The moisture content of FW may affect the energy efficiency of incineration. In Taiwan, FW, which includes raw (r-FW) and post-consumer (p-FW) waste, is often stored in freezers before pretreatment. This study evaluated the effects of storage environment on the moisture content and microbial growth of FW. Storage at 263 K was associated with the largest reduction in moisture content in both r-FW and p-FW. At 263 K, the moisture content of r-FW and p-FW was lowest at 96 and 72 h, respectively. The E.coli and total bacteria counts were steady over 120 h when stored at 263 K. Storage at 253 K required the greatest electricity consumption, followed by 263 K and 258 K. Based on the reduction of moisture content and increase in energy efficiency, it is suggested that FW is placed in temporary storage at 263 K before (pre)treatment. The results of this study will help waste-to-energy plants, incinerators, and waste management enterprises to implement proper (pre)treatment of FW for sustainable waste management. Copyright © 2018 Elsevier Ltd. All rights reserved.

  11. Effects of oral Lactobacillus administration on antioxidant activities and CD4+CD25+forkhead box P3 (FoxP3)+ T cells in NZB/W F1 mice. (United States)

    Tzang, Bor-Show; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Huang, Chih-Yang; Hsu, Tsai-Ching


    Systemic lupus erythematosus (SLE) is an autoimmune disease that is characterised by a dysregulation of the immune system, which causes inflammation responses, excessive oxidative stress and a reduction in the number of cluster of differentiation (CD)4+CD25+forkhead box P3 (FoxP3)+ T cells. Supplementation with certain Lactobacillus strains has been suggested to be beneficial in the comprehensive treatment of SLE. However, little is known about the effect and mechanism of certain Lactobacillus strains on SLE. To investigate the effects of Lactobacillus on SLE, NZB/W F1 mice were orally gavaged with Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263). Supplementation with GMNL-32, GMNL-89 and GMNL-263 significantly increased antioxidant activity, reduced IL-6 and TNF-α levels and significantly decreased the toll-like receptors/myeloid differentiation primary response gene 88 signalling in NZB/W F1 mice. Notably, supplementation with GMNL-263, but not GMNL-32 and GMNL-89, in NZB/W F1 mice significantly increased the differentiation of CD4+CD25+FoxP3+ T cells. These findings reveal beneficial effects of GMNL-32, GMNL-89 and GMNL-263 on NZB/W F1 mice and suggest that these specific Lactobacillus strains can be used as part of a comprehensive treatment of SLE patients.

  12. HPLC-MS/MS determination of a hardly soluble drug in human urine through drug-albumin binding assisted dissolution. (United States)

    Rodila, Ramona; Kim, Grace E; Fan, Leimin; Chang, Min S; Zhang, Jun; Wu, Huaiqin; El-Shourbagy, Tawakol A


    ABT-263 is under development for treatment of cancer. In order to support clinical trials, an analytical method for ABT-263 quantification in human urine became necessary. Due to the extremely poor solubility of ABT-263 in aqueous and most common organic solvents, a critical step was to dissolve the drug into urine matrix. Although other potential approaches could be used, addition of powder albumin was found to be the most advantageous. Albumin powder does not significantly alter urine sample volume (< or = 2.8%) and a range of albumin to urine sample volume ratios can be allowed for full recovery of drug and thus accurate quantification. The procedure is fairly simple and can potentially be a universal approach for compounds with low solubility in urine, but strong protein binding. The method has been validated to support clinical trials.

  13. Design, synthesis and pharmacological evaluation of new acyl sulfonamides as potent and selective Bcl-2 inhibitors. (United States)

    Liu, Xiaohua; Zhang, Yu; Huang, Wenjing; Tan, Wenfu; Zhang, Ao


    The antiapoptotic protein Bcl-2, overexpressed in many tumor cells, is an attractive target for potential small molecule anticancer drug discovery. Herein, we report a different structural modification approach on ABT-263 by merging the piperazinyl-phenyl fragment into a bicyclic framework leading to a series of novel analogues, among which tetrahydroisoquinoline 13 was nearly equally potent against Bcl-2 as ABT-263. Further SAR in the P4-interaction pocket affored the difluoroazetidine substituted analogue 55, which retained good Bcl-2 activity with improved Bcl-2/Bcl-xL selectivity. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia


    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  15. MicroSISAK. Continuous liquid-liquid extractions of radionuclides at {>=} 0.2 mL/min

    Energy Technology Data Exchange (ETDEWEB)

    Hild, D.; Eberhardt, K.; Kratz, J.V.; Wiehl, N. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Even, J. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Helmholtz-Institut Mainz, Mainz (Germany); Loeb, P.; Werner, B.; Hofmann, C. [Institut fuer Mikrotechnik Mainz GmbH, Mainz (Germany)


    extraction yield determined as the ratio of the Tc {gamma}-ray activities in both detectors was 76 {+-} 1%. With this experiment, it was demonstrated that MicroSISAK is in principle ready for an on-line experiment for the chemical characterization of the superheavy element bohrium, element 107. However, the detection of a-particle activities by liquid scintillation counting still needs to be worked out. (orig.)

  16. Blood parasites in northern goshawk (Accipiter gentilis) with an emphasis to Leucocytozoon toddi

    Czech Academy of Sciences Publication Activity Database

    Hanel, J.; Doležalová, J.; Stehlíková, Š.; Modrý, David; Chudoba, J.; Synek, P.; Votýpka, Jan


    Roč. 115, č. 1 (2016), s. 263-270 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : avian blood parasites * Haemosporida * Trypanosoma * PCR detection * birds of prey * raptors * mixed infection Subject RIV: EG - Zoology Impact factor: 2.329, year: 2016

  17. Correlation of Ultrastructural Changes of Endothelial Cells and Astrocytes Occurring during Blood Brain Barrier Damage after Traumatic Brain Injury with Biochemical Markers of Blood Brain Barrier Leakage and Inflammatory Response

    Czech Academy of Sciences Publication Activity Database

    Vajtr, D.; Benada, Oldřich; Kukačka, J.; Průša, R.; Houšťava, L.; Toupalík, P.; Kizek, R.


    Roč. 58, č. 2 (2009), s. 263-268 ISSN 0862-8408 Institutional research plan: CEZ:AV0Z50200510 Keywords : Blood brain barrier * Expansive contusion * Metalloproteinases Subject RIV: EE - Microbiology, Virology Impact factor: 1.430, year: 2009

  18. Perceived Social Support and Locus of Control as the Predictors of Vocational Outcome Expectations (United States)

    Isik, Erkan


    The purpose of this study was to examine the relationships of vocational outcome expectation to social support which is an environmental factor and locus of control which is a personal factor. With this purpose, using Social Cognitive Career Theory as the theoretical framework, 263 undergraduate students completed Vocational Outcome Expectations…

  19. 78 FR 57339 - Fisheries of the Caribbean, Gulf of Mexico and South Atlantic; Revisions to Headboat Reporting... (United States)


    ... approved, the For- Hire Reporting Amendment would amend the FMPs to modify data reporting for for-hire... Karla Gore, Southeast Regional Office, NMFS, 263 13th Avenue South, St. Petersburg, FL 33701...). Attachments to electronic comments will be accepted in Microsoft Word, Excel, or Adobe PDF file formats only...

  20. Rutherford backscatering spectroscopy of optically silver doped amorphous chalcogenides

    Czech Academy of Sciences Publication Activity Database

    Wágner, T.; Krbal, M.; Vlček, M.; Frumar, M.; Peřina, Vratislav; Macková, Anna; Hnatowicz, Vladimír; Kasap, S. O.


    Roč. 53, č. 1 (2003), s. A247-A256 ISSN 0011-4626 R&D Projects: GA AV ČR KSK1010104 Keywords : backscatering * Ag2-Ge-S * films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.263, year: 2003

  1. Basama teremtete a jiná citoslovce klení

    Czech Academy of Sciences Publication Activity Database

    Šimečková, Marta


    Roč. 98, č. 5 (2015), s. 263-266 ISSN 0027-8203 R&D Projects: GA ČR GAP406/11/1786 Keywords : interjection basom/basama/basa * loanword * territorial dialects * Czech-Hungarian language contact Subject RIV: AI - Linguistics

  2. Developmental Dynamics of Emotion and Cognition Processes in Preschoolers (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.; Weaver, Jennifer Miner


    Dynamic relations during the preschool years across processes of control and understanding in the domains of emotion and cognition were examined. Participants were 263 children (42% non-White) and their mothers who were seen first when the children were 3 years old and again when they were 4. Results indicated dynamic dependence among the…

  3. 77 FR 58556 - Proposed Agency Information Collection Activities; Comment Request (United States)


    .... Telecommunications Device for the Deaf (TDD) users may contact (202) 263-4869, Board of Governors of the Federal... the proper performance of the Federal Reserve's functions; including whether the information has... Bank Holding Company Report of Equity Investments in Nonfinancial Companies, and the Annual Report of...

  4. 75 FR 55579 - Proposed Agency Information Collection Activities; Comment Request (United States)


    ... the proposed collection of information is necessary for the proper performance of the Federal Reserve... for the Deaf (TDD) users may contact (202) 263-4869, Board of Governors of the Federal Reserve System... revision, of the following report: Report title: Domestic Finance Company Report of Consolidated Assets and...

  5. 78 FR 66714 - Proposed Agency Information Collection Activities; Comment Request (United States)


    ... Deaf (TDD) users may contact (202) 263-4869, Board of Governors of the Federal Reserve System.... Whether the proposed collection of information is necessary for the proper performance of the Federal... revision, of the following report: Report title: Domestic Finance Company Report of Consolidated Assets and...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 263 ... Issue, Title. Vol 1, No 2 (2002), Effect of Light and Darkness on Packed Cell Volume in the Rat, Abstract. A. A. OSINUBI, F. I. DURU, C. C. NORONHA, A. O. OKANLAWON. Vol 4, No 1 (2005), Effect of Marijuana Smoking on Blood Chemistry and Serum Biogenic Amines Concentrations in Humans ...

  7. Gifted Education in Preschool: Perceived Barriers and Benefits of Program Development (United States)

    Kettler, Todd; Oveross, Mattie E.; Bishop, James C.


    Substantial evidence supports the benefits of quality preschool education for children of all levels and backgrounds. However, early childhood gifted education services rarely exist in preschool centers. This study included 263 preschool centers representing geographic diversity in a southern state in the United States. Narrative data were…

  8. Proton nuclear magnetic resonance study of water + t-butyl alcohol ...

    African Journals Online (AJOL)

    Hydroxyl-proton chemical shifts for water and t-butyl alcohol in water + t-butyl alcohol mixtures with 8 mol% t-butyl alcohol, and the average hydroxyl and amino proton chemical shift for water + t-butylamine mixtures, have been determined at 200 MHz for four temperatures (263, 278, 298 and 313 K) as a function of ...

  9. A genetic linkage map of Japanese scallop Mizuhopecten ...

    African Journals Online (AJOL)

    A genetic linkage map of the Japanese scallop Mizuhopecten yessoensis was constructed based on 302 markers, including 263 amplified fragment length polymorphism (AFLP) markers and 39 microsatellite (SSR) markers. The two parental maps were constructed according to the double pseudo-test cross strategy with an ...

  10. Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017)

    African Journals Online (AJOL)

    Biosynthesis of lovastatin using agro-industrial wastes as carrier substrates · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Sadia Javed, Munazzah Meraj, Saqib Mahmood, Arruje Hameed, Farah Naz, Sameera Hassan, Rao Irfan, 263-269.

  11. Prevention of bone bridge formation using transplantation of the autogenous mesenchymal stem cells to physeal defects: An experimental study in rabbits

    Czech Academy of Sciences Publication Activity Database

    Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.


    Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  13. Electron-Spectroscopic Studies of Thermal Stability of Pd/Nb Surfaces

    Czech Academy of Sciences Publication Activity Database

    Jirka, Ivan; Bastl, Zdeněk


    Roč. 53, č. 1 (2003), s. 11-17 ISSN 0011-4626 Institutional research plan: CEZ:AV0Z4040901 Keywords : metal-metal interfaces * alloys * palladium films Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.263, year: 2003

  14. S¯adhan¯a Vol. 28, 2003 Author Index

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Babu Rao C. Study of engineering surfaces using laser- scattering techniques. 739. Bahadur D. Biomaterials and magnetism. 639. Balaselvi J see Bharathi A. 263. Baldev Raj. Summary. 5 see Mudali U K. 601 see Babu Rao C. 739 see Venugopal S. 833. Baligidad R G see Gogia A K. 677. Banerjee D see Gogia A K. 677.

  15. Cytoplasmic organelles determine complexity and specificity of calcium signalling in adrenal chromaffin cells

    Czech Academy of Sciences Publication Activity Database

    Garsia-Sancho, J.; Verkhratsky, Alexei


    Roč. 192, č. 2 (2008), s. 263-271 ISSN 1748-1708 Institutional research plan: CEZ:AV0Z50390512 Keywords : Ca2+ signalling * calcium microdomains * chromaffin cells Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 2.455, year: 2008

  16. 77 FR 41163 - Submission for OMB Review; Comment Request (United States)


    ... States promoting food safety with respect to meal, poultry, and egg products. Need and Use of the.... Number of Respondents: 1,150. Frequency of Responses: Reporting: On occasion. Total Burden Hours: 263... disposed. Description of Respondents: Business or other for-profit. Number of Respondents: 6,090. Frequency...

  17. Download this PDF file

    African Journals Online (AJOL)


    ABSTRACT. Hydroxyl-proton chemical shifts for water and t-butyl alcohol in water + t-butyl alcohol mixtures with ≥ 8 mol% t-butyl alcohol, and the average hydroxyl and amino proton chemical shift for water + t-butylamine mixtures, have been determined at 200 MHz for four temperatures (263, 278, 298 and 313 K) as a ...

  18. School children\\'s accessibility to insecticide-treated bednets in peri ...

    African Journals Online (AJOL)

    When asked about general health status questions, 263 (57.9%) reported ever having fallen ill while at school, 41.2% having ever came to school knowing they were unwell, and 40.7% of those that reported having fallen ill at school, categorized their illness as malaria. Regarding illness in the month preceding the study, ...

  19. Utilizing linkage disequilibrium information from Indian Genome ...

    Indian Academy of Sciences (India)

    References. Barrett J. C., Fry B., Maller J. and Daly M. J. 2005 Haploview, anal- ysis and visualization of LD and haplotype maps. Bioinformatics. 21, 263–265. Bahl S., Virdi K., Mittal U., Sachdeva M. P., Kalla A. K., Holmes. S. E. et al. 2005 Evidence of a common founder for SCA12 in the Indian population. Ann. Hum. Genet.

  20. The Construction and Validation of an Abridged Version of the Autism-Spectrum Quotient (AQ-Short) (United States)

    Hoekstra, Rosa A.; Vinkhuyzen, Anna A. E.; Wheelwright, Sally; Bartels, Meike; Boomsma, Dorret I.; Baron-Cohen, Simon; Posthuma, Danielle; van der Sluis, Sophie


    This study reports on the development and validation of an abridged version of the 50-item Autism-Spectrum Quotient (AQ), a self-report measure of autistic traits. We aimed to reduce the number of items whilst retaining high validity and a meaningful factor structure. The item reduction procedure was performed on data from 1,263 Dutch students and…

  1. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    the least (2.63 mg/kg) was for enjera processed from brown tef grain baked using tap water. Daily dietary fluoride intake was different with ... studies, due to the increased health benefits associated with high iron contents in brown tef ... drinking water or food results in dental fluorosis and skeletal fluorosis (Liub et al., 2009).

  2. Disclosure of HIV Positive Result to a Sexual Partner among Adult ...

    African Journals Online (AJOL)


    sexual partners. Rates, Barriers & outcomes: A. Review paper. WHO. Geneva, Switzerland; 2004. 6. Waddell EN; Messeri PA: Social support, disclosure & use of Anti Retroviral therapy. AIDS behaviour 2006;. 10:263-272. 7. Serovich Jm; Mosack XE: Reasons for HIV disclosure or non-disclosure to causal sexual partners.

  3. The "putative" role of transcription factors from HlWRKY family in the regulation of the final steps of prenylflavonid and bitter acids biosynthesis in hop (Humulus lupulus L.)

    Czech Academy of Sciences Publication Activity Database

    Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Bříza, Jindřich; Siglová, Kristýna; Mishra, Ajay Kumar; Duraisamy, Ganesh Selvaraj; Týcová, Anna; Ono, E.; Krofta, K.


    Roč. 92, č. 3 (2016), s. 263-277 ISSN 0167-4412 R&D Projects: GA ČR GA13-03037S Institutional support: RVO:60077344 Keywords : Lupulin biosynthesis * Transcription factors * 5' RNA degradome * Plant promoter activation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016


    African Journals Online (AJOL)

    Sct., &ttrb. 489. FORBES, J.M., r r. 263. 1969. A notc on the voluntary intake of lactating ewes; milk yield and growth of lambs. Anim. hod. JOI{ANSSON, I., 1962. Gmetic osrycts of fury ottle breding. London: Oliver & Boyd. LE ROUX, P.. 1970. Thc infltrnce of plane of nutrition and seasons of lambing on the production of mutton ...

  5. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva


    Roč. 563, č. 1 (2006), s. 263-267 ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 263 ... Special Edition 2011, Romanticism as a Meeting Point Between the Nigerian Poet and Sculptor, Abstract PDF. CE Nwanna. Vol 17, No 1 (2016), Sexual predators or preys: Inter-racial sexual relationships in Jude Dibia's novels, Abstract PDF. Ifeyinwa Genevieve Okolo. Vol 16, No 1 (2015), Sexuality ...

  7. Fuzzy-logic based learning style prediction in e-learning using web ...

    Indian Academy of Sciences (India)

    humanoid robot. IJCSSE 26(3). Triantafillou E, Pomportsis A and Georgiadou E 2002 AES-CS: Adaptive educational system base on cognitive styles. In: Proceedings AH2002 Workshop, 10–20. Wilges B, Mateus G P, Nassar S M and Bastos R C 2012 Integration of BDI agent with fuzzy logic in a virtual learning environment.

  8. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D K Avasthi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  9. Quo vadis plant hormone analysis?

    Czech Academy of Sciences Publication Activity Database

    Tarkowská, Danuše; Novák, Ondřej; Floková, Kristýna; Tarkowski, P.; Turečková, Veronika; Grúz, Jiří; Rolčík, Jakub; Strnad, Miroslav


    Roč. 240, č. 1 (2014), s. 55-76 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Plant hormones * Extraction * Mass spectrometr Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014

  10. (Zea mays L.) cultivars Maverik and Bora

    African Journals Online (AJOL)



    Oct 5, 2009 ... 35.32. 29.31 pea (Pisum sativum L.) and lentil (Lens culinaris Medik.) .... Kahramanmaraş-Turkey (Tosun, 2005; Celep, 2006). Parameter. July. August September. October November Average. 2004. 29.3. 28.0. 26.3. 21.0. 11.5. 22.7. Temperature. (oC) .... be very based on variety, climate and environment.

  11. human intestinal schistosomiasis in communities living near three ...

    African Journals Online (AJOL)



    Jul 2, 2011 ... load. Snails were collected for identification of Biomphalaria species and then checked for cercarial shading. RESULTS: The prevalence of S. mansoni was 26.3 % with intensity ranging 24 to 936 eggs per gram of stool. Participants in the age .... Attempt was not made to detect non-shedding infection; only ...

  12. C S Sundar

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. C S Sundar. Articles written in Sadhana. Volume 28 Issue 1-2 February-April 2003 pp 263-272. Superconductivity in MgB2 : Phonon modes and influence of carbon doping · A Bharathi Y Hariharan Jemima Balaselvi C S Sundar · More Details Abstract Fulltext PDF. Following a brief overview, ...

  13. Recommendations Concerning Methods and Media Appropriate to Leadership Training and Education at the US Coast Guard Academy. (United States)


    Four-Factor Tehory of Leadership," Administrative Science Quarterly, 1966, 11, 238-263. Herzberg , Frederick . "The Motivation to Work Among Finnish...conditions of subordinates. They reflect the Herzberg A-9 (1965) hygiene factors, and the conventional military category of "welfare of subordinates

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 263 ... Vol 18, No 1 (2017), Über die Morphosyntaktische Struktur von Nominalkomposita im Deutschen und in Yoruba, Abstract PDF. Ezekiel O. Olagunju ... Vol 18, No 2 (2017): Special Edition, Christian Ethics in a Corrupt Society: A Challenge to Christians in Nigeria, Abstract PDF. Friday Ifeanyi Ogbuehi.

  15. Predicting outcome of internet-based treatment for depressive symptoms.

    NARCIS (Netherlands)

    Warmerdam, E.H.; van Straten, A.; Twisk, J.; Cuijpers, P.


    In this study we explored predictors and moderators of response to Internet-based cognitive behavioral therapy (CBT) and Internet-based problem-solving therapy (PST) for depressive symptoms. The sample consisted of 263 participants with moderate to severe depressive symptoms. Of those, 88 were

  16. Download this PDF file

    African Journals Online (AJOL)

    Babalola OE, Rachel Eye Center, PO Box 4108, Garki, Abuja. M ESUGA (MBBS). PKATO YOHANA (RN, Diploma in ... This can often best be achieved through eye camps. Outreach programmes also help to define the extent of .... prescribed eye drops for glaucoma. Ophthalmic Surg 1995;. 26(3): 233-6. Thomas R and ...

  17. Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27

    DEFF Research Database (Denmark)

    Adland, Emily; Hill, Matilda; Lavandier, Nora


    The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...

  18. Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.


    Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015

  19. Simulation nitrogen-limited crop growth with SWAP/WOFOST : process descriptions and user manual

    NARCIS (Netherlands)

    Groenendijk, Piet; Boogaard, Hendrik; Heinen, Marius; Kroes, J.G.; Supit, Iwan; Wit, de Allard


    This report describes a soil nitrogen module (Soil-N), which is combined with the agro-hydrological model, SWAP, and the crop growth model, WOFOST. The core of the Soil-N module is a description of the nitrogen cycle, which is coupled to the organic matter cycle based upon the RothC-26.3 model.

  20. Effect of eucalyptus (Eucalyptus camaldulensis) and maize (Zea ...

    African Journals Online (AJOL)


    Editorial FAN, Bolivia. Soumare et al. 16001. Gareca EE, Martinez YY, Bustamante RO, Aguirre LF, Siles MM (2007). Regeneration patterns of Polylepis subtusalbida growing with the exotic trees Pinus radiata and Eucalyptus globulus at Parque. Nacional Tunari, Bolivia. Plant Ecol. 193:253-263. Hopkinsa AA, Malinowskic ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 263 ... Vol 5, No 2 (2006), Blood glucose level and lipid profile in rats fed on Treculia Africana (Breadfruit) diet: A sub-chronic study, Abstract. OO Okwari, OE Ofem, ... Vol 9, No 2 (2010), Comparative Effect of Fresh, Thermoxidized and Irradiated Oil on Gastric Acid Secretion and Cytoprotection in Rats, Abstract.

  2. Environmental Assessment for Selected Regions in the Mediterranean Sea (United States)


    7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341

  3. Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, Daniel J.; van Buuren, Stef; ter Kuile, Feiko O.; Stasinopoulos, D. Mikis; Rigby, Robert A.; Terlouw, Dianne J.


    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  4. A New Point of View on the Relationship Between Global Solar Irradiation and Sunshine Quantifiers

    Czech Academy of Sciences Publication Activity Database

    Brabec, Marek; Badescu, V.; Dumitrescu, A.; Paulescu, M.


    Roč. 126, March (2016), s. 252-263 ISSN 0038-092X Institutional support: RVO:67985807 Keywords : global solar irradiation * sunshine quantifiers * sunshine number * Angstrom equation * statistical modeling * regression analysis Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 4.018, year: 2016

  5. Alien Pathogens on the Horizon: Opportunities for Predicting their Threat to Wildlife

    Czech Academy of Sciences Publication Activity Database

    Roy, H. E.; Hesketh, H.; Purse, B. V.; Eilenberg, J.; Santini, A.; Sclarea, R.; Stentiford, G. D.; Adriaens, T.; Bacela-Spychalska, K.; Bass, D.; Beckmann, K. M.; Bessell, P.; Bojko, J.; Booy, O.; Cardoso, A.-C.; Essl, F.; Groom, Q.; Harrower, C.; Kleespies, R. G.; Martinou, A. F.; van Oers, M. M.; Peeler, E. J.; Pergl, Jan; Rabitsch, W.; Roques, A.; Schaffner, F.; Schindler, S.; Schmidt, B. R.; Schönrogge, K.; Smith, J.; Solarz, W.; Stewart, A.; Stroo, A.; Tricarico, E.; Turvey, K. M. A.; Vannini, A.; Vila, M.; Woodward, S.; Wynns, A. A.; Dunn, A. M.


    Roč. 10, č. 4 (2017), s. 477-484 ISSN 1755-263X Grant - others:COST(XE) TD1209 Program:FA Institutional support: RVO:67985939 Keywords : horizon scanning * invasions * legislation * wildlife diseases Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016

  6. 75 FR 53966 - Proposed Agency Information Collection Activities; Comment Request (United States)


    ... consumer reporting agencies, policy & procedures, 1,172 financial institutions; irrelevant dispute notices..., including the proposed reporting form and instructions, supporting statement, and other documentation will... for the Deaf (TDD) users may contact (202-263-4869). Proposal to approve under OMB delegated authority...

  7. 77 FR 47841 - Agency Information Collection Activities: Announcement of Board Approval Under Delegated... (United States)


    ... times per year. Reporters: Financial businesses. Estimated annual reporting hours: 60,000 hours... industries on their financial condition (outside of the standardized regulatory reporting process) and... (202) 452-3829. Telecommunications Device for the Deaf (TDD) users may contact (202) 263-4869, Board of...

  8. Endoscopy services in KwaZulu-Natal Province, South Africa, are ...

    African Journals Online (AJOL)

    There were 0.06 registered gastroenterologists (GEs) per 100 000 population. Each endoscopist performed an average of 263 endoscopies per annum. There were 1.18 endoscopy rooms available per unit, and two units had on-site fluoroscopy available. The average waiting period for an upper endoscopy was 27 (range 7 ...

  9. Self-Harm Behaviour in Adolescents: Body Image and Self-Esteem (United States)

    Oktan, Vesile


    This research aimed to reveal the relationship between self-harm behaviour, body image, and self-esteem, and examined whether there was a difference between the body image and self-esteem of the adolescents who exhibited self-harm behaviour and those who did not. The study was conducted with the participation of 263 high school students--143…

  10. Should one be a left or a right Sellarsian? (And is there really such a choice?)

    Czech Academy of Sciences Publication Activity Database

    Peregrin, Jaroslav


    Roč. 47, č. 2 (2016), s. 251-263 ISSN 0026-1068 R&D Projects: GA ČR GA13-20785S Institutional support: RVO:67985955 Keywords : Sellars * normativity * ontology * translation * first-person perspective Subject RIV: AA - Philosophy ; Religion

  11. Challenges of congenital malformations: an African perspective

    African Journals Online (AJOL)


    Apr 2, 2017 ... anomaly screening program in a Nigerian university hospital: redefining obstetrics practice in a developing African country. Niger Med J 2015;. 56:263. 39 Bouman N. The psychosocial adjustment of children with major congenital abdominal anomalies [PhD thesis]. Rotterdam: Erasmus University; 1999.

  12. Data of evolutionary structure change: 1G9OA-2VPHB [Confc[Archive

    Lifescience Database Archive (English)


  13. The ribose and glycine Maillard reaction in the interstellar medium ...

    Indian Academy of Sciences (India)


    aInstituto de Quimica, Universidad Nacional Autonoma de Mexico, Mexico City, Mexico. bFaculty of Engineering, Chiba University, Inage-ku, Chiba 263-8522, Japan e-mail: MS received 26 October 2007; revised 22 December 2007. Abstract. Possibility of the Maillard reaction to take place in the ...

  14. How Do Academic Disciplines Use PowerPoint? (United States)

    Garrett, Nathan


    How do academic disciplines use PowerPoint? This project analyzed PowerPoint files created by an academic publisher to supplement textbooks. An automated analysis of 30,263 files revealed clear differences by disciplines. Single-paradigm "hard" disciplines used less complex writing but had more words than multi-paradigm "soft"…

  15. Sugar beet activities of the USDA-ARS East Lansing conducted in cooperation with Saginaw Valley Bean and Beet Farm during 2011 (including Project 905) (United States)

    Evaluation and rating plots were planted at the Saginaw Valley Research & Extension Center in Frankenmuth, MI in 2011 that focused on Cercospora leaf spot performance, conducted in conjunction with Beet Sugar Development Foundation and including USDA-ARS cooperators. 263 breeding lines were tested i...

  16. Infusion of butyrate affects plasma glucose, butyrate, and ß-hydroxybutyrate but not plasma insulin in lactating dairy cows (United States)

    The objective of this research was to investigate the effects on plasma metabolites and rumen measures when butyrate was infused into the rumen or abomasum of lactating cows. Jugular catheters were inserted into 5 ruminally fistulated Holstein cows (94.2 ± 26.3 days in milk [DIM]; 717 ± 45 kg body w...

  17. New and noteworthy bird records from the Mt. Wilhelm elavational gradient, Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Marki, P. Z.; Sam, Kateřina; Koane, B.; Kristensen, J. B.; Kennedy, J. D.; Jonsson, K. A.


    Roč. 136, č. 4 (2016), s. 263-271 ISSN 0007-1595 R&D Projects: GA ČR(CZ) GP14-32024P Institutional support: RVO:60077344 Keywords : bird records * Mt. Wilhelm * Papua New Guinea Subject RIV: EG - Zoology

  18. Prevalence of musculoskeletal pain and factors associated with ...

    African Journals Online (AJOL)


    heel pain and shoulder pain among teachers was 38.1%,. 26.3%, 24.1% and 20.6% respectively (5). The. Australian rural community study indicated that most common ..... Watson, P. J. on behalf of the Flags Think-Tank. (2009) Tackling musculoskeletal problems: a guide for the clinic and workplace - identifying obstacles.

  19. Egyptian Journal of Medical Human Genetics - Vol 16, No 3 (2015)

    African Journals Online (AJOL)

    Sarcopenic obesity and dyslipidemia response to selective exercise program after liver transplantation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Basha, ZE Mowafy, EA Morsy, 263-268. ...

  20. SCAP gene polymorphisms decrease the risk of nonalcoholic fatty ...

    Indian Academy of Sciences (India)

    5E-institute of Shanghai Municipal Education Commission, Shanghai University of Traditional Chinese Medicine,. Shanghai 201203, People's Republic of China. [Sun S., Wang M., Song H., .... no history of type II diabetes, hypertension, dyslipidaemia and fatty liver, and the remaining 263 individuals had been diagnosed ...

  1. Emotion and Cognition: Attitudes toward Persons Who Are Visually Impaired. (United States)

    Verplanken, B.; And Others


    A survey of the attitudes toward people with visual impairments in rehabilitation agencies or health care centers in the Netherlands received 263 responses from the general public and rehabilitation workers. Analysis supported the usefulness of distinguishing between the emotional and cognitive components of attitudes. Implications for public and…

  2. Microstructural Stability of Dissimilar Weld Joint of Creep -Resistant Steels with Increased Nitrogen Content at 500-900oC

    Czech Academy of Sciences Publication Activity Database

    Zlámal, B.; Foret, R.; Buršík, Jiří; Svoboda, Milan


    Roč. 263, - (2007), s. 195-200 ISSN 1012-0386 Institutional research plan: CEZ:AV0Z20410507 Keywords : creep-resistant steel * weld joint * structural analyses Subject RIV: JG - Metallurgy Impact factor: 0.483, year: 2005

  3. The effect of CoQ10 and vitamin E on serum total sialic acid, lipid ...

    African Journals Online (AJOL)



    Jun 13, 2011 ... Seyrek K, Seyrek-Intas K, Keskin A, Kargın-Kiral F, Musal B, Toplu N. (2005). Biochemical and histochemical studies on the occurrence of sialic acids in mammary tumours of bitches. Res. Med. Vet-Toulouse,. 156: 258-263. Simpson C, Herr H, Courville KA (2004). Concurrent therapies that protect against ...

  4. Environment friendly chemoselective deprotection of acetonides and ...

    Indian Academy of Sciences (India)

    Highly chemoselective environment friendly deprotection of acetonides and cleavage of acetals and ketones has been ... Keywords. Environment friendly; acetonides; chemoselective; aqueous medium; deprotection; acetals. 1. Introduction ... were obtained using a Qtof Micro YA263 instrument. Ethyl acetate was dried over ...

  5. An Investigation into Communication Climate and Staff Efficiency in ...

    African Journals Online (AJOL)

    Nekky Umera

    Using the stratified random sampling technique, 1500 workers were drawn from public and private tertiary institutions i.e .... climate and efficiency of private and public tertiary institutions staff. 5. There is no significant difference .... Vol. 8. No2. Pp. 251-263. Ijaduola, K.O. (2007a). An evaluation of public relations awareness of.

  6. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.


    Roč. 27, - (2003), 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  7. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.


    Roč. 27, - (2003), s. 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910; CEZ:MSM 113100003 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 263 ... Special Edition 2011, Crude Oil, a Blessing and Impediment in Niger Delta Polity: Tanure ojaide's The activist, Abstract PDF. NC Mba ... Vol 17, No 3 (2017), Effect of Painting Series Package on the Performances of Junior Secondary Cultural and Creative Arts in Ogbomoso Nigeria, Abstract PDF.

  9. 21 CFR 73.450 - Riboflavin. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Riboflavin. 73.450 Section 73.450 Food and Drugs... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.450 Riboflavin. (a) Identity. (1) The color additive riboflavin is the riboflavin defined in the Food Chemicals Codex, 3d Ed. (1981), pp. 262-263, which is...

  10. 1222-IJBCS-Article- Ibrahim Alkoiret

    African Journals Online (AJOL)


    Factors affecting stallion semen survival and fertility. In Proc. 10th. Congress on Anim. Repro and AI. Urbana. Champaign, IL USA. (3) 377. Quin PJ, White IG. 1966. The effect of cold shock and deep freezing on the concentration of major cations in spermatozoa. J. Reprod. Fert., 12 : 263-. 270. Salisbury GW, Vandemark NL.

  11. Over-wintering Daphnia: uncoupling the effects of temperature and food on offspring size and filtering screen morphology in D. galeata

    Czech Academy of Sciences Publication Activity Database

    Macháček, Jiří; Seďa, Jaromír


    Roč. 35, č. 5 (2013), s. 1069-1079 ISSN 0142-7873 R&D Projects: GA ČR(CZ) GA206/09/1325 Institutional support: RVO:60077344 Keywords : Daphnia size * filtering screens * phenotypic plasticity * embryonic induction * temperature effect Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.263, year: 2013

  12. Complementation of sweet corn mutants: a method for grouping ...

    Indian Academy of Sciences (India)

    Vivekananda Parvatiya Krishi Anusandhand Sansthan (VPKAS), Almora 263601, India; Division of Genetics, Indian Agricultural Research Institute, New Delhi 110 012, India; Department of Genetics and Plant Breeding, Govind Ballabh Pant University of Agriculture and Technology, Pantnagar 263 145, India; Indian Council ...

  13. Cross-Cultural Comparison of Anxiety Symptoms in Colombian and Australian Children (United States)

    Amaya, Andrea Crane; Campbell, Marilyn


    Introduction: This cross-cultural study compared both the symptoms of anxiety and their severity in a community sample of children from Colombia and Australia. Method: The sample comprised 516 children (253 Australian children and 263 Colombian children), aged 8 to 12-years-old. The Spence Children's Anxiety Scale (SCAS) was used to measure both…

  14. A Century of Change: The Evolution of School Library Resources, 1915-2015 (United States)

    Lamb, Annette


    School libraries have been in existence since at least the eighth century. However, it wasn't until the twentieth century that the school library was seen primarily as "a source of enrichment for the curriculum, and a means of developing reading and study habits in the pupils" (Clyde 1981, 263). While the formats available and tools for…

  15. 3-D Imaging Using Row-Column-Addressed Arrays With Integrated Apodization

    DEFF Research Database (Denmark)

    Christiansen, Thomas Lehrmann; Rasmussen, Morten Fischer; Bagge, Jan Peter


    This paper demonstrates the fabrication, characterization, and experimental imaging results of a 62+62 element λ/2-pitch row-column-addressed capacitive micromachined ultrasonic transducer (CMUT) array with integrated apodization. A new fabrication process was used to manufacture a 26.3 mm by 26...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 263 ... Vol 9, No 2 (2010), Predisposing Factors to Pityriasis Versicolor in Primary School Pupils in Remo Land, Ogun State, Nigeria, Abstract. HI Effedua, BO Adefuye, CA Inyaniwura, AM Deji-Agboola, AA Oluwadun. Vol 5, No 2 (2006), Predisposition of Nigerian children with severe malaria to urinary tract ...

  17. Discovery of SM Higgs Boson in ATLAS Experiment

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  18. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Rakshit. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  19. Genetic polymorphisms in DNA repair and oxidative stress pathways may modify the association between body size and postmenopausal breast cancer

    Czech Academy of Sciences Publication Activity Database

    McCullough, L. E.; Eng, S. M.; Bradshaw, P. T.; Cleveland, R. J.; Steck, S. E.; Terry, M. B.; Shen, J.; Crew, K.D.; Rössner ml., Pavel; Ahn, J.; Ambrosone, Ch.B.; Teitelbaum, S. L.; Neugut, A. I.; Santella, R. M.; Gammon, M. D.


    Roč. 25, č. 4 (2015), s. 263-269 ISSN 1047-2797 Institutional support: RVO:68378041 Keywords : breast cancer * body mass index * oxidative stress * DNA repair * Epidemiology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.335, year: 2015

  20. Profile of children with cerebral palsy attending outpatient ...

    African Journals Online (AJOL)

    Jaundice (39.9%), asphyxia (26.8%) and infection (17.4%) were the leading causes of CP and spastic CP was the most common type (81.7%). Quadriplegic CP presentation was predominant (67.1%), and leading co-morbidities were mental retardation (31%) and speech impairment (26.3%). About 50% of the children ...

  1. 26 CFR 1.162-28 - Allocation of costs to lobbying activities. (United States)


    ... administrative department costs (for example, payroll, personnel, and accounting). (d) Ratio method—(1) In... allocation. Following the amendments to section 162(e), Y adopts its 263A step-allocation methodology to... research, preparation, and other background activities related to direct contact lobbying but who does not...

  2. An Investigation into the Self-Handicapping Behaviors of Undergraduates in Terms of Academic Procrastination, the Locus of Control and Academic Success (United States)

    Akça, Figen


    The aim of this study was to investigate the relationship between self-handicapping, academic procrastination, the locus of control and academic success. The aim was also to determine whether these variables predicted self-handicapping behavior. The population of the study consisted of 263 undergraduates studying in different departments of the…

  3. Interstrain differences in cognitive functions in rats in relation to status epilepticus

    Czech Academy of Sciences Publication Activity Database

    Hort, J.; Brožek, Gustav; Komárek, V.; Langmeier, M.; Mareš, Pavel


    Roč. 112, - (2000), s. 77-83 ISSN 0166-4328 R&D Projects: GA MZd IZ2904; GA MZd IZ3510; GA AV ČR KSK2011602 Grant - others:GA UK(XC) 25/1966 Subject RIV: ED - Physiology Impact factor: 2.263, year: 2000

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 263 ... Vol 2, No 2 (2003), Aqueous extract of the Bark of Kigelia africana reverses early testicular damage induced by methanol extract of Carica Papaya, Abstract. AIR Abioye, FIO Duru, CC Noronha, AO Okanlawon. Vol 2, No 1 (2003), Ascorbic Acid and Beta-Carotene Alleviate Oxidative Effect of London King ...

  5. Review of adult head injury admissions into the intensive care unit of ...

    African Journals Online (AJOL)

    The most common mode of injury was road traffic accident. All the patients admitted to ICU had either moderate or severe head injury, with 73.7% having severe head injury. About 26.3% of the patients had associated cervical spine injuries and 50% had various musculoskeletal and soft tissue injuries. Cranial computed ...

  6. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Author Affiliations. B. Rani1 Alok C. Gupta1 Paul J. Wiita2. Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital 263 129, India. Department of Physics, The College of New Jersey, P.O. Box 7718, Ewing, NJ 08628, USA.

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 237-243 Invited Papers. Direct angle resolved photoemission spectroscopy and superconductivity of strained high-c films ... pp 263-270 Invited Papers. A first-principles study of phase transitions in ultrathin films of BaTiO3 .... Some unusual electronic patterns on graphite surface · Shyam K Choudhury Anjan K Gupta.

  8. probing the cob(ii)alamin conductor hypothesis with glutamate ...

    African Journals Online (AJOL)


    Glutamate mutase activity was also demonstrated upon incubation of GlmS and E with 3',5'- ... overproduced in E.coli (Huhta et al. 2001,. Huhta et ..... Biochemistry. 37: 9704-9715. Buckel W 2001 Unusual enzymes involved in five pathways of glutamate fermentation. Appl. Microbiol. Biotechnol. 57: 263-273. Buckel W and ...

  9. Askey, Prof. Richard Allen

    Indian Academy of Sciences (India)

    Fellow Profile. Elected: 1988 Honorary. Askey, Prof. Richard Allen. Date of birth: 4 June 1933. Address: 5915, American Parkway, Apt. 228, Madison, WI 43718, U.S.A.. Contact: Office: (+1-608) 262 2880. Residence: (+1-608) 233 7900. Fax: (+1-608) 263 8891. Email: YouTube; Twitter; Facebook ...

  10. Reproductive ecology and egg production of the radiated tortoise ...

    African Journals Online (AJOL)

    We captured and marked 1438 radiated tortoises of which 26% were adults. Mating and nesting coincided with the rainy season, and mating events peaked in December, shortly before females started nesting in January. The incubation period was approximately 263–342 days, and hatchlings emerged after the onset of the ...

  11. Dietary determination of stunting and anaemia among pre ...

    African Journals Online (AJOL)

    children in the province of Kenitra (Morocco). A stratified random sample of 263 pupils with average age of 12.9 ± 0.9 years including one-third from rural schools were administered a weekly food frequency questionnaire. A health team assessed the anthropometric status and blood haemoglobin levels. Dietary diversity was ...

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. JITENDRA B NAIK. Articles written in Bulletin of Materials Science. Volume 40 Issue 2 April 2017 pp 263-270. Design and development of sustained-release glyburide-loaded silica nanoparticles · JAYESH S PATIL PRITAM B PATIL PRAVIN SONAWANE JITENDRA B NAIK.

  13. Contribution to the knowledge of ptyctimous mites (Acari: Oribatida) from Madagascar

    Czech Academy of Sciences Publication Activity Database

    Niedbala, W.; Starý, Josef


    Roč. 59, č. 4 (2013), s. 337-345 ISSN 1217-8837 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : oribatid mites * new species * Mahunka * Phthiracaroidea * Euphthiracaroidea Subject RIV: EG - Zoology Impact factor: 0.263, year: 2013

  14. Experiment list: SRX691796 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX691796 mm9 TFs and others Epitope tags Neural Neuro-2a Tissue=Brain|Cell Type=Neuroblast|Disease=Neurobla...stoma 12696256,79.9,26.4,263 GSM1496576: N2A noED S2 rep1; Mus musculus; ChIP-Seq s

  15. Oenothera coronifera, a new alien species for the Czech flora, and Oenothera stricta, recorded again after nearly two centuries

    Czech Academy of Sciences Publication Activity Database

    Mihulka, Stanislav; Pyšek, Petr; Pyšek, A.


    Roč. 75, - (2003), s. 263-270 ISSN 0032-7786 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/1239 Institutional research plan: CEZ:AV0Z6005908 Keywords : alien plants * casual occurrence * Oenothera Subject RIV: EF - Botanics

  16. Carbachol and acetylcholine delay the early postdenervation depolarization of muscle fibres through M1-cholinergic receptors

    Czech Academy of Sciences Publication Activity Database

    Urazaev, A.; Naumenko, N.; Malomough, A.; Nikolsky, E.; Vyskočil, František


    Roč. 37, č. 4 (2000), s. 255-263 ISSN 0168-0102 R&D Projects: GA AV ČR(CZ) IAA7011902 Institutional research plan: CEZ:AV0Z5011922 Keywords : acetylcholine * M1 Subject RIV: ED - Physiology Impact factor: 1.807, year: 2000

  17. 76 FR 23907 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Queen Conch Fishery of Puerto... (United States)


    ..., Gulf of Mexico, and South Atlantic; Queen Conch Fishery of Puerto Rico and the U.S. Virgin Islands..., 263 13th Avenue South, St. Petersburg, FL 33701 or may be downloaded from the Southeast Regional... approximately $39,000. Even this value, as an extreme upper bound for average revenues for St. Croix fishermen...

  18. Periodic solutions to second-order indefinite singular equations

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Zamora, M.


    Roč. 263, č. 1 (2017), s. 451-469 ISSN 0022-0396 Institutional support: RVO:67985840 Keywords : degree theory * indefinite singularity * periodic solution * singular differential equation Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.988, year: 2016

  19. Localization of MHC class II/human cartilage glycoprotein-39 complexes in synovia of rheumatoid arthritis patients using complex-specific monoclonal antibodies

    NARCIS (Netherlands)

    Steenbakkers, Peter G. A.; Baeten, Dominique; Rovers, Eric; Veys, Eric M.; Rijnders, Antonius W. M.; Meijerink, Jan; de Keyser, Filip; Boots, Annemieke M. H.


    Recently human cartilage gp-39 (HC gp-39) was identified as a candidate autoantigen in rheumatoid arthritis (RA). To further investigate the relevance of this Ag in RA, we have generated a set of five mAbs to a combination epitope of complexes of HC gp-39(263-275) and the RA-associated DR alpha beta

  20. Core-Collapse Supernovae and Gamma-Ray Bursts in TMT Era SB ...

    Indian Academy of Sciences (India)

    Core-Collapse Supernovae and Gamma-Ray Bursts in TMT Era. S. B. Pandey. Aryabhatta Research Institute of Observational Sciences, Manora Peak,. Nainital 263 129, India. e-mail: Received 8 May 2013; accepted 25 June 2013. Abstract. Study of energetic cosmic explosions as a part of time domain.

  1. Satellite and Missile Data Generation for AIS. (United States)


    LAUNCHED FROM BETELGEUSE TO RIGEL 23 JULY 1987.* 2.6.3 The KWIC Concordance. Next, the sanitized data is put into a machine readable form and processed...M-67 Is the name of a galactic cluster in the Cancer constellation. UM-67 is a fictitious name. Betelgeuse and Rigel are stars in the Orion

  2. Markets and medicine: the politics of health care reform in Britain, Germany, and the United States

    National Research Council Canada - National Science Library

    Giaimo, Susan


    ...: The Limits of Markets in Health Care 193 Appendix: Information on Interviews and Methodology 225 Notes 233 Bibliography 263 Index 293 List of TablesTables I. Physicians' Earnings Relative to Other Occupations in the United Kingdom, Germany, and the United States, 1965-92 13 2. Physicians' Mean Gross Income in the United Kingdom, Germany, and...

  3. File list: Oth.Dig.05.AllAg.Caco-2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.05.AllAg.Caco-2 hg19 TFs and others Digestive tract Caco-2 SRX026264,SRX026...263,SRX080352,SRX080411,SRX026268,SRX026267,SRX886445,SRX886446,SRX026266,SRX026265 ...

  4. File list: Oth.Dig.10.AllAg.Caco-2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.10.AllAg.Caco-2 hg19 TFs and others Digestive tract Caco-2 SRX026264,SRX026...263,SRX080352,SRX080411,SRX026268,SRX886445,SRX886446,SRX026266,SRX026267,SRX026265 ...

  5. Pharmacogenetic Analysis of Captopril Effects on Blood Pressure: Possible Role of the Ednrb (Endothelin Receptor Type B) Candidate Gene

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef; Dobešová, Zdenka; Zídek, Václav; Šilhavý, Jan; Šimáková, Miroslava; Mlejnek, Petr; Vaněčková, Ivana; Kuneš, Jaroslav; Pravenec, Michal


    Roč. 63, č. 2 (2014), s. 263-265 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LH11049 Institutional support: RVO:67985823 Keywords : captopril * blood pressure * QTL * Ednrb gene * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.293, year: 2014

  6. Edward U Lorenz

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  7. Female Muslim students' dress practices in a South African campus

    African Journals Online (AJOL)


    roots in South-East Asia and North Africa. (Hassan, 2011:170). African Muslims are dispersed across Kwazulu-Natal, Gauteng and the Western Cape and originated from African countries including the Democratic Republic of. Congo, Malawi and Mozambique (Vahed &. Jeppie, 2005:263). Ferraro (2001:22) defines culture ...

  8. Long-term monitoring of native bullhead and invasive gobiids in the Danubian rip-rap zone

    Czech Academy of Sciences Publication Activity Database

    Janáč, Michal; Roche, Kevin Francis; Šlapanský, Luděk; Polačik, Matej; Jurajda, Pavel


    Roč. 807, č. 1 (2018), s. 263-275 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Competition * Fish population structure * Invasive species impact * Ponto–Caspian gobies * River bank stabilisation Subject RIV: EG - Zoology Impact factor: 2.056, year: 2016

  9. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. A. Pirya1 S. Nandi1 D. J. Saikia2 C. Konar3 M. Singh1. Aryabhatta Research Institute of Observational Sciences, Manora Peak, Nainital 263 129, India. National Centre for Radio Astrophysics, Pune University Campus, Post Bag 3, Pune 411 007, India. ASIAA, Taipei 10617, Taiwan, Republic of China.

  10. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Institute of Astronomy and Astrophysics, AS, Taipei 10617, Taiwan. Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30244 Kraków, Poland. University of Hertfordshire, College Lane, Hatfield, UK. University of Southampton, Southampton SO17 1BJ, UK. ARIES, Manora Peak, Nainital 263 ...

  11. Dynamic coupling between heart rate and ventricular repolarisation

    Czech Academy of Sciences Publication Activity Database

    Halámek, Josef; Jurák, Pavel; Villa, M.; Souček, M.; Fráňa, P.; Nykodym, J.; Eisenberger, M.; Leinveber, P.; Vondra, Vlastimil; Somers, V. K.; Kára, T.


    Roč. 52, č. 3 (2007), s. 255-263 ISSN 0013-5585 R&D Projects: GA ČR(CZ) GA102/05/0402 Institutional research plan: CEZ:AV0Z20650511 Keywords : QT/RR coupling * transfer function Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 0.593, year: 2007

  12. The Double–Double Radio Galaxy 3C293

    Indian Academy of Sciences (India)

    S. A. Joshi1 S. Nandi2 D. J. Saikia1 C. H. Ishwara-Chandra1 C. Konar3. National Centre for Radio Astrophysics, Pune University Campus, Pune 411 007, India. Aryabhatta Research Institute of Observational Sciences, Manora Peak, Nainital 263 129, India. Institute of Astronomy and Astrophysics, AS, Taipei 10617, Taiwan.

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  14. G Chandramohan Reddy

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...

  15. occidentale L.) Production in Ghana

    African Journals Online (AJOL)

    Paper N0. 263. EMBRAPA. (1993). Empresa Brasileira de. Pesquisa Agropecuriaz Centro Nacional de. Pesquisa de Agroindustria Tropical. Circular. Tecnica.Numero01Abril l993.p. 15. Irvine, F. R. (1961). Wooay Plants of Ghana. pp. 552 - 553. Liondon: Oxford University Press. ISSS—FAO—ISRIC (1998). World Reference.

  16. Ultrastructure of the mature spermatozoon of Eubothrium rugosum (Batsch, 1786) with a re-assessment of the spermatozoon ultrastructure of Eubothrium crassum (Bloch, 1779) (Cestoda: Bothriocephalidea)

    Czech Academy of Sciences Publication Activity Database

    Bruňanská, M.; Fagerholm, H. P.; Nebesářová, Jana; Kostič, B.


    Roč. 47, č. 4 (2010), s. 257-263 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : ultrastructure * spermatozoon * Eubothrium * Bothriocephalidea * Cestoda Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.847, year: 2010

  17. Relativistic hypernuclei: old problems and new prospects

    Czech Academy of Sciences Publication Activity Database

    Majling, Lubomír; Lukstins, J.; Parfenov, AN.; Chren, D.; Solar, M.; Sopko, B.


    Roč. 53, č. 8 (2003), s. 667-677 ISSN 0011-4626 R&D Projects: GA ČR GA202/02/0930; GA AV ČR KSK1048102 Keywords : quantum wave -guides * Schrödinger-operators * Dirichlet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.263, year: 2003

  18. The Best and the Rest: Revisiting the Norm of Normality of Individual Performance (United States)

    O'Boyle, Ernest, Jr.; Aguinis, Herman


    We revisit a long-held assumption in human resource management, organizational behavior, and industrial and organizational psychology that individual performance follows a Gaussian (normal) distribution. We conducted 5 studies involving 198 samples including 633,263 researchers, entertainers, politicians, and amateur and professional athletes.…

  19. Response of maize (Zea mays L.) to combined application of ...

    African Journals Online (AJOL)



    Nov 4, 2015 ... farmyard manure, poultry manure and nitrogen for Corn (Zea mays. L.) productivity. Int. J. Agric. Biol. 6(2):260-263. Makinde EA, Ayoola AA (2008). Residual influence of early season crop fertilization and cropping systems on growth and yield of cassava. Amer. J. Agric. Biol. Sci. 3(4): 712-715. PME (2013).

  20. Isotope exchange study of the dissociation of metal - humic substance complexes

    Czech Academy of Sciences Publication Activity Database

    Mizera, J.; Jansová, A.; Hvoždová, I.; Beneš, P.; Novák, František


    Roč. 53, A (2003), s. A97-A101 ISSN 0011-4626 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 210000019 Keywords : isotope exchange * dissociation of metal * humic substance complexes Subject RIV: EH - Ecology, Behaviour Impact factor: 0.263, year: 2003

  1. Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen


    Roč. 2012, Prosinec (2013), s. 263-265 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy

  2. Large-basis no-core shell model

    Czech Academy of Sciences Publication Activity Database

    Barrett, BR.; Navrátil, Petr; Vary, J. P.


    Roč. 704, č. 17 (2002), s. 254C-263C ISSN 0375-9474 Institutional research plan: CEZ:AV0Z1048901 Keywords : monte-carlo calculations * light-nuclei * cross-sections * ground-state * C12 * systems Subject RIV: BE - Theoretical Physics Impact factor: 1.568, year: 2002

  3. Parnassiana nova : LI. Bemerkungen über Parnassius in den Karpathen und der Tschechoslowakei

    NARCIS (Netherlands)

    Eisner, C.; Zelný, J.


    Parnassius mnemosyne mesoleucus Fruhstorfer, natio gynaecotropaintensa (natio nova) Zelný (1956) hat in seinen Arbeiten „Parnassius mnemosyne mesoleucus Fruhstorfer aus der Kleinen Fatra" (Zeitschrift der Wiener Entomologischen Gesellschaft, 41: 257-263) sich ausführlich über die in den

  4. Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal

    Czech Academy of Sciences Publication Activity Database

    Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin


    Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012

  5. Urban residence and higher education do not protect against cognitive decline in aging and dementia : 10-Year follow-up of the Canadian Study of Health and Aging

    NARCIS (Netherlands)

    Helmes, Edward; van Gerven, Pascal W.M.


    The construct of cognitive reserve has primarily been defined in terms of a single proxy measure, education. There may, however, be alternative, potentially additive, proxy measures of cognitive reserve, such as rural or urban residence. Using a large sample of 10,263 older Canadians, ranging in age

  6. AcEST: DK944889 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 27-F10, full insert seque... 264 2e-69 tr|Q40093|Q40093_IPONI PNIL34 OS=Ipomoea nil GN=PNIL 34 PE=2 SV=1 263...LVY 487 VKNL+R+P Y M P++SGSVD AEFEPQLVY Sbjct: 367 VKNLKRIPHVAALVSEIIAAYLMPPIESGSVDFAEFEPQLVY 408 >tr|Q40093|Q40093_IPONI PNIL34

  7. Modification of jet-like correlations in Pb-Au collisions at 158A GeV/c

    Czech Academy of Sciences Publication Activity Database

    Adamová, Dagmar; Agakichiev, G.; Antonczyk, D.; Appelshäuser, H.; Belaga, V.; Bielčíková, Jana; Braun-Munzinger, P.; Busch, O.; Cherlin, A.; Damjanović, S.; Dietel, T.; Dietrich, L.; Drees, A.; Dubitzky, W.; Esumi, S.I.; Filimonov, K.; Fomenko, K.; Fraenkel, Z.; Garabatos, C.; Glassel, P.; Holeczek, J.; Kalisky, M.; Kniege, S.; Kushpil, Vasilij; Maas, A.; Marin, A.; Milosevic, J.; Milov, A.; Miskowiec, D.; Panebrattsev, Y.; Petchenova, O.; Petráček, Vojtěch; Pfeiffer, A.; Ploskon, M.; Rak, Jan; Ravinovich, I.; Rehak, P.; Sako, H.; Schmitz, W.; Schuchmann, S.; Sedykh, S.; Shimansky, S.; Stachel, J.; Šumbera, Michal; Tilsner, H.; Tserruya, I.; Wessels, J. P.; Wienold, T.; Wurm, J.P.; Xie, W.; Yurevich, S.; Yurevich, V.


    Roč. 678, č. 3 (2009), s. 259-263 ISSN 0370-2693 Institutional research plan: CEZ:AV0Z10480505 Keywords : QUARK-GLUON PLASMA * RADIATIVE ENERGY-LOSS * COLLABORATION Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.083, year: 2009

  8. TherapeuTic hypoThermia afTer peri-inTervenTional in-hospiTal ...

    African Journals Online (AJOL)


    Apr 4, 2011 ... anaesthesiology and postoperative intensive care medicine, university hospital of cologne, Kerpener strasse 62,. 50937 Köln, Germany ... Subjects: seven patients admitted to the intensive care unit after peri-interventional. IHCA between ..... morbidly obese (263 kg body weight, 196 cm, Bmi. 68 kg/m2) and ...

  9. Onchocerciasis Amongst Children Of An Endemic Community In ...

    African Journals Online (AJOL)

    Onchocerciasis among 278 children (0-15yrs) of Ekpan village, a hyperendemic community in Uhunmwode Local Government Area of Edo State, Nigeria was investigated using the prevalence of nodules as index. The overall prevalence of palpable nodules was 26.3%. Nodule prevalence increased with age and the ...

  10. Goal-Oriented hp-Adaptivity for Elliptic Problems

    Czech Academy of Sciences Publication Activity Database

    Šolín, Pavel; Demkowicz, L.


    Roč. 193, 6-8 (2004), s. 449-468 ISSN 0045-7825 R&D Projects: GA ČR GP102/01/D114 Keywords : hp-finite elements * hp-adaptivity * Dual problem Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.263, year: 2004

  11. The Temporal and Scalar Mechanics of Conflict: Strategic Implications of Speed and Time on the American Way of War (United States)


    if technology artificially creates an alternative information tunnel that traverses normal space-time, bypassing the standard flow of information and...263-268. Quantum physics and special relativity theorizes the possibility of “ wormholes ” which are bridges or tunnels providing a shortcut through one

  12. Social aspects of conservation in the Eastern Arc Mountain forests ...

    African Journals Online (AJOL)

    Social aspects of conservation in the Eastern Arc Mountain forests. CSL Chachage. Abstract. Journal of East African Natural History Vol. 87 (1&2) 1998: 253-263. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  13. Intertextualita a její podíl na vyjednávání pozic účastníků talk show

    Czech Academy of Sciences Publication Activity Database

    Čmejrková, Světla; Hoffmannová, Jana


    Roč. 73, č. 4 (2012), s. 263-284 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : political discourse * intertextuality * talk shaw * polyphony * irony * parody Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012

  14. Industrial-scale process control by means of electrostatics probes

    Czech Academy of Sciences Publication Activity Database

    Špatenka, P.; Brunnhofer, Václav; Krumeich, J.; Blažek, J.; Šerý, M.; Endres, H. J.; Cook, R.


    Roč. 5, - (2001), s. 255-263 ISSN 1084-0184 R&D Projects: GA ČR GA202/00/1592; GA MŠk OC 527.60 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  15. 278----9 Dec 2009 [FINAL VERSION].indd

    African Journals Online (AJOL)


    Dec 9, 2009 ... Bakhtin, M.M., 1984, Problems of Dostoyevsky's poetics, University of Minnesota Press, Minneapolis. Berlin, A., 2002, Lamentations: A commentary, Westminster John. Knox Press, Louisville. Vol. 65 No. 1 Page 7 of 7. 263. Brooks, C. & Warren, R.P., 1976, Understanding poetry, Holt,. Rinehart and Winston ...

  16. 77 FR 65256 - IFR Altitudes; Miscellaneous Amendments (United States)


    ... FIX DAIFE, IN FIX 18000 45000 DAIFE, IN FIX NOLNN, OH FIX 18000 45000 From To MEA Sec. 95.6001 VICTOR... FEDERAL AIRWAY V263 Is Amended To Read in Part HUGO, CO VOR/DME *LIMEX, CO FIX **10000 *10000--MRA **8500...

  17. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. INDRANIL BISWAS. Articles written in Proceedings – Mathematical Sciences. Volume 111 Issue 3 August 2001 pp 263-269. Stability of Picard Bundle Over Moduli Space of Stable Vector Bundles of Rank Two Over a Curve · Indranil Biswas Tomás L Gómez.

  18. The Relationship between EFL Learners' Language Learning Strategy Use and Achievement (United States)

    Balci, Özgül; Ügüten, Selma Durak


    The primary purpose of this study was to examine the relationship between language learning strategy use and foreign language achievement, focusing on differences in gender. A total of 263 English as a foreign language students enrolled in English preparatory class program at Necmettin Erbakan University, School of Foreign Languages participated…

  19. Jiecai Han

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Jiecai Han. Articles written in Bulletin of Materials Science. Volume 25 Issue 4 August 2002 pp 263-266 Synthesis. Self-propagating high temperature synthesis and magnetic properties of Ni0.35Zn0.65Fe2O4 powders · Yao Li Jiupeng Zhao Jiecai Han · More Details Abstract ...

  20. 45 CFR 260.30 - What definitions apply under the TANF regulations? (United States)


    ... meaning specified at § 263.0(b) of this chapter. Adult means an individual who is not a “minor child,” as... Mayor of the District of Columbia. IEVS means the Income and Eligibility Verification System operated... participation rates. It means, for a month, a State where: (1)(i) The average rate of total unemployment...

  1. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Kaijing Zuo. Articles written in Journal of Biosciences. Volume 31 Issue 2 June 2006 pp 255-263 Articles. Overexpression of GbERF confers alteration of ethylene-responsive gene expression and enhanced resistance to Pseudomonas syringae in transgenic tobacco · Jie Qin Kaijing ...

  2. 17 CFR 200.30-5 - Delegation of authority to Director of Division of Investment Management. (United States)


    ... that are principally engaged in the development or exploitation of inventions, technological... of the Commission pursuant to sections 5318A(a)(4), 5318A(e)(2) and 5318(h)(2) of the Bank Secrecy....263, and §§ 230.651-230.703(T) of this chapter as that delegated to each Regional Director in § 200.30...

  3. 76 FR 81128 - Guidance Regarding Deduction and Capitalization of Expenditures Related to Tangible Property (United States)


    ...-BE18 Guidance Regarding Deduction and Capitalization of Expenditures Related to Tangible Property... accounting for, and dispositions of, property subject to section 168. The temporary regulations also amend..., DC. FOR FURTHER INFORMATION CONTACT: Concerning the proposed regulations under sections 162 and 263...

  4. 78 FR 23631 - Notice of Final Federal Agency Actions on Proposed Highway in California (United States)


    ... Lake County with NEPA oversight being conducted by the State of California. The project takes place in Lake County, immediately adjacent to the town of Lakeport on South Main Street and Soda Bay Rd. Those... County: Lars Ewing, Assistant Public Works Director, telephone (707) 263-2341, email Lars.Ewing...

  5. 8 CFR 265.1 - Forms. (United States)


    ... for those exempted by section 263(b) of the Act, all aliens in the United States required to register under section 262 of the Act shall report each change of address and new address within 10 days on Form... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Forms. 265.1 Section 265.1 Aliens and...

  6. Data of evolutionary structure change: 1APXA-6CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-6CCPA 1APX 6CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...ine>PRO CA 323 PRO CA 267 GLU CA 263 6CCP... A 6CCPA RVDTPEDTTPDN ...ex> 6CCP A 6CCPA YED...389602661133 3.6602940559387207 2 6CCP

  7. Data of evolutionary structure change: 1APXA-5CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-5CCPA 1APX 5CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...ine>PRO CA 323 PRO CA 267 GLU CA 263 5CCP... A 5CCPA RVDTPEDTTPDN ...ex> 5CCP A 5CCPA YED...4090881347656 3.6460940837860107 2 5CCP

  8. Data of evolutionary structure change: 1APXA-7CCPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1APXA-7CCPA 1APX 7CCP A A ----GKSYPTVSPDYQKAIEKAKRKLRGFIAEKK-----...e> PRO CA 323 PRO CA 267 GLU CA 263 7CCP... A 7CCPA RVDTPEDTTPDN 7CCP A 7CCPA Y...34991455078 3.6459429264068604 2 7CCP

  9. Isolation and characterization of microsatellite DNA loci from Sillago ...

    Indian Academy of Sciences (India)

    species, Sillago sinica (Perciformes: Sillaginidae), from coastal waters of China. Zool. Stud. 50, 254–263. Lee C.-S., Hu F. and Hirano R. 1981 Salinity tolerance of fertilized eggs and larval survival in the fish Sillago sihama. Mar. Ecol. Prog. Ser. 4, 169–174. Lu Z.-B., Chen X. and Du J.-G. 2008 The population dynamics.

  10. Fungal diversity in sandstone gorges of the Bohemian Switzerland National Park (Czech Republic): impact of climatic inversion

    Czech Academy of Sciences Publication Activity Database

    Holec, J.; Wild, Jan


    Roč. 63, č. 2 (2011), s. 243-263 ISSN 1211-0981 R&D Projects: GA TA ČR TA01021283 Institutional research plan: CEZ:AV0Z60050516 Keywords : mycromycetes * ecology * microclimate * breal-montane fungi Subject RIV: EF - Botanics

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. J P Bhatt. Articles written in Journal of Biosciences. Volume 26 Issue 2 June 2001 pp 253-263 Articles. Ovarian steroid sulphate functions as priming pheromone in male Barilius bendelisis (Ham.) J P Bhatt M S Sajwan · More Details Abstract Fulltext PDF. The study reveals that ...

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. K. M. Hiremath. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 263-264 Session V – Vector Magnetic Fields, Prominences, CMEs & Flares. Emergence of Twisted Magnetic Flux Related Sigmoidal ...

  13. Self-Regulation in Early Adolescence: Relations with Mother-Son Relationship Quality and Maternal Regulatory Support and Antagonism (United States)

    Moilanen, Kristin L.; Shaw, Daniel S.; Fitzpatrick, Amber


    The purpose of the current investigation was to examine relations among maternal regulatory support, maternal antagonism, and mother-son relationship quality in relation to boys' self-regulation during early adolescence. As part of a larger longitudinal study on 263 low-income, ethnically diverse boys, multiple informants and methods were used to…

  14. 78 FR 1570 - Semiannual Regulatory Agenda (United States)


    ... Transformers (energy efficiency standards) Residential clothes washers (energy efficiency standards... Distribution Transformers (Reg Plan Seq No. 32). 263 Test Procedures for 1904-AC76 Residential Refrigerators... Efficiency Standards for Distribution Transformers Regulatory Plan: This entry is Seq. No. 32 in part II of...

  15. A survey of aphid parasitoids in Kahramanmaras, Turkey (Hymenoptera: Braconidae, Aphidiinae, and Hymenoptera: Aphelinidae)

    Czech Academy of Sciences Publication Activity Database

    Aslan, M. M.; Uygun, N.; Starý, Petr


    Roč. 32, č. 3 (2004), 255-263 ISSN 0334-2123 R&D Projects: GA AV ČR(CZ) IAA6007105; GA AV ČR(CZ) IBS5007102 Institutional research plan: CEZ:AV0Z5007907 Keywords : parasitoids Subject RIV: EG - Zoology Impact factor: 0.543, year: 2004

  16. 21 CFR 522.460 - Cloprostenol sodium. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Cloprostenol sodium. 522.460 Section 522.460 Food... Cloprostenol sodium. (a)(1) Specifications. Each milliliter of the aqueous solution contains 263 micrograms of cloprostenol sodium (equivalent to 250 micrograms of cloprostenol) in a sodium citrate, anhydrous citric acid...

  17. 16Nomads in the shadows of empires

    African Journals Online (AJOL)

    different in terms of their social structure and psychological makeup. However, they used to have a ... empires extended their influence over these ethnic groups in southern Ethiopia and. Kenya, there was quite ... adopted a liberal outlook in dealing with sophisticated social and cultural issues. 263The gabbar system of ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 263 ... Vol 5, No 1 (2006), Refractive errors in school children in Onitsha, Nigeria, Abstract. SNN Nwosu, IU Alozie. Vol 1, No ... CI Udoye, OA Olusile, AO Oginni. Vol 6, No 1 (2007), Safety Awareness in Selected X-ray Diagnostic Centres in Surulere and Ikeja Local Government Areas of Lagos State, Nigeria.

  19. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Mechanical behaviour of aluminium-lithium alloys · N Eswara ... In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma .... Indigenous development and airworthiness certification of 15–5 PH precipitation hardenable stainless steel for aircraft applications.

  20. Interkulturní boj o uznání

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek


    Roč. 57, č. 2 (2009), s. 263-269 ISSN 0015-1831 R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : intercultural dialogue * recognition Subject RIV: AA - Philosophy ; Religion

  1. methods for synthesis of β-aryl-β-mercaptoketones over anhydrous ...

    Indian Academy of Sciences (India)

    1H and 13C Nuclear Magnetic Resonance (NMR) spec- tra were obtained in CDCl3 on a Bruker AV-300. (300 MHz) spectrometer using tetramethylsilane as an internal standard. Mass spectrum was acquired on a Waters QTOF Micro YA263 Mass Spectrometer. Analytical samples were dried in vacuo at room temperature.

  2. FeCl3-catalysed Zn-mediated allylation of cyclic enol ethers in water

    Indian Academy of Sciences (India)

    For correspondence nal standard on 300 and 75 MHz spectrometer (Bruker) respectively and IR were recorded using a Shimadzu. FT IR-8300 instrument. High-resolution mass spectra were obtained using a Qtof Micro YA263 instrument. Ethyl acetate was dried over anhydrous calcium chlo- ride. Petroleum ether of boiling ...

  3. VizieR Online Data Catalog: Inner/outer HII regions: galaxy sample (Rodriguez-Baras+, 2018) (United States)

    Rodriguez-Baras, M.; Diaz, A. I.; Rosales-Ortega, F. F.; Sanchez, S. F.


    Physical properties for 263 isolated spiral galaxies, observed by the CALIFA survey, are presented. These galaxies compose this work galaxy sample. For each galaxy redshift, morphological type, inclination, distance, effective radius, g and r SDSS magnitudes, absolute B magnitude and total number of HII regions extracted in the galaxy are given. (1 data file).

  4. N L Singh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N L Singh. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  5. Low-level determination of silicon in biological materials using radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Zeisler, R.


    Roč. 263, č. 3 (2005), s. 811-816 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z10480505 Keywords : gel breast implants * alzhemers-disease * renal-failure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.460, year: 2005

  6. Greater Focus Needed on Alien Plant Impacts in Protected Areas

    Czech Academy of Sciences Publication Activity Database

    Hulme, P. E.; Pyšek, Petr; Pergl, Jan; Jarošík, Vojtěch; Schaffner, U.; Vila, M.


    Roč. 7, č. 5 (2014), s. 459-466 ISSN 1755-263X R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : plant invasions * impact * protected areas Subject RIV: EF - Botanics Impact factor: 7.241, year: 2014

  7. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. MOSAMI GALVANKAR. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 251-263 Article. Estrogen is essential but not sufficient to induce endometriosis · MOSAMI GALVANKAR NEHA SINGH MODI DEEPAK · More Details Abstract Fulltext PDF.

  8. Dalších deset let archeologického areálu pod třetím nádvořím Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana


    Roč. 68, č. 4 (2008), s. 259-263, 334-337 ISSN 1210-5538 R&D Projects: GA MK KZ97P02OPP006 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeological heritige * Prague Castle * Early Mediaeval * interdisciplinary excavation * conservation Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Screening of leaf meals as feed supplements in the culture of ...

    African Journals Online (AJOL)

    protein content (26.3%) followed by Gliricidia leaf meal (22.9%) and Stylosanthes leaf meal (19.5%). All the four diets (A – D) were formulated with maize flour, soybean, fish meal, blood meal and the respective leaf meals and crude protein content ranged from 30.57 – 36.42 %. The diets were distributed randomly to twelve ...

  10. One-Pot, Simple and Efficient Synthesis of Triaryl-1H-imidazoles by ...

    African Journals Online (AJOL)


    –3000. 30 M.M. Heravi, K. Bakhtiari and H.A. Oskooie, J. Mol. Catal. A Chem.,. 2007, 263, 279–281. 31 M.V. Chary, N.C. Keerthysri, S.V.N. Vupallapati, N. Lingaiah and. S. Kantevari, Catal. Commun., 2008, 9, 2013–2017. 32 A.Y. Usyatinsky ...


    National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...


    National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...

  13. Download this PDF file

    African Journals Online (AJOL)


    ABSTRACT. Objectives: To investigate the effects of malnutrition as a co-morbid factor on neurocognitive functioning in HIV positive adults in Lusaka. Design: A cross- sectional study consisting of 263 participants. The sample comprised of 109 (40.2 %) males and 162 (59.8%) females with an age range of between 20.

  14. A novel inhibitor of cytokinin degradation (INCYDE) influences the biochemical parameters and photosynthetic apparatus in NaCl-stressed tomato plants

    Czech Academy of Sciences Publication Activity Database

    Aremu, A.O.; Masondo, N.A.; Sunmonu, T.O.; Kulkarni, M. G.; Zatloukal, Marek; Spíchal, Lukáš; Doležal, Karel; van Staden, J.


    Roč. 240, č. 4 (2014), s. 877-889 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Antioxidant * Cytokinins * Chlorophyll Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014

  15. Outbreak of Zika Virus Infections, Dominica, 2016. (United States)

    Ryan, Sadie J; Carlson, Colin J; Stewart-Ibarra, Anna M; Borbor-Cordova, Mercy J; Romero, Moory M; Cox, Shelly-Ann; Mahon, Roché; Trotman, Adrian; St Ville, Sylvester; Ahmed, Shalauddin


    In February 2016, the World Health Organization declared the pandemic of Zika virus a public health emergency. On March 4, 2016, Dominica reported its first autochthonous Zika virus disease case; subsequently, 1,263 cases were reported. We describe the outbreak through November 2016, when the last known case was reported.

  16. Outbreak of Zika Virus Infections, Dominica, 2016


    Ryan, Sadie J.; Carlson, Colin J.; Stewart-Ibarra, Anna M.; Borbor-Cordova, Mercy J.; Romero, Moory M.; Cox, Shelly-Ann; Mahon, Roché; Trotman, Adrian; St. Ville, Sylvester; Ahmed, Shalauddin


    In February 2016, the World Health Organization declared the pandemic of Zika virus a public health emergency. On March 4, 2016, Dominica reported its first autochthonous Zika virus disease case; subsequently, 1,263 cases were reported. We describe the outbreak through November 2016, when the last known case was reported.

  17. Magnetism in UPtAl under high pressure

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Eto, T.; Oomi, G.; Sechovský, V.; Andreev, Alexander V.; Takeshita, N.; Môri, N.


    Roč. 52, č. 2 (2002), s. 263-266 ISSN 0011-4626. [Czech and Slovak Conference on Magnetism /11./. Košice, 20.08.2001-23.08.2001] Institutional research plan: CEZ:AV0Z1010914 Keywords : UPtAl * high pressure * electrical resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.311, year: 2002

  18. Polypseudorotaxanes between .alpha.-cyclodextrin and poly(propylene glycol)-b-poly(ethylene glycol)-b-poly(propylene glycol) copolymers studied by MALDI-TOF mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Horský, Jiří; Walterová, Zuzana


    Roč. 74, January (2016), s. 256-263 ISSN 0014-3057 Grant - others:OPPK(XE) CZ.2.16/3.1.00/24504 Institutional support: RVO:61389013 Keywords : polypseudorotaxanes * reverse pluronics * cyclodextrin Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.531, year: 2016

  19. Intrapartální fetální monitoring, senzitivita a specificita metod

    Czech Academy of Sciences Publication Activity Database

    Hájek, Z.; Srp, B.; Pavlíková, Markéta; Zvárová, Jana; Liška, K.; Haddad El, R.; Pašková, A.; Pařízek, A.


    Roč. 71, č. 4 (2006), s. 263-267 ISSN 1210-7832 Grant - others:GA MZd(CZ) NH7664 Institutional research plan: CEZ:AV0Z10300504 Keywords : senzitivita * specificita * diagnostika hypoxie * kardiotokografie * fetální pulzní oxymetrie * ST analýza EKG plodu Subject RIV: BB - Applied Statistics, Operational Research

  20. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Denny P Alappattu. Articles written in Journal of Earth System Science. Volume 117 Issue S1 July 2008 pp 263-271. Aircraft measurements of aerosol black carbon from a coastal location in the north-east part of peninsular India during ICARB · S Suresh Babu S K Satheesh ...

  1. Effects of stocking on the genetic structure of brown trout, Salmo trutta, in Central Europe inferred from mitochondrial and nuclear DNA markers

    Czech Academy of Sciences Publication Activity Database

    Kohout, Jan; Jašková, I.; Papoušek, Ivo; Šedivá, Alena; Šlechta, Vlastimil


    Roč. 19, č. 3 (2012), 252-263 ISSN 0969-997X R&D Projects: GA AV ČR 1QS500450513; GA MŠk LC06073; GA ČR GA206/09/1154 Institutional support: RVO:67985904 ; RVO:68081766 Keywords : control region * Danube * introgression Subject RIV: GL - Fishing Impact factor: 1.028, year: 2012

  2. Modeling of the Aerosol Infiltration Characteristics in a Cultural Heritage Building: Τhe Baroque Library Hall in Prague

    Czech Academy of Sciences Publication Activity Database

    Chatoutsidou, S.E.; Mašková, Ludmila; Ondráčková, Lucie; Ondráček, Jakub; Lazaridis, M.; Smolík, Jiří


    Roč. 89, JUL (2015), s. 253-263 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Grant - others:EEA(NO) A/CZ0046/2/001 Institutional support: RVO:67985858 Keywords : infiltration factor * penetration * deposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015


    African Journals Online (AJOL)


    Oct 27, 2000 ... Increase in hospital admissions for acute childhood asthma in Cape. Town, 1978 -1990. 5 Afr Med 1 1994; 84' 263-266. 19. Strachan DP, Anderson HR, Limb ES. A national survey of asthma prevalence, severity and treatment in Great Britain. Arch Dis Child 1994; 70: 174-178. 20. Mielck A, Reitmeir P, Wjst ...

  4. Dynamical Processes in Flux Tubes and their Role in ...

    Indian Academy of Sciences (India)


    , Vol. 263. (ed.) Rutten, R. J. and Severino, G. (Kluwer: Acad. Publ.), p. 453. Nördlund, Ä., Brandenburg, Α., Jennings, R. L., Rieutord, M., Ruokainen, J., Stein, R. F.,. Tuominen, I. 1992, Astrophys. J., 392, 647. Spruit, Η. C. 1981, Astr. Astrophys., ...

  5. On periodic bounded and unbounded solutions of second order nonlinear ordinary differential equations

    Czech Academy of Sciences Publication Activity Database

    Lomtatidze, Alexander


    Roč. 24, č. 2 (2017), s. 241-263 ISSN 1072-947X Institutional support: RVO:67985840 Keywords : nonlinear ordinary differential equations * periodic boundary value problem * solvability Subject RIV: BA - General Mathematics Impact factor: 0.290, year: 2016 xml

  6. SAJS March 2011.indd

    African Journals Online (AJOL)


    Mar 7, 2011 ... 16. Gordeuk VR. African iron overload. Semin Haematol 2002;39:263-269. 17. Asare GA, Bronze M, Naidoo V, et al. Interaction between aflatoxin B1 and dietary iron overload in hepatic mutagenesis. Toxicology 2007;234:157-166. 18. Siegel AB, Zhu AX. Metabolic syndrome and hepatocellular carcinoma.

  7. A scent shield to survive: identification of the repellent compounds secreted by the male offspring of the cuckoo bumblebee Bombus vestalis

    Czech Academy of Sciences Publication Activity Database

    Lhomme, P.; Ayasse, M.; Valterová, Irena; Lecocq, T.; Rasmont, P.


    Roč. 157, č. 3 (2015), s. 263-270 ISSN 0013-8703 Institutional support: RVO:61388963 Keywords : Hymenoptera * Apidae * Psithyrus * social parasitism * repellent * GC-EAD * chemical camouflage Subject RIV: EG - Zoology Impact factor: 1.442, year: 2015

  8. K výročí nedožitých pětasedmdesátin archiváře a historika Antonína Verbíka

    Czech Academy of Sciences Publication Activity Database

    Novotný, Gustav


    Roč. 51, - (2009), s. 263-268 ISSN 0583-5569 R&D Projects: GA ČR(CZ) GA404/06/0167 Institutional research plan: CEZ:AV0Z80150510 Keywords : history * biography * archival science * Czech lands * Moravia Subject RIV: AB - History

  9. Effects of the content and language integrated learning approach to EFL teaching: A comparative study

    NARCIS (Netherlands)

    Goris, J.A.; Denessen, E.J.P.G.; Verhoeven, L.T.W.


    This study investigates the effects of English-medium CLIL on EFL proficiency in three European countries. Seven mainstream grammar schools spread across The Netherlands, Germany, and Italy participated with a total of 263 pupils aged 12 to 16. Several language skills were measured by means of

  10. Sunita Dhawan

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sunita Dhawan. Articles written in Journal of Biosciences. Volume 25 Issue 3 September 2000 pp 263-266 Articles. Positive correlation between menthol content and in vitro menthol tolerance in Mentha arvensis L. cultivars · Ajit K Shasany Suman P S Khanuja Sunita Dhawan Sushil ...

  11. Optical replication techniques for image slicers

    Czech Academy of Sciences Publication Activity Database

    Schmoll, J.; Robertson, D.J.; Dubbeldam, C.M.; Bortoletto, F.; Pína, L.; Hudec, René; Prieto, E.; Norrie, C.; Ramsay- Howat, S.


    Roč. 50, 4-5 (2006), s. 263-266 ISSN 1387-6473 Institutional research plan: CEZ:AV0Z10030501 Keywords : smart focal planes * image slicers * replication Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.914, year: 2006

  12. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz. Classics Volume 20 Issue 3 March 2015 pp 260-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. Perceived Self-Efficacy to Avoid Cigarette Smoking and Addiction: Differences between Hispanics and Non-Hispanic Whites. (United States)

    Sabogal, Fabio; And Others


    Finds that, among 263 Hispanic and 150 non-Hispanic White smokers, Hispanics smoked fewer cigarettes, had lower levels of perceived addiction to nicotine, and had higher perceived self-efficacy to avoid smoking, but these differences shrank with greater acculturation. Discusses implications for smoking cessation programs. Contains 27 references.…

  14. Stages and Discharges of the Mississippi River and Tributaries and Other Watersheds in the New Orleans District for 1991 (United States)


    234 GULF OF MEXICO . . . . ..................... 263 PART II. OBSERVED DISCHARGES MISSISSIPPI RIVERANDPASSES ......... ............... 271 OLD...DISCHARGE IN THOUSAND DAY SECOND FEET DAY JAN FEB NAR APR NAY AtUN Jt. AUG SEP OCT NOV DEC 226215 125 83 33 32 90 64 37 m8 90 279 92 5 63 21 2m 224 127

  15. Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej; Dervişcemaloğlu, B.


    Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision

  16. 76 FR 72502 - Removal From the List of Specially Designated Nationals and Blocked Persons of Certain Entities... (United States)



  17. Fathers' Involvement with Their Preschool-Age Children: How Fathers Spend Time with Their Children in Different Family Structures (United States)

    Halme, Nina; Astedt-Kurki, Paivi; Tarkka, Marja-Terttu


    The purpose of this study was to describe how fathers (n = 263) spent time with their preschool-age children and to compare it in different family structures. Data were gathered by structured questionnaires. The instrument included five categories of variables for the time spent: the quantity of time, physical activities, fathers' attitude towards…

  18. Morphology evolution during cooling of quiescent immiscible polymer blends: matrix crystallization effect on the dispersed phase coalescence

    Czech Academy of Sciences Publication Activity Database

    Dimzoski, Bojan; Fortelný, Ivan; Šlouf, Miroslav; Sikora, Antonín; Michálková, Danuše


    Roč. 70, č. 1 (2013), s. 263-275 ISSN 0170-0839 R&D Projects: GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * coalescence * morphology evolution Subject RIV: BJ - Thermodynamics Impact factor: 1.491, year: 2013

  19. The smt-0 mutation which abolishes mating-type switching in fission yeast is a deletion

    DEFF Research Database (Denmark)

    Styrkársdóttir, U; Egel, R; Nielsen, O


    Mating-type switching in the fission yeast, S. pombe, is initiated by a DNA double-strand break (DSB) between the mat1 cassette and the H1 homology box. The mat1-cis-acting mutant, smt-0, abolishes mating-type switching and is shown here to be a 263-bp deletion. This deletion starts in the middle...

  20. Separation of Azeotropic Mixture Acetone + Hexane by Using Polydimethylsiloxane Membrane.

    Czech Academy of Sciences Publication Activity Database

    Randová, A.; Bartovská, L.; Kačírková, Marie; Ledesma, Oscar Iván Hernández; Červenková Šťastná, Lucie; Izák, Pavel; Žitková, Andrea; Friess, K.


    Roč. 170, OCT 1 (2016), s. 256-263 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) LD14094 Institutional support: RVO:67985858 Keywords : azeotropic mixture * PDMS membrane * pervaporation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.359, year: 2016

  1. Insights into Finnish First-Year Pre-Service Teachers' Twenty-First Century Skills (United States)

    Valtonen, Teemu; Sointu, Erkko Tapio; Kukkonen, Jari; Häkkinen, Päivi; Järvelä, Sanna; Ahonen, Arto; Näykki, Piia; Pöysä-Tarhonen, Johanna; Mäkitalo-Siegl, Kati


    This study focuses on Finnish pre-service teachers' perceptions of their twenty-first century skills, especially their learning strategies, collaboration and teamwork, as well as knowledge and attitudes related to ICT in education. The target group consist of 263 first-year pre-service teachers from three universities. The results outline how…

  2. Evidence for fish predation on a coleoid cephalopod from the Lower Jurassic Posidonia Shale of Germany

    Czech Academy of Sciences Publication Activity Database

    Přikryl, T.; Košťák, M.; Mazuch, M.; Mikuláš, Radek


    Roč. 263, č. 1 (2012), s. 25-33 ISSN 0077-7757 Institutional research plan: CEZ:AV0Z30130516 Keywords : taphonomy * Cephalopoda * Actinopterygia * predation * Jurassic * Jurassic (Germany) Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.755, year: 2012

  3. Molecular characterisation of Neoparamoeba strains isolated from gills of Scophthalmus maximus

    Czech Academy of Sciences Publication Activity Database

    Fiala, Ivan; Dyková, Iva


    Roč. 55, č. 1 (2003), s. 11-16 ISSN 0177-5103 R&D Projects: GA ČR GA206/00/0265 Institutional research plan: CEZ:AV0Z6022909; CEZ:MSM 123100003 Keywords : Paramoeba * Neoparamoeba * phylogenetic position Subject RIV: EA - Cell Biology Impact factor: 1.263, year: 2003

  4. Logically Incorrect Arguments

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Vladimír; Peregrin, Jaroslav


    Roč. 30, č. 3 (2016), s. 263-287 ISSN 0920-427X R&D Projects: GA ČR(CZ) GA13-21076S Institutional support: RVO:67985955 Keywords : argumentation * logical form * incorrect argument * correct arguments Subject RIV: AA - Philosophy ; Religion Impact factor: 0.689, year: 2016

  5. Aplikace nízkých teplot pro zvýšení katodoluminiscenčního signálu v rastrovacím elektronovém mikroskopu

    Czech Academy of Sciences Publication Activity Database

    Vaškovicová, Naděžda; Skoupý, Radim; Krzyžánek, Vladislav


    Roč. 62, č. 10 (2017), s. 260-263 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * cathodoluminescence * diamonds * CL spectrum s * cryo-SEM * contamination Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering

  6. Sethian Crowns, Sethian Martyrs? Jewish Apocalypses and Christian Martyrs in a Gnostic Literary Tradition

    DEFF Research Database (Denmark)

    Burns, Dylan Michael


    The predominant image of the crown is among the most baffling features of several, difficult Gnostic apocalypses, recensions of which we know to have been controversial in the school of the Neoplatonic philosopher Plotinus (ca. 263 c.e.). In these “Sethian” apocalypses, recovered from Nag Hammadi...

  7. Spatial practices in lowliebenhof: the case of Maphango v Aengus ...

    African Journals Online (AJOL)

    In Maphango v Aengus Lifestyle Properties (Pty) Ltd 2012 5 BCLR 449 (CC) the question before the Constitutional Court was when a landlord may legally cancel contracts of lease and evict tenants. In answering this question the court had to consider the constitutional protection against arbitrary evictions in section 26(3) ...

  8. The cestode community in northern fur seals (Callorhinus ursinus) on St. Paul Island, Alaska

    Czech Academy of Sciences Publication Activity Database

    Kuzmina, T.A.; Hernández-Orts, Jesús S.; Lyons, E.T.; Spraker, T.R.; Kornyushyn, V.V.; Kuchta, Roman


    Roč. 4, č. 2 (2015), s. 256-263 ISSN 2213-2244 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Adenocephalus pacificus (Diphyllobothrium pacificum) * Anophryocephalus cf. ochotensis * Cestoda * Diphyllobothridea * Diplogonoporus tetrapterus * Otariidae, North Pacific * Tapeworms * Tetrabothriidea Subject RIV: EG - Zoology

  9. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...

  10. Asymptomatic intestinal protozoa in school age children in Pategi ...

    African Journals Online (AJOL)

    Asymptomatic intestinal protozoa in school age children in Pategi, Pategi LGA of Kwara state, Nigeria. ... Results: One hundred and ninety seven (26.3%) of the samples were positive for intestinal protozoan parasite. The distribution of the parasites ... Key words: Asymptomatic, amoebiasis, giardiasis, rural area, children.

  11. Abareshi Maryam Non-isothermal crystallization kinetics of ...

    Indian Academy of Sciences (India)


    ing (FSP) of Al–TiC in situ composite. 571. Bechir M Ben ..... carbide–cobalt bounded inserts. 327. Kamariah see Kartini I. 1419. Kanagaraj S .... see Yuan Changlai. 263. Liu Yanyun. A simple and efficient electrochemical reductive method for graphene oxide. 1529. Liu Zi Xuan see Chen Chang Chun. 1725. Logan Philip J.

  12. North Atlantic weather oscillation and human infectious diseases in the Czech Republic, 1951-2003

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk


    Roč. 20, č. 3 (2005), s. 263-270 ISSN 0393-2990 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519 Keywords : climate change * cluster analysis * human infectious diseases Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.361, year: 2005

  13. Champagne for the cryogenics teams

    CERN Multimedia


    Christmas has come early for the LHC as a complete sector of the cryogenic distribution line has been operating at 10 degrees Kelvin (-263°C) for the past two weeks, just a few degrees above the machine's nominal operating temperature.

  14. Structural study of a novel antimicrobial peptide isolated from the venom of bee Anthophora plumipes

    Czech Academy of Sciences Publication Activity Database

    Čujová, Sabína; Veverka, Václav; Buděšínský, Miloš; Bednárová, Lucie; Čeřovský, Václav


    Roč. 20, Suppl S1 (2014), S263-S264 ISSN 1075-2617. [European Peptide Symposium /33./. 31.08.2014-05.09.2014, Sofia] Institutional support: RVO:61388963 Keywords : antimicrobial peptides * membranes * CD-spectroscopy * NMR spectroscopy Subject RIV: CC - Organic Chemistry

  15. Mindset Change Prerequisite for Academic Excellence: A Case of Four Zimbabwean and South African Universities (United States)

    Makondo, L.


    This article submits that the calibre, attitude and mindset of lecturers/teachers in institutions of Higher Education need drastic improvement and change if academic excellence is to be attainable and sustained in the 21st century. This article builds on the observations by Makondo (2010, 263-276) that most university teaching staff members are…

  16. 21 CFR 316.3 - Definitions. (United States)


    ...) Greater safety in a substantial portion of the target populations, for example, by the elimination of an... Service Act (42 U.S.C. 262-263). (9) Marketing application means an application for approval of a new drug... approval letter of a marketing application for a sponsor of a designated orphan drug, no approval will be...

  17. A Paradigm for Security Metrics in Counterinsurgency (United States)


    The rest go on with their old measurements and expect me to fit them. — George Bernard Shaw, Playwright The history of COIN security an estimated 263,000 in 1962.87 The book Souvenirs de la Bataille d’Alger written by Saadi Yacef in 1962 inspired the movie Battle of Algiers

  18. A Spreadsheet Model That Estimates the Impact of Reduced Distribution Time on Inventory Investment Savings: What is a Day Taken Out of the Pipeline Worth in Inventory? (United States)


    fall-2006/lecture-notes/lect11.pdf Chang, C.-T. (2005). A Linearization Approach for Inventory Models with Variable Lead Time. International Journal of Production Economics , 263...Demand and Lead Time are Stochastic. International Journal of Production Economics , 595-605. Hayya, J. C., Harrison, T. P., & He, X. (2011). The Impact

  19. Distributed Market-Based Algorithms for Multi-Agent Planning with Shared Resources (United States)


    International Journal of Production Economics , 36(2... International Journal of Production Economics , 116(1):129 – 138, 2008. ISSN 0925-5273. doi: 10.1016/j. ijpe.2008.08.002. URL Kaihara. Multi-agent based supply chain modelling with dynamic environment. International Journal of Production Economics , 85(2):263

  20. Effects of Malnutrition as a Co-Morbid Factor on Neurocognitive ...

    African Journals Online (AJOL)

    Objectives: To investigate the effects of malnutrition as a co-morbid factor on neurocognitive functioning in HIV positive adults in Lusaka. Design: A cross- sectional study consisting of 263 participants. The sample comprised of 109 (40.2 %) males and 162 (59.8%) females with an age range of between 20 and 65 years.