WorldWideScience

Sample records for bohrium 263

  1. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  2. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  4. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  5. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  6. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  7. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  8. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  9. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  10. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  11. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  12. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  13. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  14. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  15. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  16. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  17. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  18. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  19. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  20. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  1. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  2. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  3. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  4. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  5. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  6. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  7. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  8. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  9. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  10. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  11. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  12. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  13. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  14. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  15. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  16. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  17. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  18. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  19. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  20. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  1. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  2. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  3. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  4. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  5. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  6. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  7. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  8. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  9. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  10. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  11. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  12. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  13. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  14. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  15. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  16. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  17. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  18. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  19. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  20. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  1. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  2. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  3. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  4. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  5. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  6. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  7. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  8. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  9. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  10. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  11. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  12. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  13. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  14. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  15. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  16. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  17. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  18. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  19. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  20. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  1. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  2. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  3. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  4. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  5. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  6. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  7. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  8. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  9. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  10. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  11. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  12. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  13. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  14. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  15. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  16. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  17. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  18. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  19. 33 CFR 117.263 - Banana River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers...

  20. 12 CFR 263.63 - Assessment order.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Assessment order. 263.63 Section 263.63 Banks... OF PRACTICE FOR HEARINGS Rules and Procedures for Assessment and Collection of Civil Money Penalties § 263.63 Assessment order. (a) In the event of consent to an assessment by the person concerned, or...

  1. 12 CFR 263.36 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Evidence. 263.36 Section 263.36 Banks and... PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.36 Evidence. (a) Admissibility. (1) Except as is otherwise set forth in this section, relevant, material, and reliable evidence that is...

  2. 14 CFR 26.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Definitions. 26.3 Section 26.3 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CONTINUED... certificate, or manufacturer, as determined by the Administrator....

  3. 42 CFR 2.63 - Confidential communications.

    Science.gov (United States)

    2010-10-01

    ... CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS Court Orders Authorizing Disclosure and Use § 2.63... injury, including homicide, rape, kidnapping, armed robbery, assault with a deadly weapon, or child...

  4. 26 CFR 1.263A-12 - Production period.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Production period. 1.263A-12 Section 1.263A-12...) INCOME TAXES Items Not Deductible § 1.263A-12 Production period. (a) In general. Capitalization of... include the production period of a unit of designated property. In contrast, section 263A(a) requires...

  5. 21 CFR 26.3 - Scope.

    Science.gov (United States)

    2010-04-01

    ... PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE QUALITY SYSTEM AUDIT REPORTS, AND CERTAIN... Provisions for Pharmaceutical Good Manufacturing Practices § 26.3 Scope. (a) The provisions of this subpart... inspections and the good manufacturing practices (GMP's) requirements. (c) Appendix B of this subpart...

  6. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  7. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  8. 12 CFR 263.14 - Witness fees and expenses.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Witness fees and expenses. 263.14 Section 263... SYSTEM RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.14 Witness fees and expenses. Witnesses subpoenaed for testimony or depositions shall be paid the same fees for attendance...

  9. 27 CFR 26.3 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ... 1135.26, Delegation of the Administrator's Authorities in 27 CFR Part 26, Liquors and Articles From... Administrator. 26.3 Section 26.3 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Regulations § 26.3 Delegations of the Administrator. The regulatory authorities of the Administrator...

  10. 26 CFR 1.263A-7 - Changing a method of accounting under section 263A.

    Science.gov (United States)

    2010-04-01

    ... books and records, actual financial and accounting data which is required to apply the capitalization... accounting under section 263A. (a) Introduction—(1) Purpose. These regulations provide guidance to taxpayers... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Changing a method of accounting under...

  11. 26 CFR 1.263A-0 - Outline of regulations under section 263A.

    Science.gov (United States)

    2010-04-01

    ... accounting. (4) Financial accounting method disregarded. (5) Treatment of intercompany transactions. (i...) Introduction. (1) Purpose. (2) Taxpayers that adopt a method of accounting under section 263A. (3) Taxpayers...) Engineering and design services. (F) Safety engineering services. (v) Accounting method change. (h)...

  12. 12 CFR 263.65 - Civil penalty inflation adjustments.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Civil penalty inflation adjustments. 263.65... Money Penalties § 263.65 Civil penalty inflation adjustments. (a) Inflation adjustments. In accordance with the Federal Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note), the Board...

  13. 40 CFR 60.263 - Standard for carbon monoxide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for carbon monoxide. 60.263... Production Facilities § 60.263 Standard for carbon monoxide. (a) On and after the date on which the... furnace any gases which contain, on a dry basis, 20 or greater volume percent of carbon...

  14. 40 CFR 263.31 - Discharge clean up.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Discharge clean up. 263.31 Section 263.31 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... up. A transporter must clean up any hazardous waste discharge that occurs during transportation...

  15. 12 CFR 263.31 - Scheduling and prehearing conferences.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Scheduling and prehearing conferences. 263.31... RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.31 Scheduling and prehearing conferences. (a) Scheduling conference. Within 30 days of service of the notice...

  16. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  17. 27 CFR 26.263 - Determination of tax on beer.

    Science.gov (United States)

    2010-04-01

    ... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Procedure at Port of Entry From the Virgin Islands § 26.263 Determination of tax on beer. If the...

  18. Dicty_cDB: CFC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC263 (Link to dictyBase) - - - Contig-U16068-1 CFC263P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365137 |BD365137.1 Newly fou ...

  19. Scene adaptive video encoding for MPEG and H.263+ video

    OpenAIRE

    Fernando, WAC; Canagarajah, CN

    2001-01-01

    This paper presents a new scene adaptive video encoding scheme for MPEG and H263+ video encoders. The proposed scheme determines the picture types adaptively based on statistical features of each video frame. Results show that the proposed scheme demonstrates a significant improvement in performance compared to existing schemes This paper presents a new scene adaptive video encoding scheme for MPEG and H263+ video encoders. The proposed scheme determines the picture types adaptively based ...

  20. 26 CFR 1.263A-15 - Effective dates, transitional rules, and anti-abuse rule.

    Science.gov (United States)

    2010-04-01

    ...-abuse rule. 1.263A-15 Section 1.263A-15 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE..., transitional rules, and anti-abuse rule. (a) Effective dates—(1) Sections 1.263A-8 through 1.263A-15 generally... account under former section 189 or section 266. (c) Anti-abuse rule. The interest capitalization...

  1. Microstructure stability: Optimisation of 263 Ni-based superalloy

    Directory of Open Access Journals (Sweden)

    Crozet Coraline

    2014-01-01

    Full Text Available To reduce CO2 emissions on coal-fired power plant, A-ultra supercritical (A-USC power plant whose steam conditions exceed 700 °C are being developed. At these elevated temperatures, the use of Ni-base superalloys becomes necessary. In this context and within the European project NextGenPower, focus is made on commercial Nimonic C-263 as a candidate material for turbine rotors. Nimonic C-263 is known to have low sensitivity to segregation, high workability and high weldability which are major properties for the manufacture of large shafts. Long-term creep strength is also required for this application and unfortunately Nimonic C-263 shows η-phase precipitation after long-time exposure between 700 °C–900 °C which is detrimental for long-term creep properties. The composition of Nimonic C-263 was thus optimised to overcome the formation of η-phase. Trial tests were made in order to study the effect of hardening contribution elements on microstructural and mechanical properties. Then, a 500 mm diameter forged rotor was made from optimised 263 alloy and shows promising properties.

  2. Dicty_cDB: AFI263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI263 (Link to dictyBase) - G00054 DDB0217856 Contig-U00406-1 AFI263P (Lin ... lignments: (bits) Value (Q550W6) RecName: Full=GDP-fucose ... transporter 1; AltName: Full=S... 414 e-114 AC1155 ... mRNA (cDNA... 181 2e-44 (A6QM03) RecName: Full=GDP-fucose ... transporter 1; AltName: Full=S... 180 5e-44 CP0011 ...

  3. Dicty_cDB: VHD263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD263 (Link to dictyBase) - - - Contig-U16438-1 VHD263P (Link to Original ... . 36 0.033 3 DY606328 |DY606328.1 IMMUNEF045811F15 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... e. 52 0.044 1 DY601389 |DY601389.1 LIVERF074993O11 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ... e. 52 0.044 1 DY600634 |DY600634.1 LIVERF074991B17 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ...

  4. 40 CFR 263.11 - EPA identification number.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false EPA identification number. 263.11... number. (a) A transporter must not transport hazardous wastes without having received an EPA identification number from the Administrator. (b) A transporter who has not received an EPA identification...

  5. 12 CFR 263.403 - Automatic removal, suspension, and debarment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment... From Performing Audit Services § 263.403 Automatic removal, suspension, and debarment. (a) An... to a temporary suspension or permanent revocation of registration or a temporary or...

  6. 40 CFR 180.263 - Phosalone; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Phosalone; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.263 Phosalone; tolerances for residues. (a) General. Tolerances are established for residues...

  7. 7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics.

    Science.gov (United States)

    2010-01-01

    ... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to...

  8. 26 CFR 1.263(b)-1 - Expenditures for advertising or promotion of good will.

    Science.gov (United States)

    2010-04-01

    ... good will. 1.263(b)-1 Section 1.263(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(b)-1 Expenditures for... section 733 or section 451 of the Internal Revenue Code of 1939, in computing its excess profits...

  9. 33 CFR 263.24 - Authority for snagging and clearing for flood control (Section 208).

    Science.gov (United States)

    2010-07-01

    ... clearing for flood control (Section 208). 263.24 Section 263.24 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS Flood Control Policy § 263.24 Authority for snagging and clearing for flood control (Section 208). (a)...

  10. 34 CFR 263.6 - How does the Secretary evaluate applications for the Professional Development program?

    Science.gov (United States)

    2010-07-01

    ... Professional Development program? 263.6 Section 263.6 Education Regulations of the Offices of the Department of... DISCRETIONARY GRANT PROGRAMS Professional Development Program § 263.6 How does the Secretary evaluate applications for the Professional Development program? The following criteria, with the total number of...

  11. 34 CFR 263.2 - Who is eligible to apply under the Professional Development program?

    Science.gov (United States)

    2010-07-01

    ... GRANT PROGRAMS Professional Development Program § 263.2 Who is eligible to apply under the Professional... 34 Education 1 2010-07-01 2010-07-01 false Who is eligible to apply under the Professional Development program? 263.2 Section 263.2 Education Regulations of the Offices of the Department of...

  12. 27 CFR 25.263 - Production of concentrate and reconstitution of beer.

    Science.gov (United States)

    2010-04-01

    ... and reconstitution of beer. 25.263 Section 25.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Concentrate § 25.263 Production of concentrate and reconstitution of beer. (a) Operations at brewery. A brewer may concentrate...

  13. Dicty_cDB: SLI263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng significant alignments: (bits) Value N ( AU052966 ) Dictyostelium discoideum slug cDNA, clone SLF396. 313... e-133 3 ( AU053262 ) Dictyostelium discoideum slug cDNA, clone SLI263. 313 e-133 3 ( AU034176 ) Dictyostelium discoideum slug... cDNA, clone SLC144. 313 e-133 3 ( AU033450 ) Dictyostelium discoideum slug cDNA, clone SL...A841. 313 e-133 3 ( AU033594 ) Dictyostelium discoideum slug cDNA, clone SLB210. ...313 e-133 3 ( AU039267 ) Dictyostelium discoideum slug cDNA, clone SLH314. 313 e-133 3 ( AU034754 ) Dictyostelium discoideum slug

  14. 29 CFR 779.263 - Excise taxes not at the retail level.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Excise taxes not at the retail level. 779.263 Section 779... Coverage Excise Taxes § 779.263 Excise taxes not at the retail level. There are also a wide variety of taxes levied at the manufacturer's or distributor's level and not at the retail level. It should...

  15. 45 CFR 263.0 - What definitions apply to this part?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What definitions apply to this part? 263.0 Section 263.0 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES EXPENDITURES OF STATE AND FEDERAL TANF FUNDS §...

  16. 26 CFR 1.263(e)-1 - Expenditures in connection with certain railroad rolling stock.

    Science.gov (United States)

    2010-04-01

    ... by the Interstate Commerce Commission (49 CFR Part 1201), but only if (i) such unit exclusively moves... rolling stock. 1.263(e)-1 Section 1.263(e)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE... connection with certain railroad rolling stock. (a) Allowance of deduction—(1) Election. Under section...

  17. 34 CFR 263.1 - What is the Professional Development program?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What is the Professional Development program? 263.1... Development Program § 263.1 What is the Professional Development program? (a) The Professional Development... Professional Development program requires individuals who receive training to— (1) Perform work related to...

  18. Stable retrograde orbits around the triple system 2001 SN263

    CERN Document Server

    Araujo, R A N; Prado, A F B A

    2015-01-01

    The NEA 2001 SN263 is the target of the ASTER MISSION - First Brazilian Deep Space Mission. Araujo et al. (2012), characterized the stable regions around the components of the triple system for the planar and prograde cases. Knowing that the retrograde orbits are expected to be more stable, here we present a complementary study. We now considered particles orbiting the components of the system, in the internal and external regions, with relative inclinations between $90^{\\circ}< I \\leqslant180^{\\circ}$, i.e., particles with retrograde orbits. Our goal is to characterize the stable regions of the system for retrograde orbits, and then detach a preferred region to place the space probe. For a space mission, the most interesting regions would be those that are unstable for the prograde cases, but stable for the retrograde cases. Such configuration provide a stable region to place the mission probe with a relative retrograde orbit, and, at the same time, guarantees a region free of debris since they are expect...

  19. Hypolipidemic Effects and Safety of Lactobacillus Reuteri 263 in a Hamster Model of Hyperlipidemia

    Directory of Open Access Journals (Sweden)

    Wen-Ching Huang

    2015-05-01

    Full Text Available We aimed to verify the beneficial effects of probiotic strain Lactobacillus reuteri 263 (Lr263 on hypolipidemic action in hamsters with hyperlipidemia induced by a 0.2% cholesterol and 10% lard diet (i.e., high-cholesterol diet (HCD. Male Golden Syrian hamsters were randomly divided into two groups: normal (n = 8, standard diet (control, and experimental (n = 32, a HCD. After a two-week induction followed by a six-week supplementation with Lr263, the 32 hyperlipidemic hamsters were divided into four groups (n = 8 per group to receive vehicle or Lr263 by oral gavage at 2.1, 4.2, or 10.5 × 109 cells/kg/day for 6 weeks, designated the HCD, 1X, 2X and 5X groups, respectively. The efficacy and safety of Lr263 supplementation were evaluated by lipid profiles of serum, liver and feces and by clinical biochemistry and histopathology. HCD significantly increased serum levels of total cholesterol (TC, triacylglycerol (TG cholesterol, high-density lipoprotein cholesterol (HDL-C, and low-density lipoprotein cholesterol (LDL-C, LDL-C/HDL-C ratio, hepatic and fetal TC and TG levels, and degree of fatty liver as compared with controls. Lr263 supplementation dose dependently increased serum HDL-C level and decreased serum TC, TG, LDL-C levels, LDL-C/HDL-C ratio, hepatic TC and TG levels, and fecal TG level. In addition, Lr263 supplementation had few subchronic toxic effects. Lr263 could be a potential agent with a hypolipidemic pharmacological effect.

  20. Single gene microdeletions and microduplication of 3p26.3 in three unrelated families

    DEFF Research Database (Denmark)

    Kashevarova, Anna A; Nazarenko, Lyudmila P; Schultz-Pedersen, Soren; Skryabin, Nikolay A; Salyukova, Olga A; Chechetkina, Nataliya N; Tolmacheva, Ekaterina N; Rudko, Aleksey A; Magini, Pamela; Graziano, Claudio; Romeo, Giovanni; Joss, Shelagh; Tümer, Zeynep; Lebedev, Igor N

    2014-01-01

    BACKGROUND: Detection of submicroscopic chromosomal alterations in patients with a idiopathic intellectual disability (ID) allows significant improvement in delineation of the regions of the genome that are associated with brain development and function. However, these chromosomal regions usually...... contain several protein-coding genes and regulatory elements, complicating the understanding of genotype-phenotype correlations. We report two siblings with ID and an unrelated patient with atypical autism who had 3p26.3 microdeletions and one intellectually disabled patient with a 3p26.3 microduplication...

  1. Atomic Mass and NuclearBinding Energy for Uup-263(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-263 (Ununpentium, atomic number Z = 115, mass number A = 263).

  2. 28 CFR 26.3 - Date, time, place, and method of execution.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Date, time, place, and method of... Implementation of Death Sentences in Federal Cases § 26.3 Date, time, place, and method of execution. (a) Except... time designated by the Director of the Federal Bureau of Prisons, which date shall be no sooner than...

  3. 33 CFR 263.23 - Small flood control project authority (Section 205).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Small flood control project..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS Flood Control Policy § 263.23 Small flood control project authority (Section 205). (a) Legislative authority. Section 205 of the...

  4. A case of de novo duplication of 15q24-q26.3

    Directory of Open Access Journals (Sweden)

    Hye Ran Kim

    2011-06-01

    Full Text Available Distal duplication, or trisomy 15q, is an extremely rare chromosomal disorder characterized by prenatal and postnatal overgrowth, mental retardation, and craniofacial malformations. Additional abnormalities typically include an unusually short neck, malformations of the fingers and toes, scoliosis and skeletal malformations, genital abnormalities, particularly in affected males, and, in some cases, cardiac defects. The range and severity of symptoms and physical findings may vary from case to case, depending upon the length and location of the duplicated portion of chromosome 15q. Most reported cases of duplication of the long arm of chromosome 15 frequently have more than one segmental imbalance resulting from unbalanced translocations involving chromosome 15 and deletions in another chromosome, as well as other structural chromosomal abnormalities. We report a female newborn with a de novo duplication, 15q24- q26.3, showing intrauterine overgrowth, a narrow asymmetric face with down-slanting palpebral fissures, a large, prominent nose, and micrognathia, arachnodactyly, camptodactyly, congenital heart disease, hydronephrosis, and hydroureter. Chromosomal analysis showed a 46,XX,inv(9(p12q13,dup(15(q24q26.3. Array comparative genomic hybridization analysis revealed a gain of 42 clones on 15q24-q26.3. This case represents the only reported patient with a de novo 15q24-q26.3 duplication that did not result from an unbalanced translocation and did not have a concomitant monosomic component in Korea.

  5. 34 CFR 263.4 - What training costs may a Professional Development program include?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What training costs may a Professional Development... GRANT PROGRAMS Professional Development Program § 263.4 What training costs may a Professional Development program include? (a) A Professional Development program may include, as training costs,...

  6. Composite Laminate With Coefficient of Thermal Expansion Matching D263 Glass

    Science.gov (United States)

    Robinson, David; Rodini, Benjamin

    2012-01-01

    The International X-ray Observatory project seeks to make an X-ray telescope assembly with 14,000 flexible glass segments. The glass used is commercially available SCHOTT D263 glass. Thermal expansion causes the mirror to distort out of alignment. A housing material is needed that has a matching coefficient of thermal expansion (CTE) so that when temperatures change in the X-ray mirror assembly, the glass and housing pieces expand equally, thus reducing or eliminating distortion. Desirable characteristics of this material include a high stiffness/weight ratio, and low density. Some metal alloys show promise in matching the CTE of D263 glass, but their density is high compared to aluminum, and their stiffness/weight ratio is not favorable. A laminate made from carbon fiber reinforced plastic (CFRP) should provide more favorable characteristics, but there has not been any made with the CTE matching D263 Glass. It is common to create CFRP laminates of various CTEs by stacking layers of prepreg material at various angles. However, the CTE of D263 glass is 6.3 ppm/ C at 20 C, which is quite high, and actually unachievable solely with carbon fiber and resin. A composite laminate has been developed that has a coefficient of thermal expansion identical to that of SCHOTT D263 glass. The laminate is made of a combination of T300 carbon fiber, Eglass, and RS3C resin. The laminate has 50% uni-T300 plies and 50% uni-E-glass plies, with each fiber-layer type laid up in a quasi-isotropic laminate for a total of 16 plies. The fiber volume (percent of fiber compared to the resin) controls the CTE to a great extent. Tests have confirmed that a fiber volume around 48% gives a CTE of 6.3 ppm/ C. This is a fairly simple composite laminate, following well established industry procedures. The unique feature of this laminate is a somewhat unusual combination of carbon fiber with E-glass (fiberglass). The advantage is that the resulting CTE comes out to 6.3 ppm/ C at 20 C, which matches D

  7. Biological Control of Rice Blast (Magnaporthe oryzae by use of Streptomyces sindeneusis isolate 263 in Greenhouse

    Directory of Open Access Journals (Sweden)

    M. E. Zarandi

    2009-01-01

    Full Text Available Soil Actinomycetes particularly Streptomyces spp. have antagonistic activity against wide range of plant pathogens. In the recent decades they have attracted high interests as biocontrol agents. In search for finding such principles, in vitro suppression of Magnaporthe oryzae the causal agent of rice blast disease was studied by use of Streptomyces sindeneusis isolate 263 in greenhouse. Spray of rice seedling-leaves with of mixed spore suspension of the pathogen and S. sindeneusis isolate 263 resulted in strong inhibition of the pathogen and suppression of leaf symptoms. Propagation of the antagonist crude sap was performed in aqueous cultures and bioactivity was monitored in shaked cultures. Ongoing goals of this research include isolation, characterization and identification of the active metabolites and future goals include identification of active genes for use in development of recombinant DNAs in transgenic rice varieties bearing elevated resistance to infections by M. oryzae.

  8. The role of particle ripening on the creep acceleration of Nimonic 263 superalloy

    OpenAIRE

    Angella Giuliano; Donnini Riccardo; Ripamonti Dario; Maldini Maurizio

    2014-01-01

    Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C) Nimonic 263, a polycrystalline nickel base superall...

  9. Yeast Interacting Proteins Database: YLR263W, YDR510W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available description Protein component of the axial elements of the synaptonemal complex, involved in chromosom...YLR263W RED1 Protein component of the axial elements of the synaptonemal complex, involved in chromosom...ins (YPD) 0 IST hit 4 IST hit in the opposite bait/prey orientation - ... ...ins; regulates chromatid cohesion, chromosome segregation, APC-mediated proteolysis, DNA repli...cription Ubiquitin-like protein of the SUMO family, conjugated to lysine residues of target proteins; regulates chrom

  10. Stability Regions Around the Components of the Triple System 2001 SN263

    CERN Document Server

    Araujo, R A N; Prado, A F B A; Sukhanov, A

    2012-01-01

    The NEAs (Near-Earth Asteroids) are good targets for spatial missions, since they periodically approach the orbit of the Earth. Recently, the NEA (153591) 2001 SN263 was chosen as the target of the ASTER MISSION- First Brazilian Deep Space Mission, planned to be launched in 2015. In February 2008, the radio astronomers from Arecibo-Puerto Rico concluded that (153591) 2001 SN263 is actually a triple system (Nolan et al., 2008). The announcement of the ASTER MISSION has motivated the development of the present work, whose goal is to characterize regions of stability and instability of the triple system (153591) 2001 SN263. The method adopted consisted in dividing the region around the system into four distinct regions. We have performed numerical integrations of systems composed by seven bodies: Sun, Earth, Mars, Jupiter and the three components of the system, and by thousands of particles randomly distributed within the demarcated regions, for the planar and inclined prograde cases. The results are diagrams of...

  11. High spatial resolution optical imaging of the multiple T Tauri system LkHα 262/LkHα 263

    Science.gov (United States)

    Velasco, S.; Rebolo, R.; Oscoz, A.; Mackay, C.; Labadie, L.; Garrido, A. Pérez; Crass, J.; Díaz-Sánchez, A.; Femenía, B.; González-Escalera, V.; King, D. L.; López, R. L.; Puga, M.; Rodríguez-Ramos, L. F.; Zuther, J.

    2016-05-01

    We report high spatial resolution i' band imaging of the multiple T Tauri system LkHα 262/LkHα 263 obtained during the first commissioning period of the Adaptive Optics Lucky Imager (AOLI) at the 4.2 m William Herschel Telescope, using its Lucky Imaging mode. AOLI images have provided photometry for each of the two components LkHα 263 A and B (0.41 arcsec separation) and marginal evidence for an unresolved binary or a disc in LkHα 262. The AOLI data combined with previously available and newly obtained optical and infrared imaging show that the three components of LkHα 263 are co-moving, that there is orbital motion in the AB pair, and, remarkably, that LkHα 262-263 is a common proper motion system with less than 1 mas/yr relative motion. We argue that this is a likely five-component gravitationally bounded system. According to BT-settl models the mass of each of the five components is close to 0.4 M⊙ and the age is in the range 1-2 Myr. The presence of discs in some of the components offers an interesting opportunity to investigate the formation and evolution of discs in the early stages of multiple very low-mass systems. In particular, we provide tentative evidence that the disc in 263C could be coplanar with the orbit of 263AB.

  12. AN ERROR-RESILIENT H.263+ CODING SCHEME FOR VIDEO TRANSMISSION OVER WIRELESS NETWORKS

    Institute of Scientific and Technical Information of China (English)

    Li Jian; Bie Hongxia

    2006-01-01

    Video transmission over wireless networks has received much attention recently for its restricted bandwidth and high bit-error rate. Based on H.263+, by reversing part stream sequences of each Group Of Block (GOB), an error resilient scheme is presented to improve video robustness without additional bandwidth burden. Error patterns are employed to simulate Wideband Code Division Multiple Access(WCDMA) channels to check out error resilience performances. Simulation results show that both subjective and objective qualities of the reconstructed images are improved remarkably. The mean Peak Signal to Noise Ratio (PSNR)is increased by 0.5dB, and the highest increment is 2dB.

  13. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Davies, A., E-mail: adavies@lle.rochester.edu; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)

    2014-11-15

    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.

  14. Superluminal motion in the double-lobed quasar 3C263

    International Nuclear Information System (INIS)

    The authors report the detection of superluminal motion in the quasar 3C263. The milliarc second structure of this source consists of two nearly unresolved components, whose separation is increasing at a rate of 0.06 +- 0.02 marc s yr-1. This corresponds to an expansion speed of 2.7 +- 0.9 c (Hsub(o) = 55 km s-1 Mpc-1, qsub(o) = 0.05). This quasar is the weakest superluminal source found so far, and there are indications that superluminal motion occurs frequently in this class of object. (author)

  15. Superluminal motion in the double-lobed quasar 3C263

    Energy Technology Data Exchange (ETDEWEB)

    Zensus, J.A.; Hough, D.H.; Porcas, R.W.

    1987-01-01

    The authors report the detection of superluminal motion in the quasar 3C263. The milliarc second structure of this source consists of two nearly unresolved components, whose separation is increasing at a rate of 0.06 +- 0.02 marc s yr/sup -1/. This corresponds to an expansion speed of 2.7 +- 0.9 c (Hsub(o) = 55 km s/sup -1/ Mpc/sup -1/, qsub(o) = 0.05). This quasar is the weakest superluminal source found so far, and there are indications that superluminal motion occurs frequently in this class of object.

  16. Superluminal motion in the double-lobed quasar 3C263

    Science.gov (United States)

    Zensus, J. A.; Hough, D. H.; Porcas, R. W.

    1987-01-01

    The detection of superluminal motion in the quasar 3C263 is reported. The milliarcsecond structure of this source consists of two nearly unresolved components whose separation is increasing at a rate of 0.06 + or - 0.02 marcsec/yr. This corresponds to an expansion speed of 2.7 + or - 0.9 c (H/0/ = 55 km/s/Mpc, q/0/ = 0.05). This quasar is the weakest superluminal source found so far, and there are indications that superluminal motion occurs frequently in this class of object.

  17. A 780-year record of explosive volcanism from DT263 ice core in east Antarctica

    Institute of Scientific and Technical Information of China (English)

    ZHOU Liya; LI Yuansheng; Jihong Cole-da; TAN Dejun; SUN BO; REN Jiawen; WEI Lijia; WANG Henian

    2006-01-01

    Ice cores recovered from polar ice sheet Received and preserved sulfuric acid fallout from explosive volcanic eruptions. DT263 ice core was retrieved from an east Antarctic location. The ice core is dated using a combination of annual layer counting and volcanic time stratigraphic horizon as 780 years (1215-1996 A.D.). The ice core record demonstrates that during the period of approximately 1460-1800 A.D., the accumulation is sharply lower than the levels prior to and after this period. This period coincides with the most recent neoglacial climatic episode, the "Little Ice Age (LIA)", that has been found in numerous Northern Hemisphere proxy and historic records.The non-sea-salt SO2-4 concentrations indicate seventeen volcanic events in DT263 ice core. Compared with those from previous Antarctic ice cores, significant discrepancies are found between these records in relative volcanic flux of several well-known events. The discrepancies among these records may be explained by the differences in surface topography, accumulation rate, snow drift and distribution which highlight the potential impact of local glaciology on ice core volcanic records, analytical techniques used for sulfate measurement, etc. Volcanic eruptions in middle and high southern latitudes affect volcanic records in Antarctic snow more intensively than those in the Iow latitudes.

  18. Efficient Video Transcoding from H.263 to H.264/AVC Standard with Enhanced Rate Control

    Directory of Open Access Journals (Sweden)

    Nguyen Viet-Anh

    2006-01-01

    Full Text Available A new video coding standard H.264/AVC has been recently developed and standardized. The standard represents a number of advances in video coding technology in terms of both coding efficiency and flexibility and is expected to replace the existing standards such as H.263 and MPEG-1/2/4 in many possible applications. In this paper we investigate and present efficient syntax transcoding and downsizing transcoding methods from H.263 to H.264/AVC standard. Specifically, we propose an efficient motion vector reestimation scheme using vector median filtering and a fast intraprediction mode selection scheme based on coarse edge information obtained from integer-transform coefficients. Furthermore, an enhanced rate control method based on a quadratic model is proposed for selecting quantization parameters at the sequence and frame levels together with a new frame-layer bit allocation scheme based on the side information in the precoded video. Extensive experiments have been conducted and the results show the efficiency and effectiveness of the proposed methods.

  19. Deformed potential energy of $^{263}Db$ in a generalized liquid drop model

    CERN Document Server

    Chen Bao Qiu; Zhao Yao Lin; 10.1088/0256-307X/20/11/009

    2003-01-01

    The macroscopic deformed potential energy for super-heavy nuclei /sup 263/Db, which governs the entrance and alpha decay channels, is determined within a generalized liquid drop model (GLDM). A quasi- molecular shape is assumed in the GLDM, which includes volume-, surface-, and Coulomb-energies, proximity effects, mass asymmetry, and an accurate nuclear radius. The microscopic single particle energies derived from a shell model in an axially deformed Woods- Saxon potential with a quasi-molecular shape. The shell correction is calculated by the Strutinsky method. The total deformed potential energy of a nucleus can be calculated by the macro-microscopic method as the summation of the liquid-drop energy and the Strutinsky shell correction. The theory is applied to predict the deformed potential energy of the experiment /sup 22/Ne+/sup 241/Am to /sup 263/Db* to /sup 259/Db+4 n, which was performed on the Heavy Ion Accelerator in Lanzhou. It is found that the neck in the quasi-molecular shape is responsible for t...

  20. Deformed Potential Energy of 263Db in a Generalized Liquid Drop Model

    Institute of Scientific and Technical Information of China (English)

    陈宝秋; 马中玉; 赵耀林

    2003-01-01

    The macroscopic deformed potential energy for super-heavy nuclei 263 Db,which governs the entrance and alpha decay channels,is determined within a generalized liquid drop model(GLDM).A quasi-molecular shape is as sumed in the GLDM,which includes volume-,surface-,and Coulomb-energies,proximity effects,mass asymmetry,and an accurate nuclear radius.The microscopic single particle energies are derived from a shell model in an axially deformed Woods-Saxon potential with a quasi-molecular shape.The shell correction is calculated by the Strutinsky method.The total deformed potential energy of a nucleus can be calculated by the macro-microscopic method as the summation of the liquid-drop energy and the Strutinsky shell correction.The theory is applied to predict the deformed potential energy of the experiment 22Ne + 241Am → 263Db* → 259Db + 4n,which was performed on the Heavy Ion Accelerator in Lanzhou.It is found that the neck in the quasi-molecular shape is responsible for the deep valley of the fusion barrier due to the shell corrections.In the cold fusion path,the double-hump fusion barrier is predicted by the shell correction and complete fusion events may occur.

  1. Mechanism of artemisinin resistance for malaria PfATP6 L263 mutations and discovering potential antimalarials: An integrated computational approach.

    Science.gov (United States)

    N, Nagasundaram; C, George Priya Doss; Chakraborty, Chiranjib; V, Karthick; D, Thirumal Kumar; V, Balaji; R, Siva; Lu, Aiping; Ge, Zhang; Zhu, Hailong

    2016-01-01

    Artemisinin resistance in Plasmodium falciparum threatens global efforts in the elimination or eradication of malaria. Several studies have associated mutations in the PfATP6 gene in conjunction with artemisinin resistance, but the underlying molecular mechanism of the resistance remains unexplored. Associated mutations act as a biomarker to measure the artemisinin efficacy. In the proposed work, we have analyzed the binding affinity and efficacy between PfATP6 and artemisinin in the presence of L263D, L263E and L263K mutations. Furthermore, we performed virtual screening to identify potential compounds to inhibit the PfATP6 mutant proteins. In this study, we observed that artemisinin binding affinity with PfATP6 gets affected by L263D, L263E and L263K mutations. This in silico elucidation of artemisinin resistance enhanced the identification of novel compounds (CID: 10595058 and 10625452) which showed good binding affinity and efficacy with L263D, L263E and L263K mutant proteins in molecular docking and molecular dynamics simulations studies. Owing to the high propensity of the parasite to drug resistance the need for new antimalarial drugs will persist until the malarial parasites are eventually eradicated. The two compounds identified in this study can be tested in in vitro and in vivo experiments as possible candidates for the designing of new potential antimalarial drugs. PMID:27471101

  2. Mechanism of artemisinin resistance for malaria PfATP6 L263 mutations and discovering potential antimalarials: An integrated computational approach

    Science.gov (United States)

    Nagasundaram, N.; George Priya Doss, C.; Chakraborty, Chiranjib; Karthick, V.; Thirumal Kumar, D.; Balaji, V.; Siva, R.; Lu, Aiping; Ge, Zhang; Zhu, Hailong

    2016-07-01

    Artemisinin resistance in Plasmodium falciparum threatens global efforts in the elimination or eradication of malaria. Several studies have associated mutations in the PfATP6 gene in conjunction with artemisinin resistance, but the underlying molecular mechanism of the resistance remains unexplored. Associated mutations act as a biomarker to measure the artemisinin efficacy. In the proposed work, we have analyzed the binding affinity and efficacy between PfATP6 and artemisinin in the presence of L263D, L263E and L263K mutations. Furthermore, we performed virtual screening to identify potential compounds to inhibit the PfATP6 mutant proteins. In this study, we observed that artemisinin binding affinity with PfATP6 gets affected by L263D, L263E and L263K mutations. This in silico elucidation of artemisinin resistance enhanced the identification of novel compounds (CID: 10595058 and 10625452) which showed good binding affinity and efficacy with L263D, L263E and L263K mutant proteins in molecular docking and molecular dynamics simulations studies. Owing to the high propensity of the parasite to drug resistance the need for new antimalarial drugs will persist until the malarial parasites are eventually eradicated. The two compounds identified in this study can be tested in in vitro and in vivo experiments as possible candidates for the designing of new potential antimalarial drugs.

  3. Clinical analysis of primary diseases in 263 late preterm infants%晚期早产儿263例患病情况临床分析

    Institute of Scientific and Technical Information of China (English)

    翁景文; 刘红; 董世霄; 靳绯; 刘靖媛

    2013-01-01

    目的 分析晚期早产儿(late preterm infant,LPI)生后患病及并发症情况,分析需要呼吸支持治疗的围产期高危因素,为防治提供依据.方法 分析263例晚期早产儿临床资料,用Logistic回归分析的方法 筛选需要呼吸支持的晚期早产儿(LPI)的围产期高危因素,并分析常见临床并发症的发生情况.结果 呼吸困难是LPI生后住院治疗的首要病因,原发病以湿肺(24.33%)和败血症(18.63%)为首,其各系统并发症的发病率均较高,以高胆红素血症(17.87%)、低血糖(13.68%)等为主.logistic回归显示双胎、妊高症、剖宫产及生后窒息是LPI需要呼吸支持的危险因素(均P<0.05).结论 LPI生后易发生多种并发症,应注意观察,及时救治.重视围产期异常分娩因素,是降低LPI生后需要呼吸支持的关键.

  4. Object-Oriented System-on-Network-on-Chip Template and Implementation: H.263 Case Study

    Institute of Scientific and Technical Information of China (English)

    MA Liwei; SUN Yihe

    2008-01-01

    Network-on-chip (NoC) technology enables a new system-on-chip paradigm, the system-on-network-on-chip (SoNoC) paradigm. One of the challenges in designing application-specific networks is modeling the on-chip system behavior and determining on-chip traffic characteristics. A universal object message level model for SoNoC was defined and an object-oriented methodology was developed to imple-ment this model in hardware and software. The model supports "object to core" synthesis and "function in-voking to network" mapping. A case study of an H.263 system verifies the model and methodology. System prototypes are easily built and on-chip traffic can be observed using the SoNoC model to provide real benchmarks for on-chip network design.

  5. SU-E-P-22: AAPM Task Group 263 Tackling Standardization of Nomenclature for Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Matuszak, M; Feng, M [University of Michigan, Ann Arbor, MI (United States); Moran, J [Univ Michigan Medical Center, Ann Arbor, MI (United States); Xiao, Y [Thomas Jefferson University, Philadelphia, PA (United States); Mayo, C; Miller, R [Mayo Clinic, Rochester, MN (United States); Bosch, W [Washington Univ, Saint Louis, MO (United States); Popple, R [Univ Alabama Birmingham, Birmingham, AL (United States); Marks, L [UNC School of Medicine, Chapel Hill, NC (United States); Wu, Q [Duke University Medical Center, Durham, NC (United States); Molineu, A; Martel, M [UT MD Anderson Cancer Center, Houston, TX (United States); Yock, T [Massachusetts General Hospital, Boston, MA (United States); McNutt, T [Johns Hopkins University, Severna Park, MD (United States); Brown, N [Baptist Medical Center, Jacksonville, FL (United States); Purdie, T [Princess Margaret Hospital, Toronto, ON (Canada); Yorke, E [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Santanam, L [Washington University School of Medicine, St.louis, MO (United States); Gabriel, P [University of Pennsylvania, Philadelphia, PA (United States); Michalski, J [Washington University, Saint Louis, MO (United States); and others

    2015-06-15

    Purpose: There is growing recognition of need for increased clarity and consistency in the nomenclatures used for body and organ structures, DVH metrics, toxicity, dose and volume units, etc. Standardization has multiple benefits; e.g. facilitating data collection for clinical trials, enabling the pooling of data between institutions, making transfers (i.e. hand-offs) between centers safer, and enabling vendors to define “default” settings. Towards this goal, the American Association of Physicists in Medicine (AAPM) formed a task group (TG263) in July of 2014, operating under the Work Group on Clinical Trials to develop consensus statements. Guiding principles derived from the investigation and example nomenclatures will be presented for public feedback. Methods: We formed a multi-institutional and multi-vendor collaborative group of 39 physicists, physicians and others involved in clinical use and electronic transfer of information. Members include individuals from IROC, NRG, IHE-RO, DICOM WG-7, ASTRO and EORTC groups with overlapping interests to maximize the quality of the consensus and increase the likelihood of adoption. Surveys of group and NRG members were used to define current nomenclatures and requirements. Technical requirements of vendor systems and the proposed DICOM standards were examined. Results: There is a marked degree of inter and intra institutional variation in current approaches, resulting from inter-vendor differences in capabilities, clinic specific conceptualizations and inconsistencies. Using a consensus approach, the group defined optimal formats for the naming of targets and normal structures. A formal objective assessment of 13 existing clinically-used software packages show that all had capabilities to accommodate these recommended nomenclatures. Conclusions: A multi-stakeholder effort is making significant steps forward in developing a standard nomenclature that will work across platforms. Our current working list includes > 550

  6. SU-E-P-22: AAPM Task Group 263 Tackling Standardization of Nomenclature for Radiation Therapy

    International Nuclear Information System (INIS)

    Purpose: There is growing recognition of need for increased clarity and consistency in the nomenclatures used for body and organ structures, DVH metrics, toxicity, dose and volume units, etc. Standardization has multiple benefits; e.g. facilitating data collection for clinical trials, enabling the pooling of data between institutions, making transfers (i.e. hand-offs) between centers safer, and enabling vendors to define “default” settings. Towards this goal, the American Association of Physicists in Medicine (AAPM) formed a task group (TG263) in July of 2014, operating under the Work Group on Clinical Trials to develop consensus statements. Guiding principles derived from the investigation and example nomenclatures will be presented for public feedback. Methods: We formed a multi-institutional and multi-vendor collaborative group of 39 physicists, physicians and others involved in clinical use and electronic transfer of information. Members include individuals from IROC, NRG, IHE-RO, DICOM WG-7, ASTRO and EORTC groups with overlapping interests to maximize the quality of the consensus and increase the likelihood of adoption. Surveys of group and NRG members were used to define current nomenclatures and requirements. Technical requirements of vendor systems and the proposed DICOM standards were examined. Results: There is a marked degree of inter and intra institutional variation in current approaches, resulting from inter-vendor differences in capabilities, clinic specific conceptualizations and inconsistencies. Using a consensus approach, the group defined optimal formats for the naming of targets and normal structures. A formal objective assessment of 13 existing clinically-used software packages show that all had capabilities to accommodate these recommended nomenclatures. Conclusions: A multi-stakeholder effort is making significant steps forward in developing a standard nomenclature that will work across platforms. Our current working list includes > 550

  7. Heat Killed Lactobacillus reuteri GMNL-263 Reduces Fibrosis Effects on the Liver and Heart in High Fat Diet-Hamsters via TGF-β Suppression

    Directory of Open Access Journals (Sweden)

    Wei-Jen Ting

    2015-10-01

    Full Text Available Obesity is one of the major risk factors for nonalcoholic fatty liver disease (NAFLD, and NAFLD is highly associated with an increased risk of cardiovascular disease (CVD. Scholars have suggested that certain probiotics may significantly impact cardiovascular health, particularly certain Lactobacillus species, such as Lactobacillus reuteri GMNL-263 (Lr263 probiotics, which have been shown to reduce obesity and arteriosclerosis in vivo. In the present study, we examined the potential of heat-killed bacteria to attenuate high fat diet (HFD-induced hepatic and cardiac damages and the possible underlying mechanism of the positive effects of heat-killed Lr263 oral supplements. Heat-killed Lr263 treatments (625 and 3125 mg/kg-hamster/day were provided as a daily supplement by oral gavage to HFD-fed hamsters for eight weeks. The results show that heat-killed Lr263 treatments reduce fatty liver syndrome. Moreover, heat-killed Lactobacillus reuteri GMNL-263 supplementation in HFD hamsters also reduced fibrosis in the liver and heart by reducing transforming growth factor β (TGF-β expression levels. In conclusion, heat-killed Lr263 can reduce lipid metabolic stress in HFD hamsters and decrease the risk of fatty liver and cardiovascular disease.

  8. Activation Energy Calculations for the Portevin-Le Chatelier Effect in Nimonic 263 Superalloy

    Science.gov (United States)

    Han, G. M.; Tian, C. G.; Chu, Z. K.; Cui, C. Y.; Hu, Z. Q.; Sun, X. F.

    2015-10-01

    The Portevin-Le Chatelier (PLC) effect in the Nimonic 263 superalloy was investigated by tensile test in a wide temperature range, from room temperature to 1033 K (760 °C), and at strain rates between 0.1 and 4 × 10-4 s-1. Types A, B, and C serrations were observed depending upon the test temperatures and strain rates. The activation energy ( Q) for serrated flow was determined by employing various methodologies for T PLC effect was observed. The value of Q was found to be independent of the method employed. The average Q value of 70 KJ/mol was found to be in agreement with that for diffusion of substitutional solutes such as Cr and Mo in a Ni matrix by pipe diffusion. At temperatures ranging from 723 K to 923 K (450 °C to 650 °C), type C serrations and an inverse PLC effect were noticed, which may be caused by unlocking process.

  9. The role of particle ripening on the creep acceleration of Nimonic 263 superalloy

    Directory of Open Access Journals (Sweden)

    Angella Giuliano

    2014-01-01

    Full Text Available Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C Nimonic 263, a polycrystalline nickel base superalloy used for combustion chambers of gas turbines. The experimental results suggest that the reinforcing particle evolution is not the main reason for the creep acceleration that seems to be better described by a strain correlated damage, such as the accumulation of mobile dislocations or the grain boundary cavitation. The coarsened microstructure, obtained by overageing the alloy at high temperature before creep testing, mainly influences the initial stage of the creep, resulting in a higher minimum creep rate and a corresponding reduction of the creep resistance.

  10. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    International Nuclear Information System (INIS)

    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75–80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (∼1 −μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 104 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  11. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D. [Laboratory for Laser Energetics, University of Rochester, 250 E. River Rd., Rochester, New York 14616 (United States); Kugland, N. L.; Rushford, M. C. [Lawrence Livermore National Laboratory, University of California, P. O. Box 808, Livermore, California 94551 (United States)

    2012-10-15

    A 10-ps, 263-nm (4{omega}) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution ({approx}1 -{mu}m full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10{sup 4} with respect to all wavelengths outside of the 263 {+-} 2 nm measurement range.

  12. Orthogonal Frequency-Division Multiplex Transmission of H.263 Encoded Video over Highly Frequency-Selective Wireless Networks

    OpenAIRE

    Cherriman, P.J.; Keller, T.; Hanzo, L.

    1999-01-01

    The video performance of a 155-Mbps wireless asynchronous transfer mode (WATM) proposal and that of a 2-Mbps Universal Mobile Telecommunications System (UMTS) concept is evaluated for a range of low- to high-quality video application scenarios, various propagation conditions, and video bit rates using the H.263 video codec, assisted by a novel packetization and packet acknowledgment scheme. Orthogonal frequency-division multiplexing is invoked over the highly dispersive channels for conveying...

  13. Navitoclax (ABT-263) accelerates apoptosis during drug-induced mitotic arrest by antagonizing Bcl-xL

    OpenAIRE

    Shi, Jue; Zhou, Yuan; Huang, Hsiao-Chun; Mitchison, Timothy J.

    2011-01-01

    Combining microtubule-targeting anti-mitotic drugs with targeted apoptosis potentiators is a promising new chemotherapeutic strategy to treat cancer. In this study we investigate the cellular mechanism by which Navitoclax (previously called ABT-263), a Bcl-2 family inhibitor, potentiates apoptosis triggered by paclitaxel and an inhibitor of Kinesin-5 (KSP), across a panel of epithelial cancer lines. Using time-lapse microscopy, we show that Navitoclax has little effect on cell death during in...

  14. Operable Breast Cancer: a Clinical Analysis of 6,263 Cases

    Institute of Scientific and Technical Information of China (English)

    Mingtian Yang; Xi Wang; Jun Tang; Tiehua Rong; Zhifan Huang; Changuang Zeng; Hao Long; Jianhua Fu; Peng Lin; Xin Wang; Siyu Wang

    2005-01-01

    OBJECTIVE In Europe and America breast cancer commonly occurs in women of middle and old age, with a median age of about 57 years. Modified radical mastectomy now called standard radical mastectomy, has taken the place of traditional radical mastectomy. Patients with breast cancer at an early stage commonly receive BCT (breast conservative therapy). The TNM stage (especially the lymph node status) affects the prognosis, and adjuvant therapy can improve survival. In China, only a few reports have been pubIished studying large numbers of breast cancer patients. This study was designed to analyze the clinical features, surgical pattern and treatment outcome of resectable breast cancer, as well as to explore the prognostic factors and the effect of adjuvant therapy, with a goal to improve the level of diagnosis and treatment.METHODS Records of the 6,263 patients with resectable breast cancer who had been admitted into our hospital from June 1964 to June 2003 were analyzed retrospectively.RESULTS Of the 6,263 cases, 98.8% were female. Breast cancer occurred most frequently in patients of ages 40~49 years (41.0%), especially in patients 45~49 years old (25.2%). A breast lump, which occurred in 96.2% of the patients, was the main clinical manifestation. The overall 5- and 10-year survival rates were 75.16% and 40.44%. Of the patients in TNM stages 0-1,Ⅱ, and Ⅲ, the 5-year survival rates were 96.8%, 73.7% and 46.4% respectively and the 10-year survival rates were 78.7%, 64.6% and 33.5% respectively. The 5-, and 10-year survival rates were higher in the lymph node negative group than in the lymph node positive group (80.3% vs. 55.6%, and 59.2% vs. 31.9%, P<0.01). Since the 1980s there was no significant difference in survival rates of patients who received a radical mastectomy compared to a modified radical mastectomy(P>0.05). Of the 73 patients who underwent breast conservative therapy, no local recurrence or metastasis occurred during a maximal follow-up of 17

  15. Preliminary development plan of the ALR, the laser rangefinder for the ASTER deep space mission to the 2001 SN263 asteroid

    OpenAIRE

    Antonio Gil Vicente de Brum; Annibal Hetem Jr.; Israel da Silveira Rêgo; Cayo Prado Fernandes Francisco; Andre Fenili; Fernando Madeira; Flavio Caldas da Cruz; Marcelo Assafin

    2011-01-01

    The Brazilian deep space mission ASTER, as temporarily named, plans to send a small spacecraft to encounter and investigate the triple asteroid 2001-SN263. The launch is scheduled (initially) to occur in 2015, arriving in 2018. The main motivation of the mission is the development of technology and expertise to leverage the national space sector. Within the scientific goals, the investigation of the still unknown asteroid 2001-SN263. The main project guideline is to aggregate the widest possi...

  16. ORBITS OF NEAR-EARTH ASTEROID TRIPLES 2001 SN263 AND 1994 CC: PROPERTIES, ORIGIN, AND EVOLUTION

    International Nuclear Information System (INIS)

    Three-body model fits to Arecibo and Goldstone radar data reveal the nature of two near-Earth asteroid triples. The triple-asteroid system 2001 SN263 is characterized by a primary of ∼1013 kg, an inner satellite ∼1% as massive orbiting at ∼3 primary radii in ∼0.7 days, and an outer satellite ∼2.5% as massive orbiting at ∼13 primary radii in ∼6.2 days. 1994 CC is a smaller system with a primary of mass ∼2.6 x1011 kg and two satellites ∼2% and ∼-1; 1994 CC inner body: dpiv/dt∼ -0.2 deg day-1), which is in agreement with analytical predictions of the secular evolution due to mutually interacting orbits and primary oblateness. Nonzero mutual inclinations between the orbital planes of the satellites provide the best fits to the data in both systems (2001 SN263: ∼ 14 deg; 1994 CC: ∼16 deg). Our best-fit orbits are consistent with nearly circular motion, except for 1994 CC's outer satellite which has an eccentric orbit of e ∼ 0.19. We examine several processes that can generate the observed eccentricity and inclinations, including the Kozai and evection resonances, past mean-motion resonance crossings, and close encounters with terrestrial planets. In particular, we find that close planetary encounters can easily excite the eccentricities and mutual inclinations of the satellites' orbits to the currently observed values.

  17. Synthesis research of squalene synthetase inhibitor CP-263, 114. How is skeleton construction carried out?; Sukuaren gosei koso sogaizai CP-263,114 no gosei kenkyu - ikanishite kokkaku kochiku wo okonauka?

    Energy Technology Data Exchange (ETDEWEB)

    Matsushima, Y. [Tokyo Inst. of Tech., Tokyo (Japan)

    2000-01-01

    CP-263, 114 isolated as a squalene synthetase inhibitor and the decyclization of CP-225, 917 was not only expected to be a lead chemical compound of the hypercholesterolemia medicine, but also have collected the attention of the organic synthetic chemistry researchers all over the world from the ring structure of advanced oxygen functionalization. In the CP- chemical compound, the constructive method of the bicyclo ring structure is a key of the synthesis, there are three reports to use the intramolecular Diels-Alder reaction (Fukuyama) and the siloxy-Cope rearrangement (Leighton), intramolecular Heck reaction (Danishefsky) as a result of succeeding in including the foothold to the side-chain lactol ring. Recently, Nicolaou et al. succeeded for the first time in the total synthesis racemic modification shell. They carried out the skeleton construction by the intramolecular Diels-Alder reaction, and constructed the maleic anhydride structure in taking the ketone as a foothold. (NEDO)

  18. Numerical simulation for determination of limit strains of a cold rolled and solution treated Nimonic C-263 alloy sheet

    Indian Academy of Sciences (India)

    K Ankamma; P V R Ravindra Reddy; S Nagarjuna; G Chandra Mohan Reddy; M Komaraiah; N Eswara Prasad

    2011-06-01

    Nimonic alloys are Ni-base superalloys used for several high temperature applications, notable among them are the components in space vehicles, rocket engines, submarines, nuclear reactors, chemical processing vessels and heat exchange tubing as they exhibit excellent mechanical strength and creep resistance at high temperatures. Hence, evaluation of their formability characteristics is of utmost importance to make them into several useful components. Limit strains or forming limit curve is one of the parameters that indicates the formability, especially the drawability of sheet metal for deep drawing applications. In this paper, the limit strains of Nimonic C-263 alloy is investigated and presented using an explicit finite element code LSDYNA 3D. The material properties and the material model are evaluated by conducting tensile tests. The limit strains obtained from the simulation are verified by the analytical equations developed using vertex theory. The results tally within ±10% error.

  19. Erratum; A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis

    Science.gov (United States)

    Nummelin, A.; Bergman, P.; Hjalmarson, Å.; Friberg, P.; Irvine, W. M.; Millar, T. J.; Ohishi, M.; Saito, S.

    2001-01-01

    In the paper ``A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis'' by A. Nummelin, P. Bergman, Å. Hjalmarson, P. Friberg, W. M. Irvine, T. J. Millar, M. Ohishi, and S. Saito (ApJS, 128, 213 [2000]), the affiliations for M. Ohishi and S. Saito were set incorrectly. The correct affiliation for M. Ohishi is National Astronomical Observatory of Japan, 2-21-1, Osawa, Mitaka, Tokyo 181-8588, Japan; ohishi@nao.ac.jp. The correct affiliation for S. Saito is Research Center for Development of Far-Infrared Region, Fukui University, 3-9-1 Bunkyo, Fukui 901-8507, Japan; saito@maxwell.apphy.fukui-u.ac.jp. The Press sincerely regrets this error.

  20. Relationships of damaged starch granules and particle size distribution with pasting and thermal profiles of milled MR263 rice flour.

    Science.gov (United States)

    Asmeda, R; Noorlaila, A; Norziah, M H

    2016-01-15

    This research was conducted to investigate the effects of different grinding techniques (dry, semi-wet and wet) of milled rice grains on the damaged starch and particle size distribution of flour produced from a new variety, MR263, specifically related to the pasting and thermal profiles. The results indicated that grinding techniques significantly (pflour. Wet grinding process yields flour with lowest percentage of starch damage (7.37%) and finest average particle size (8.52μm). Pasting and gelatinization temperature was found in the range of 84.45-89.63°C and 59.86-75.31°C, respectively. Dry ground flour attained the lowest pasting and gelatinization temperature as shown by the thermal and pasting profiles. Correlation analysis revealed that percentage of damaged starch granules had a significant, negative relationship with pasting temperature while average particle size distribution had a significant, strong negative relationship with gelatinization temperature. PMID:26258700

  1. Heat-killed Lactobacillus Reuteri GMNL-263 Prevents Epididymal Fat Accumulation and Cardiac Injury in High-Calorie Diet-Fed Rats.

    Science.gov (United States)

    Liao, Po-Hsiang; Kuo, Wei-Wen; Hsieh, Dennis Jine-Yuan; Yeh, Yu-Lan; Day, Cecilia-Hsuan; Chen, Ya-Hui; Chang, Sheng-Huang; Padma, V Vijaya; Chen, Yi-Hsing; Huang, Chih-Yang

    2016-01-01

    High-calorie diet-induced obesity leads to cardiomyocyte dysfunction and apoptosis. Impaired regulation of epididymal fat content in obese patients has been known to increase the risk of cardiac injury. In our study, a lactic acid bacteria, Lactobacillus reuteri GMNL-263, was evaluated for its potential to reduce body weight and body fat ratio and to prevent heart injury in rats with high-fat diet-induced obesity. Lactic acid bacteria supplementation restored the cardiac function and decreased the physiological changes in the heart of the obese rats. In addition, the Fas/Fas-associated protein pathway-induced caspase 3/e Poly polymerase mediated apoptosis in the cardiomyocytes of the obese rats was reversed in the Lr263-treated rats. These results reveal that fed with Lr-263 reduces body fat ratio, inhibits caspase 3-mediated apoptosis and restores cardiac function in obese rats through recovery of ejection fraction and fractional shortening. Our results indicated that the administration of Lr263 lactic acid bacteria can significantly down-regulate body fat and prevent cardiomyocyte injury in obese rats. PMID:27499689

  2. Phosphorylation of the zebrafish M6Ab at serine 263 contributes to filopodium formation in PC12 cells and neurite outgrowth in zebrafish embryos.

    Directory of Open Access Journals (Sweden)

    Kai-Yun Huang

    Full Text Available BACKGROUND: Mammalian M6A, a member of the proteolipid protein (PLP/DM20 family expressed in neurons, was first isolated by expression cloning with a monoclonal antibody. Overexpression of M6A was shown to induce filopodium formation in neuronal cells; however, the underlying mechanism of is largely unknown. Possibly due to gene duplication, there are two M6A paralogs, M6Aa and M6Ab, in the zebrafish genome. In the present study, we used the zebrafish as a model system to investigate the role of zebrafish M6Ab in filopodium formation in PC12 cells and neurite outgrowth in zebrafish embryos. METHODOLOGY/PRINCIPAL FINDINGS: We demonstrated that zebrafish M6Ab promoted extensive filopodium formation in NGF-treated PC12 cells, which is similar to the function of mammalian M6A. Phosphorylation at serine 263 of zebrafish M6Ab contributed to this induction. Transfection of the S263A mutant protein greatly reduced filopodium formation in PC12 cells. In zebrafish embryos, only S263D could induce neurite outgrowth. CONCLUSIONS/SIGNIFICANCE: Our results reveal that the phosphorylation status of zebrafish M6Ab at serine 263 is critical for its role in regulating filopodium formation and neurite outgrowth.

  3. High spatial resolution optical imaging of the multiple T Tauri system LkH{\\alpha} 262/LkH{\\alpha} 263

    CERN Document Server

    Velasco, S; Oscoz, A; Mackay, C; Labadie, L; Garrido, A Pérez; Crass, J; Díaz-Sánchez, A; Femenía, B; González-Escalera, V; King, D L; López, R L; Puga, M; Rodríguez-Ramos, L F; Zuther, J

    2016-01-01

    We report high spatial resolution i' band imaging of the multiple T Tauri system LkH$\\alpha$ 262/LkH$\\alpha$ 263 obtained during the first commissioning period of the Adaptive Optics Lucky Imager (AOLI) at the 4.2 m William Herschel Telescope, using its Lucky Imaging mode. AOLI images have provided photometry for each of the two components LkH$\\alpha$ 263 A and B (0.41 arcsec separation) and marginal evidence for an unresolved binary or a disc in LkH$\\alpha$ 262. The AOLI data combined with previously available and newly obtained optical and infrared imaging show that the three components of LkH$\\alpha$ 263 are co-moving, that there is orbital motion in the AB pair, and, remarkably, that LkH$\\alpha$ 262-263 is a common proper motion system with less than 1 mas/yr relative motion. We argue that this is a likely five-component gravitationally bounded system. According to BT-settl models the mass of each of the five components is close to 0.4 M$_{\\odot}$ and the age is in the range 1-2 Myr. The presence of discs...

  4. N263浸渍树脂吸附分离In(Ⅲ)、Fe(Ⅲ)的初步研究%PRELIMINARY STUDY ON ADSORPTION AND SEPARATION PERFORMANCE OF In3+ AND Fe3+ WITH IMPREGNATED RESINS CONTAINING N263

    Institute of Scientific and Technical Information of China (English)

    刘军深; 高学珍; 魏士龙

    2012-01-01

    The impregnated resin was prepared by a dry-impregnation technique using HZ-818 macroreticular resin as the supporter and methyl trioctyl ammonium chloride (N263) as the extractant. The effects of the concentration of hydrochloric acid, concentration of metal ions, temperature and adsorption time on the adsorption and separation performance of In3+ and Fe3+ from hydrochloric acid medium was studied with this impregnated resin by static adsoiption method. Results showed that the optimized concentration of hydrochloric acid for adsorption of In3+ and Fe3+ were 4mol/L. The adsorption isotherms for In3+ and Fe3+ fitted Langmuir adsorption isotherm models. The maximum adsorption capacities for Fe3+ and In3+ were 43.42mg/g and 14.53mg/g at 298K, respectively. The equilibrium lime was 6h for Fe3+ and 10h for In3+ . Kinetic data indicated that the adsorption for Fe3+ and In3+ with the impregnated resin agreed with the Pseudo-second-ordcr rate equation. In binary components solution, the impregnated resins were with better selective adsorption for Fe3+ but no adsorption for In3+ . The preliminary separation of In3+ and Fe3+ was achieved.%以HZ-818大孔吸附树脂为载体,甲基三辛基氯化铵(N263)为萃取剂,利用干浸渍方法制备了N263浸渍树脂.采用静态吸附法考察了在盐酸体系中盐酸浓度、金属离子浓度、温度以及时间等因素对制备的浸渍树脂吸附分离In3+、Fe3+性能的影响.结果表明,浸渍树脂吸附In3+、Fe3+的最佳盐酸浓度均为4mol/L;其吸附In3+、Fe3+的等温吸附曲线符合Langmuir等温吸附模型;298K下对Fe3+、In3+的饱和吸附容量分别为43.42mg/g、14.53mg/g.动力学研究表明,298K下浸渍树脂吸附Fe3+、In3+的平衡时间分别为6h、10h.准二级动力学方程可较好地描述浸渍树脂对In3+、Fe3+的吸附行为.混合体系中,浸渍树脂对Fe3+表现出较好的吸附性能,而对In3+基本上不吸附,从而达到了初步分离In3+、Fe3+的目的.

  5. Anticancer compound ABT-263 accelerates apoptosis in virus-infected cells and imbalances cytokine production and lowers survival rates of infected mice.

    Science.gov (United States)

    Kakkola, L; Denisova, O V; Tynell, J; Viiliäinen, J; Ysenbaert, T; Matos, R C; Nagaraj, A; Ohman, T; Kuivanen, S; Paavilainen, H; Feng, L; Yadav, B; Julkunen, I; Vapalahti, O; Hukkanen, V; Stenman, J; Aittokallio, T; Verschuren, E W; Ojala, P M; Nyman, T; Saelens, X; Dzeyk, K; Kainov, D E

    2013-01-01

    ABT-263 and its structural analogues ABT-199 and ABT-737 inhibit B-cell lymphoma 2 (Bcl-2), BCL2L1 long isoform (Bcl-xL) and BCL2L2 (Bcl-w) proteins and promote cancer cell death. Here, we show that at non-cytotoxic concentrations, these small molecules accelerate the deaths of non-cancerous cells infected with influenza A virus (IAV) or other viruses. In particular, we demonstrate that ABT-263 altered Bcl-xL interactions with Bcl-2 antagonist of cell death (Bad), Bcl-2-associated X protein (Bax), uveal autoantigen with coiled-coil domains and ankyrin repeats protein (UACA). ABT-263 thereby activated the caspase-9-mediated mitochondria-initiated apoptosis pathway, which, together with the IAV-initiated caspase-8-mediated apoptosis pathway, triggered the deaths of IAV-infected cells. Our results also indicate that Bcl-xL, Bcl-2 and Bcl-w interact with pattern recognition receptors (PRRs) that sense virus constituents to regulate cellular apoptosis. Importantly, premature killing of IAV-infected cells by ABT-263 attenuated the production of key pro-inflammatory and antiviral cytokines. The imbalance in cytokine production was also observed in ABT-263-treated IAV-infected mice, which resulted in an inability of the immune system to clear the virus and eventually lowered the survival rates of infected animals. Thus, the results suggest that the chemical inhibition of Bcl-xL, Bcl-2 and Bcl-w could potentially be hazardous for cancer patients with viral infections. PMID:23887633

  6. Comparison Study on Clinical and Neuropathological Characteristics of Hamsters Inoculated With Scrapie Strain 263K in Different Challenging Pathways

    Institute of Scientific and Technical Information of China (English)

    JIN ZHANG; XIAO-BO ZHOU; GUI-PING MA; YONG LIU; CAI-MIN XU; XIAO-PING DONG; LAN CHEN; BAO-YUN ZHAN; JUN HAN; XIN-LI XIAO; HAI-YAN TIAN; BIN-LING LI; CHEN GAO; JIAN-MEI GAO

    2004-01-01

    Objective To understand the infectious characteristics of a hamster-adapted scrapie strain 263K with five different routes of infection including intracerebral (i.c.), intraperitoneal (i.p.),intragastrical (i.g.), intracardiac and intramuscular (i. m.) approaches. Methods Hamsters were infected with crude- or fine-prepared brain extracts. The neuropathological changes, PrPSc deposits,and patterns of PK-resistant PrP were analyzed by HE stain, immunohistochemistry (IHC) assay and Western blot. Reactive gliosis and neuron loss were evaluated by glial fibrillary acidic protein (GFAP)and neuron specific enolase (NSE) specific IHC. Results The animals inoculated in i.m. and i.p.ways with crude PrPSc extracts showed clinical signs at the average incubation of 69.2+-2.8 and 65.5±3.9 days. Inoculation in i.c. and intracardiac ways with fine PrPSc extracts (0.00035 g) caused similar,but relative long incubation of around 90 days. Only oneout of eight hamsters challenged ini.g way with low dosage (0.01 g) became ill after a much longer incubation (185 d), while all animals (4/4)with high dosage (0.04 g) developed clinical signs 105 days postinfection. The most remarkable spongiform degeneration and PrPsc deposits were found in brain stem among the five challenge groups generally. The number of GFAP-positive astrocytes increased distinctly in brain stems in all infection groups, while the number of NSE-positive cells decreased significantly in cerebrum, except i.c. group. The patterns of PK-resistant PrP in brains were basically identical among the five infection routes. Conclusion Typical TSE could be induced in hamsters by inoculating strain 263K in the five infection ways. The incubation periods in bioassays depend on infective dosage, administrating pathway and preparation of PrPSc. The neuropathological changes and PrPSc deposits seem to be related with regions and inoculating pathways.

  7. Spatially extended absorption around the z=2.63 radio galaxy MRC 2025-218: outflow or infall?

    CERN Document Server

    Humphrey, A; Sánchez, S F; Alighieri, S di Serego; De Breuck, C; Binette, L; Tadhunter, C; Vernet, J; Fosbury, R; Stasielak, J

    2008-01-01

    We present an investigation into the absorber in front of the z=2.63 radio galaxy MRC 2025-218, using integral field spectroscopy obtained at the Very Large Telescope, and long slit spectroscopy obtained at the Keck II telescope. The properties of MRC 2025-218 are particularly conducive to study the nature of the absorbing gas, i.e., this galaxy shows bright and spatially extended Ly-alpha emission, along with bright continuum emission from the active nucleus. Ly-alpha absorption is detected across ~40x30 kpc^2, has a covering factor of ~1, and shows remarkably little variation in its properties across its entire spatial extent. This absorber is kinematically detached from the extended emission line region (EELR). Its properties suggest that the absorber is outside of the EELR. We derive lower limits to the HI, HII and H column densities for this absorber of 3x10^16, 7x10^17 and 2x10^18 cm^-2, respectively. Moreover, the relatively bright emission from the active nucleus has allowed us to measure a number of ...

  8. Cyclic plasticity and lifetime of the nickel-based Alloy C-263: Experiments, models and component simulation

    Directory of Open Access Journals (Sweden)

    Maier G.

    2014-01-01

    Full Text Available The present work deals with the thermomechanical fatigue and low-cycle fatigue behavior of C-263 in two different material conditions. Microstructural characteristics and fracture modes are investigated with light and electron microscopy. The experimental results indicate that viscoplastic deformations depend on the heat treatment or rather on the current state of the microstructure. The measured data are used to adjust the parameters of a Chaboche type model and a fracture-mechanics based model for fatigue lifetime prediction. The Chaboche model is able to describe the essential phenomena of time and temperature dependent cyclic plasticity including the complex cyclic hardening during thermo-cyclic loading of both material conditions with a unique set of material parameters. This could be achieved by including an additional internal variable into the Chaboche model which accounts for changes in the precipitation microstructure during high temperature loading. Furthermore, the proposed lifetime model is well suited for a common fatigue life prediction of both investigated heats. The deformation and lifetime models are implemented into a user defined material routine. In this work, the material routine is applied for the lifetime prediction of a critical power plant component using the finite element method.

  9. Extended and Filamentary Lyman Alpha Emission from the Formation of a Protogalactic Halo at z=2.63

    CERN Document Server

    Rauch, Michael; Haehnelt, Martin G; Gauthier, Jean-Rene; Sargent, Wallace L W

    2012-01-01

    We report the observation of a further asymmetric, extended Lyman alpha emitting halo at z=2.63, from our ultra-deep, long-slit spectroscopic survey of faint high redshift emitters, undertaken with Magellan LDSS3 in the GOODS-S field. The Lya emission, detected over more than 30 kpc, is spatially coincident with a concentration of galaxies visible in deep broad-band imaging. While these faint galaxies without spectroscopic redshifts cannot with certainty be associated with one another or with the Lya emission, there are a number of compelling reasons why they very probably form a Milky Way halo-mass group at the Lya redshift. A filamentary structure, possibly consisting of Lya emission at very high equivalent width, and evidence for disturbed stellar populations, suggest that the properties of the emitting region reflect ongoing galaxy assembly, with recent galaxy mergers and star formation occurring in the group. Hence, the Lya provides unique insights into what is probably a key mode of galaxy formation at ...

  10. 改良电痉挛治疗精神病的护理%NURSING CARE OF 263 CASES PSYCHOPATHY TREATD WITH MODIFIED ELECTRIC CONVULSION

    Institute of Scientific and Technical Information of China (English)

    苏勉; 王彩琴; 姚小梅

    2006-01-01

    目的探讨改良电痉挛治疗精神病的护理.方法对263例精神病患者行改良电痉挛治疗(841例次)并进行有效的术前、术中、术后护理.结果263例精神病患者经积极治疗和护理,近期疗效良好,无1例出现严重并发症.结论改良电痉挛疗法是一种安全有效的治疗精神病的方法之一,术后的护理至关重要.

  11. Impact toughness of ternary Al–Zn–Mg alloys in as cast and homogenized condition measured in the temperature range 263–673 K

    Indian Academy of Sciences (India)

    Harish Kundar; Krishna; K Srinivasan

    2000-02-01

    Impact toughness of six Al–Zn–Mg ternary alloys are compared with two Al–Zn binary alloys and one CP aluminium metal at eight different temperatures of 263, 268, 273, 300, 373, 473, 573 and 673 K. The effects of alloying and temperature on toughness have been compared and analysed. The influence of alloying is more pronounced than that of temperature in reducing the toughness.

  12. Analysis of polymorphic TGFB1 codons 10, 25, and 263 in a German patient group with non-syndromic cleft lip, alveolus, and palate compared with healthy adults

    Directory of Open Access Journals (Sweden)

    Gressner Axel M

    2004-06-01

    Full Text Available Abstract Background Clefts of the lip, alveolus, and palate (CLPs rank among the most frequent and significant congenital malformations. Leu10Pro and Arg25Pro polymorphisms in the precursor region and Thr263Ile polymorphism in the prodomain of the transforming growth factor β1 (TGF-β1 gene have proved to be crucial to predisposition of several disorders. Methods In this study, polymorphism analysis was performed by real-time polymerase chain reaction (LightCycler and TGF-β1 levels determined by enzyme-linked immunosorbent assay. Results Only 2/60 Caucasian non-syndromic patients with CLP (3.3% carried the Arg25Pro and another 2/60 patients (3.3% the Thr263Ile genotypes, whereas, in a control group of 60 healthy Caucasian blood donors, these heterozygous genotypes were more frequent 16.7% having Arg25Pro (10/60; p Conclusions The genetic differences in codons 25 and 263 suggest that TGF-β1 could play an important role in occurrence of CLP, however, functional experiments will be required to confirm the mechanisms of disturbed development.

  13. Microarray based analysis of an inherited terminal 3p26.3 deletion, containing only the CHL1 gene, from a normal father to his two affected children

    Directory of Open Access Journals (Sweden)

    Lerone Margherita

    2011-04-01

    Full Text Available Abstract Background terminal deletions of the distal portion of the short arm of chromosome 3 cause a rare contiguous gene disorder characterized by growth retardation, developmental delay, mental retardation, dysmorphisms, microcephaly and ptosis. The phenotype of individuals with deletions varies from normal to severe. It was suggested that a 1,5 Mb minimal terminal deletion including the two genes CRBN and CNTN4 is sufficient to cause the syndrome. In addition the CHL1 gene, mapping at 3p26.3 distally to CRBN and CNTN4, was proposed as candidate gene for a non specific mental retardation because of its high level of expression in the brain. Methods and Results we describe two affected siblings in which array-CGH analysis disclosed an identical discontinuous terminal 3p26.3 deletion spanning less than 1 Mb. The deletion was transmitted from their normal father and included only the CHL1 gene. The two brothers present microcephaly, light mental retardation, learning and language difficulties but not the typical phenotype manifestations described in 3p- syndrome. Conclusion a terminal 3p26.3 deletion including only the CHL1 gene is a very rare finding previously reported only in one family. The phenotype of the affected individuals in the two families is very similar and the deletion has been inherited from an apparently normal parent. As already described for others recurrent syndromes with variable phenotype, these findings are challenging in genetic counselling because of an evident variable penetrance.

  14. Treatment of Scrapie Pathogen 263K With Tetracycline Partially Abolishes Protease-resistant Activity in vitro and Reduces Infectivity in vivo

    Institute of Scientific and Technical Information of China (English)

    YAN-JUN GUO; DE-XIN WANG; XIAO-PING DONG; JUN HAN; HAI-LAN YAO; BAO-YUN ZHANG; JIAN-MEI GAO; JIN ZHANG; XIN-LI XIAO; XIAO-FAN WANG; WEI-QIN ZHAO

    2007-01-01

    Objective To study the possible effect of tetracycline on protease-resistant activity in vitro and infectivity in vivo of a scrapie strain 263K.Methods Scrapie pathogens were incubated with tetracycline at different concentrations for various periods of time and protease-resistant PrP signals were evaluated with proteinase K-treatment and Western blots.The preparations treated with tetracycline were intracerebrally inoculated into golden hamsters and typical TSE manifestations were noted.PrPSc in brain tissues of the infected animals was detected by PrP specific Western blot assays. Results Protease-resistant PrP was significantly reduced in or removed from the preparations treated with tetracycline in a dose-dependant manner.Compared with the control group after incubated for 53.75±0.50 days,the preparations treated with 5 mmol/L and 20 mmol/L tetracycline prolonged the incubation time of 61.5±1.73 and 59.5±0.58 days (P<0.05). Conclusion Treatment of scrapie pathogen 263K with tetracycline reduces or removes its protease-resistant activity in vitro.

  15. Preliminary development plan of the ALR, the laser rangefinder for the ASTER deep space mission to the 2001 SN263 asteroid

    Directory of Open Access Journals (Sweden)

    Antonio Gil Vicente de Brum

    2011-09-01

    Full Text Available The Brazilian deep space mission ASTER, as temporarily named, plans to send a small spacecraft to encounter and investigate the triple asteroid 2001-SN263. The launch is scheduled (initially to occur in 2015, arriving in 2018. The main motivation of the mission is the development of technology and expertise to leverage the national space sector. Within the scientific goals, the investigation of the still unknown asteroid 2001-SN263. The main project guideline is to aggregate the widest possible Brazilian involvement in the platform, the development and operation of subsystems, integration, payload, as well as in the tracking, navigation, guidance and control of the probe. To meet this guideline, among others, the decision for the development of a laser altimeter in Brazil to fly in the mission was taken. This effort is currently coordinated by a group of researchers from the aerospace engineering personnel of UFABC. This article presents the preliminary development plan for the design of this instrument, which was called ALR (ASTER Laser Rangefinder.

  16. Human Pluripotent Stem Cells and Derived Neuroprogenitors Display Differential Degrees of Susceptibility to BH3 Mimetics ABT-263, WEHI-539 and ABT-199.

    Directory of Open Access Journals (Sweden)

    Carolina Paola García

    Full Text Available Human embryonic stem cells (hESCs are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs and hESCs-derived neuroprogenitors (NP. We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help

  17. Human Pluripotent Stem Cells and Derived Neuroprogenitors Display Differential Degrees of Susceptibility to BH3 Mimetics ABT-263, WEHI-539 and ABT-199

    Science.gov (United States)

    Dimopoulos, Nicolás Alexis; Fernandez Espinosa, Damián Darío; Miriuka, Santiago Gabriel; Sevlever, Gustavo Emilio; Romorini, Leonardo; Scassa, María Elida

    2016-01-01

    Human embryonic stem cells (hESCs) are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs) and hESCs-derived neuroprogenitors (NP). We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help to predict

  18. Numerical simulation for the determination of the limit drawing ratio of a cold rolled and solution treated Nimonic C-263 alloy sheet

    Energy Technology Data Exchange (ETDEWEB)

    Ankamma, Kandula; Chandra Mohan Reddy, Gangireddy [Mahatma Gandhi Institute of Technology, Hyderabad (India). Mechanil Engineering Dept.; Rama Ravindra Reddy, Pidugu Venkata [Chaitanya Bharathi Institute of Technology, Hyderabad (India). Mechanical Engineering Dept.; Nagarjuna, Settivari [Defence Metallurgical Research Lab., Hyderabad (India); Komaraiah, Methuku [Malla Reddy College of Engineering and Technology, Secunderabad (India); Eswara Prasad, Namburi [Regional Centre for Military Airworthiness (Materials), Hyderabad (India)

    2011-03-15

    Nimonic alloys are Ni-based superalloys used for several high temperature applications, notable among them are components in space vehicles, rocket engines, submarines, nuclear reactors, chemical processing vessels and heat exchange tubing, as they exhibit excellent mechanical strength and creep resistance at high temperatures. Hence, evaluation of their formability characteristics is of the utmost importance in making them into several useful components. The limit drawing ratio is one of the parameters that indicate the formability, especially the drawability of sheet material for deep drawing applications. In this paper, the limit drawing ratio of Nimonic C-263 alloy is investigated and presented using an explicit finite element code LSDYNA-3D. The material properties and the material model are evaluated through tensile testing. (orig.)

  19. Comment on “Human impacts on headwater fluvial systems in the northern and central Andes” (Carol P. Harden, Geomorphology 79, 249 263)

    Science.gov (United States)

    Buytaert, Wouter; De Bièvre, Bert; Celleri, Rolando; Cisneros, Felipe; Wyseure, Guido; Deckers, Seppe

    2008-04-01

    The high altitude grasslands of the tropical Andes, known as páramo, are a very fragile and unique ecosystem. Despite increasing human activities, many of its geomorphological and hydrological processes are still very poorly understood. We therefore welcome the paper of Harden [Harden, C.P., 2006. Human impacts on headwater fluvial systems in the northern and central Andes. Geomorphology 79, 249-263.] about "Human impacts on headwater fluvial systems in the northern and central Andes" as a valuable contribution to a better understanding of this complex ecosystem. However, in view of the available literature, we would like to complement the interpretation of the presented results and discuss some of the claims made in the paper.

  20. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets

    Indian Academy of Sciences (India)

    K Ankamma; D V V Satyanarayana; G Chandramohan Reddy; M Komaraiah; N Eswara Prasad

    2011-04-01

    An effort has been made to comprehensively evaluate and rationalize the in-plane anisotropy in tensile properties and the effect of aging on the nature of deformation (strain hardening behaviour) and formability characteristics, especially the limit drawing ratio and forming limit diagram. Despite weak crystallographic texture and excellent ductility and high work hardening exponents, the alloy sheets of C-263 exhibit significant extent of in-plane anisotropy in its tensile properties and yield loci. The absolute magnitudes of yield stress and the exact nature of anisotropy that can be predicted from the tensile part of the yield locus need to be employed with caution. This is because when the magnitudes of the yield stresses, obtained from yield locus are more than 5 times higher as compared to the yield and ultimate tensile strength values and the nature and degree of in-plane anisotropy under tensile loading matches with that of only the compressive yield stresses of yield locus. The alloy sheet, due to weak crystallographic texture and relatively high strengths, is found to be far more suitable for structural applications, rather than for deep drawing applications, which was reflected in low limit drawing ratio values (1.34 for CR+ST and 1.23 for peak aged conditions). Further, the study conducted reveals that the safer forming limits in strain space is higher for CR+ST condition; while, the safer forming limits in stress space are higher for peak aged (CR+ST+1073 K/8 h) condition. Finally, detailed studies are outlined to arrive at suitable microstructural and textural characteristics that provide significantly enhanced drawability in the Nimonic C-263 alloy sheets.

  1. Direct on-strip analysis of size- and time-resolved aerosol impactor samples using laser induced fluorescence spectra excited at 263 and 351 nm

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chuji [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Mississippi State University, Starkville, MS, 39759 (United States); Pan, Yong-Le, E-mail: yongle.pan.civ@mail.mil [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); James, Deryck; Wetmore, Alan E. [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Redding, Brandon [Yale University, New Haven, CT 06510 (United States)

    2014-04-01

    Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and

  2. Direct on-strip analysis of size- and time-resolved aerosol impactor samples using laser induced fluorescence spectra excited at 263 and 351 nm

    International Nuclear Information System (INIS)

    Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and

  3. Developing the "Precessing Inclined Bi-Elliptical Four-Body Problem with Radiation Pressure" to search for orbits in the triple asteroid 2001SN263

    Science.gov (United States)

    Masago, Bruna Yukiko Pinheiro Lopes; Prado, Antonio Fernando Bertachini de Almeida; Chiaradia, Ana Paula Marins; Gomes, Vivian Martins

    2016-02-01

    Space missions to visit small bodies of the Solar System are important steps to improve our knowledge of the Solar System. Usually those bodies do not have well known characteristics, as their gravity field, which make the mission planning a difficult task. The present paper has the goal of studying orbits around the triple asteroid 2001SN263, a Near-Earth Asteroid (NEA). A mission to this system allows the exploration of three bodies in the same trip. The distances reached by the spacecraft from those three bodies have fundamental importance in the quality of their observations. Therefore, the present research has two main goals: (i) to develop a semi-analytical mathematical model, which is simple, but able to represent the main characteristics of that system; (ii) to use this model to find orbits for a spacecraft with the goal of remaining the maximum possible time near the three bodies of the system, without the need of space maneuvers. This model is called "Precessing Inclined Bi-Elliptical Problem with Radiation Pressure" (PIBEPRP). The use of this model allow us to find important natural orbits for the exploration of one, two or even the three bodies of the system. These trajectories can be used individually or combined in two or more parts using orbital maneuvers.

  4. Optimization of the Diode-Pumped Solid State Nd:YLF Amplifier Chain for the 263 nm Drive Laser at the FAST Facility

    Science.gov (United States)

    Gillis, Julie M.; Corcovilos, Theodore A.; Edstrom, Dean R., Jr.; Ruan, Jinhao; Santucci, James K.

    The RF photoinjector of the 50 MeV superconducting electron linear accelerator at the Fermilab Accelerator Science and Technology (FAST) Facility is driven by a phase-locked laser system. The neodymium-doped yttrium-lithium fluoride (Nd:YLF) seed laser provides short (3 ps) infrared (1053 nm) pulses to an amplifier chain before conversion to ultraviolet (263 nm) through two frequency-doubling BBO crystals. The amplification section consists of seven diode-pumped solid state (DPSS) amplifiers, which increase the pulse energy of the seed laser using optically end-pumped Nd:YLF crystals. To maximize the total gain of the amplifier chain, each stage must be properly tuned with optimized optics, alignment, and laser beam characterization. In this paper we report on one of the single-pass amplifier improvements to achieve a consistent gain of 4.83 with stabilized output pulse trains for up to 1500 seed pulses. The final ultraviolet pulses imaged onto the Cs2Te photocathode of the RF electron gun have been doubled in energy to 10.2 μJ per pulse as a result of these alterations. Operated by Fermi Research Alliance, LLC under Contract No. De-AC02-07CH11359 with the United States Department of Energy.

  5. The HIV-1 Integrase Mutant R263A/K264A Is 2-fold Defective for TRN-SR2 Binding and Viral Nuclear Import*

    Science.gov (United States)

    De Houwer, Stéphanie; Demeulemeester, Jonas; Thys, Wannes; Rocha, Susana; Dirix, Lieve; Gijsbers, Rik; Christ, Frauke; Debyser, Zeger

    2014-01-01

    Transportin-SR2 (Tnpo3, TRN-SR2), a human karyopherin encoded by the TNPO3 gene, has been identified as a cellular cofactor of HIV-1 replication, specifically interacting with HIV-1 integrase (IN). Whether this interaction mediates the nuclear import of HIV remains controversial. We previously characterized the TRN-SR2 binding interface in IN and introduced mutations at these positions to corroborate the biological relevance of the interaction. The pleiotropic nature of IN mutations complicated the interpretation. Indeed, all previously tested IN interaction mutants also affected RT. Here we report on a virus with a pair of IN mutations, INR263A/K264A, that significantly reduce interaction with TRN-SR2. The virus retains wild-type reverse transcription activity but displays a block in nuclear import and integration, as measured by quantitative PCR. The defect in integration of this mutant resulted in a smaller increase in the number of two-long terminal repeat circles than for virus specifically blocked at integration by raltegravir or catalytic site mutations (IND64N/D116N/E152Q). Finally, using an eGFP-IN-labeled HIV fluorescence-based import assay, the defect in nuclear import was corroborated. These data altogether underscore the importance of the HIV-IN TRN-SR2 protein-protein interaction for HIV nuclear import and validate the IN/TRN-SR2 interaction interface as a promising target for future antiviral therapy. PMID:25063804

  6. Fabrication of High Transparency Diamond-Like Carbon Film Coating on D263T Glass at Room Temperature as an Antireflection Layer

    Directory of Open Access Journals (Sweden)

    Chii-Ruey Lin

    2013-01-01

    Full Text Available This study intends to deposit high transmittance diamond-like carbon (DLC thin films on D263T glass substrate at room temperature via a diamond powder target using the radio frequency (RF magnetron sputtering technique. Moreover, various process parameters were used to tune the properties of the thin films by using the Taguchi method. Experimental results show that the content of sp3 bonded carbon decreases in accordance with the effect of the substrate temperature. In addition, the hardness of all as-deposited single-layer DLC films ranges from 13.2 to 22.5 GPa, and the RMS surface roughness was improved significantly with the decrease in sputtering pressure. The water repellent of the deposited DLC films improved significantly with the increase of the sp3 content, and its contact angle was larger than that of the noncoated one by 1.45 times. Furthermore, the refraction index (n of all as-deposited DLC films ranges from 1.95 to 2.1 at λ = 600 nm. These results demonstrate that the thickness increased as the reflectance increased. DLC film under an RF power of 150 W possesses high transmissive ability (>81% and low average reflectance ability (<9.5% in the visible wavelengths (at λ = 400–700 nm.

  7. Oxygen-18 exchange as a measure of accessibility of CO2 and HCO3- to carbonic anhydrase in Chlorella vulgaris (UTEX 263)

    International Nuclear Information System (INIS)

    The exchange of 18O between CO2 and H2O in stirred suspensions of Chlorella vulgaris (UTEX 263) was measured using a membrane inlet to a mass spectrometer. The depletion of 18O from CO2 in the fluid outside the cells provides a method to study CO2 and HCO3- kinetics in suspensions of algae that contain carbonic anhydrase since 18O loss to H2O is catalyzed inside the cells but not in the external fluid. Low-CO2 cells of Chlorella vulgaris (grown with air) were added to a solution containing 18O enriched CO2 and HCO3- with 2 to 15 millimolar total inorganic carbon. The observed depletion of 18O from CO2 was biphasic and the resulting 18O content of CO2 was much less than the 18O content of HCO3- in the external solution. Analysis of the slopes showed that the Fick's law rate constant for entry of HCO3- into the cell was experimentally indistinguishable from zero (bicarbonate impermeable) with an upper limit of 3 x 10-4 s-1 due to experimental errors. The Fick's law rate constant for entry of CO2 to the sites of intracellular carbonic anhydrase was large, 0.013 per second, but not as great as calculated for no membrane barrier to CO2 flux (6 per second). The experimental value may be explained by a nonhomogeneous distribution of carbonic anhydrase in the cell (such as membrane-bound enzyme) or by a membrane barrier to CO2 entry into the cell or both. The CO2 hydration activity inside the cells was 160 times the uncatalyzed CO2 hydration rate

  8. Cardiovascular disease risk factor profiles of 263,356 older Australians according to region of birth and acculturation, with a focus on migrants born in Asia.

    Science.gov (United States)

    Guo, Shuyu; Lucas, Robyn M; Joshy, Grace; Banks, Emily

    2015-01-01

    Risk factors for cardiovascular disease (CVD), such as obesity, diabetes, hypertension and physical inactivity, are common in Australia, but the prevalence varies according to cultural background. We examined the relationship between region of birth, measures of acculturation, and CVD risk profiles in immigrant, compared to Australian-born, older Australians. Cross-sectional data from 263,356 participants aged 45 and over joining the population-based 45 and Up Study cohort from 2006-2008 were used. Prevalence ratios for CVD risk factors in Australian- versus overseas-born participants were calculated using modified Poisson regression, adjusting for age, sex and socioeconomic factors and focusing on Asian migrants. The association between time resident in Australia and age at migration and CVD risk factors in Asian migrants was also examined. Migrants from Northeast (n = 3,213) and Southeast Asia (n = 3,942) had lower levels of overweight/obesity, physical activity and female smoking than Australian-born participants (n = 199,356), although differences in prevalence of overweight/obesity were sensitive to body-mass-index cut-offs used. Compared to Australian-born participants, migrants from Northeast Asia were 20-30% less likely, and from Southeast Asia 10-20% more likely, to report being treated for hypertension and/or hypercholesterolaemia; Southeast Asian migrants were 40-60% more likely to report diabetes. Northeast Asian-born individuals were less likely than Australian-born to have 3 or more CVD risk factors. Diabetes, treated hypertension and hypercholesterolaemia occurred at relatively low average body-mass-index in Southeast Asian migrants. The CVD risk factor profiles of migrants tended to approximate those of Australian-born with increasing acculturation, in both favourable (e.g., increased physical activity) and unfavourable directions (e.g., increased female smoking). Minimizing CVD risk in migrant populations may be achieved through efforts to retain

  9. Days-lost to training and competition in relation to workload in 263 elite show-jumping horses in four European countries.

    Science.gov (United States)

    Egenvall, A; Tranquille, C A; Lönnell, A C; Bitschnau, C; Oomen, A; Hernlund, E; Montavon, S; Franko, M A; Murray, R C; Weishaupt, M A; Weeren, van R; Roepstorff, L

    2013-11-01

    Orthopaedic, or other, injuries in sports medicine can be quantified using the 'days-lost to training' concept. Both the training regimen and the surface used in training and racing can affect the health of racehorses. Our aim was to associate 'days-lost to training' in elite-level show-jumpers to horse characteristics, training and management strategies, and the time spent working on various training and competition surfaces. We designed a longitudinal study of professional riders in four European countries. Data were recorded using training diaries. Reasons for days-lost were classified into non-acute and acute orthopaedic, medical, hoof-related, and undefined. We produced descriptive statistics of training durations, relative to type of training, surfaces used, and days-lost. We created zero-inflated negative-binomial random-effects models using the overall days-lost as outcome. In the whole dataset, duration variables related to training surfaces were analysed as independent. The Swedish data only were also used to test whether duration variables were related to competition surfaces. Thirty-one riders with 263 horses provided data on 39,028 days at risk. Of these, 2357 (6.0%) were days-lost (55% and 22% of these were due to non-acute and acute orthopaedic injuries, respectively) in 126 horses. In the all-country model, controlling for season, a significant variable was country. Switzerland and the UK had lower incidence-rate ratios (IR) compared to Sweden (IRs 0.2 and 0.03, respectively). Horses with previous orthopaedic problems had almost a doubled IR (1.8) of days-lost due to orthopaedic injury, compared to baseline. If the horse had jumping training more than 1 min per day at risk the IRs were 6.9-7 (compared to less than this amount of time); this was, however, likely an effect of a small baseline. Variation in training was a protective factor with a dose-response relationship; the category with the highest variation had an IR of 0.1. In the Swedish model

  10. Experimental water content measurements of carbon dioxide in equilibrium with hydrates at (223.15 to 263.15) K and (1.0 to 10.0) MPa

    International Nuclear Information System (INIS)

    Highlights: • Experimental water content data for carbon dioxide in equilibrium with hydrates. • Data required for setting drying requirements in carbon dioxide streams. • Comparison of experimental data with model predictions and available literature data. -- Abstract: The environmental impact of carbon dioxide has led to the need for capture and storage processes. Whenever water is present, at conditions inside the carbon dioxide hydrate stability zone, there is the possibility of hydrate formation which can cause problems such as pipeline restriction and blockage. To avoid such problems it is essential to know how dry the carbon dioxide needs to be. The measurement of the water content of carbon dioxide in equilibrium with hydrates at different temperature and pressure conditions gives a value below which hydrates will not form. There is a scarcity of relevant experimental data especially at low temperatures (<263.15 K). This is in part due to the challenging nature of making accurate equilibrium water content measurements at these conditions. The experimental data can be used to compare with predictions made using different thermodynamic models. This paper presents experimental equipment, methods and results for the water content of carbon dioxide in equilibrium with hydrates at temperatures between (223.15 and 263.15) K and pressures between (1.0 and 10.0) MPa, hence in both vapour and liquid phases. The experimental data are compared with predictions from an in-house (previously developed) thermodynamic model

  11. Cisplatin-induced apoptosis in non-small-cell lung cancer cells is dependent on Bax- and Bak-induction pathway and synergistically activated by BH3-mimetic ABT-263 in p53 wild-type and mutant cells.

    Science.gov (United States)

    Matsumoto, Masaru; Nakajima, Wataru; Seike, Masahiro; Gemma, Akihiko; Tanaka, Nobuyuki

    2016-04-29

    Cisplatin is a highly effective anticancer drug for treatment of various tumors including non-small-cell lung cancer (NSCLC), and is especially useful in cases nonresponsive to molecular-targeted drugs. Accumulating evidence has shown that cisplatin activates the p53-dependent apoptotic pathway, but it also induces apoptosis in p53-mutated cancer cells. Here we demonstrated that DNA-damage inducible proapoptotic BH3 (Bcl-2 homology region 3)-only Bcl-2 family members, Noxa, Puma, Bim and Bid, are not involved in cisplatin-induced apoptosis in human NSCLC cell lines. In contrast, the expression of proapoptotic multidomain Bcl-2-family members, Bak and Bax, was induced by cisplatin in p53-dependent and -independent manners, respectively. Moreover, in wild-type p53-expressing cells, cisplatin mainly used the Bak-dependent apoptotic pathway, but this apoptotic pathway shifted to the Bax-dependent pathway by loss-of-function of p53. Furthermore, both Bak- and Bax-induced apoptosis was enhanced by the antiapoptotic Bcl-2 family member, Bcl-XL knockdown, but not by Mcl-1 knockdown. From this result, we tested the effect of ABT-263 (Navitoclax), the specific inhibitor of Bcl-2 and Bcl-XL, but not Mcl-1, and found that ABT-263 synergistically enhanced cisplatin-induced apoptosis in NSCLC cells in the presence or absence of p53. These results indicate a novel regulatory system in cisplatin-induced NSCLC cell apoptosis, and a candidate efficient combination chemotherapy method against lung cancers. PMID:26996126

  12. 29 CFR 1910.263 - Bakery equipment.

    Science.gov (United States)

    2010-07-01

    ... apparatus comprising a flour-handling system are run in electrical unity with one another the following... more than 24 inches above the flour, a bag rest step shall be provided. (vii) A control device for.... Hand-fed moulders shall be provided with a belt-feed device or the hopper shall be extended high...

  13. 33 CFR 263.15 - Program policies.

    Science.gov (United States)

    2010-07-01

    ... engineering design of recommended plans, in order that the reporting officer may proceed with work on plans... personal attention of the Chief of Engineers, the Director of Civil Works is authorized to approve or... accomplished by the Director of Civil Works, for the Chief of Engineers....

  14. 33 CFR 263.12 - References.

    Science.gov (United States)

    2010-07-01

    ... and Appearance of Feasibility Reports. (f) ER 1105-2-502 Public Meetings (33 CFR 209.405). (g) ER 1105-2-507 Preparation and Coordination of Environmental Statements (33 CFR 209.410). (h) ER 1105-2-800 Public Involvement: General Policies (33 CFR 380). (i) ER 1105-2-811 A-95 Clearinghouse Coordination...

  15. An X-ray diffraction and P-31 MAS NMR study of rare-earth phosphate glasses, (R2O3)(x)(P2O5)(1-x), x=0.175-0.263, R = La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er

    OpenAIRE

    Cole, Jacqueline M.; van Eck, Ernst R. H.; Mountjoy, Gavin; Anderson, Ruth; Brennan, Tessa; Bushnell-Wye, Graham; Newport, Robert J; Saunders, George A.

    2001-01-01

    An X-ray diffraction and P-31 MAS NMR study of rare-earth phosphate glasses of composition, (R2O3)(x)P2O5)(1-x), where x = 0.175-0.263 and R = La-Er (except for Pm), is presented. The structures of these materials were investigated as a function of (a) rare-earth atomic number and (b) glass composition, The results show an increase in rare-earth coordination number from six to seven as the rare-earth ion increases in size. This effect is most evident for the rare earths, Ce, Pr and Nd, and ap...

  16. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  17. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  18. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  19. A neutron diffraction and 27Al MQMAS NMR study of rare-earth phosphate glasses, (R2O3)x(P2O5)1-x, x = 0.187-0.263, R = Ce, Nd, Tb containing Al impurities

    International Nuclear Information System (INIS)

    A neutron diffraction study of four rare-earth phosphate glasses of composition (R2O3)x(P2O5)1-x, where x = 0.197, 0.235, 0.187, 0.263 and R Ce, Ce, Nd, Tb respectively is presented. The structures of these materials were investigated as a function of (a) rare-earth atomic number and (b) composition. The results show that samples containing the larger rare-earth ions (Ce3+ and Nd3+) are coordinated to seven oxygen atoms whereas the immediate environment of Tb3+ ions is six coordinate. This implies that rare-earth clustering must be present in the samples containing larger rare-earth ions although no R ... R correlations are directly observed. Terminal and bridging P-O correlations are resolved, existing in an approximately 1:1 ratio. Second-neighbour O(P)O separations are located with good accuracy and P(O)P correlations relating to the bridging chain are observed. There is also first evidence for the third neighbour correlation, P(OP)O, at ∼2.8 A. A residual feature in the neutron diffraction data, present at ∼1.8 A, is interpreted as Al-O correlations on the basis of 27Al MQMAS NMR experiments. This aluminium impurity originates from the use of aluminium oxide crucibles used in the glass synthesis and is shown to exist as a mixture of octahedral, tetrahedral and penta-coordinated Al-O species. No structural perturbations of the overall network were observed with varying sample composition. (author)

  20. Dicty_cDB: CHF263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 56 5e-31 6 AY250116 |AY250116.1 Lycopersicon pennellii aconitase mRNA, partial cds. 60 5e-26 5 AY250115 |AY250115.1 Lycopersicon pe...ACONITATE HYDRATASE, CYTOPLASMIC ;, mRNA sequence. 64 2e-20 3 BI925204 |BI925204.1 EST545093 tomato flower, buds 0-3 mm Lycopersi...0.1 EST550409 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDN...sthcfgw**lwlw*f*rlgcqrsips rn*vchchli*tys*iqsrwygyypiaiptrskclyfgshw*rtiqyrvtn**iph*nws nrkgyh*lw*if*nypsfrysnrs*il...qq*emp*kd*vviq qklthlfqli*llitlfklmyqellml*skikrlnsieimkdfhf*ngvlkhlmdylllh levvlyik*i*sil

  1. Dicty_cDB: SLC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lmqqlh*iiih*inhih*k liy*milanlpilkklinhqlekilnqnqitingyqiqkh*kvmtnl*hvmviiqifvgm rcmlvnqw*rnhrfh*phhtfmvntgs...lllsvisnhqfklilhsinll*liifqlhqrqntrn*nl f*lksikidqvlkllvfi*h*mlkeilkvlhllniqkknqq

  2. 26 CFR 1.263A-10 - Unit of property.

    Science.gov (United States)

    2010-04-01

    ... purposes of computing gain or loss on the sale of unit 1. See § 601.601(d)(2)(ii)(b) of this chapter... the swimming pool after 1995. (c) Units of tangible personal property. Components of tangible personal... tangible personal property that are produced by, or for, the taxpayer, for use by the taxpayer or a...

  3. Dicty_cDB: VHF263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n*xnwkiwntfl*tiy*vfrkkhfficsktrkyfqfki*ixrqfdxcik* *c*sn*lsityn*iekgyhngxcnk**rt*kfyknlfsqnrpydqene*kt*dgkfs...NGTNISYQNKSNYCSITISNGSIGXEYLKNDEPFQLIN*rmw*ieyfc*c ggqwqrkrifn*xnwkiwntfl*tiy*vfrkkhfficsktrkyfqfki*ixrqfdxc

  4. Dicty_cDB: SSK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15, mRNA sequen...ce. 92 2e-15 2 AI778006 |AI778006.1 EST258885 tomato susceptible, Cornell Lycoper...4 tomato root during/after fruit set, Cornell University Lycopersicon esculentum ...flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD11C15 5' end, mRNA sequence... pennellii cDNA clone cLPP8K18 5' sequence, mRNA sequence. 92 3e-15 2 BG642411 |BG642411.1 EST355887 tomato

  5. Dicty_cDB: VSI263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence t*hin*qqwkenny...gcvkhyngdnskcqtffnsm nslcpaawisewdeqkaadlfpsdrv*iyninn***yq*fiqkkrkkkr--- ---XIYSKKKKKKKEHNDINKK Frame B: t*hin*qqwkenny

  6. 26 CFR 1.263A-11 - Accumulated production expenditures.

    Science.gov (United States)

    2010-04-01

    ..., bulldozers, and buildings. A taxpayer apportions the adjusted basis of an asset used in the production of... is allocated on the basis of time: Example. In 1995, X uses a bulldozer exclusively to clear the land... bulldozer among the three projects on the basis of time. At the end of the first quarter of 1995,...

  7. Dicty_cDB: CFF263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niq kestlhlvlrlrggmqifvktltgktitlevegsdnienvkakiqdkegippdqqrlifa gkqledgrtlsdyniq...kestlhlvlrlrggmqifvktltgktitlevegsdnienvktki qdkegi Translated Amino Acid sequence (All Frames) Frame A: eil... ifvktltgkiitlevegsdnienvktkiqdkegippdqqrlifagkqledgrtlsdyniq kestlhlvlrlrggmqifvktltgktitlevegsdnienvkakiqd...kegippdqqrlifa gkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktki qdkeg

  8. 26 CFR 1.263(a)-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ... services. (iv) Creation of computer software. (v) Creation of package design. (4) Coordination with other... payments. (l) Examples. (m) Amortization. (n) Intangible interests in land (o) Effective date. (p...) Treatment of indirect payments. (l) Examples. (m) Effective date. (n) Accounting method changes. (1)...

  9. Dicty_cDB: AFH263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d pieces. 56 0.001 1 AF241642 |AF241642.1 Planococcus lilacinus telomere repeat-associated interstitial...01 1 AC017558 |AC017558.1 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in ordere...icans G20... 67 1e-09 CP000880_2513( CP000880 |pid:none) Salmonella enterica subsp. ariz... 67 1e-09 AE01407...kcpwklilkmvlvpkp*vlyv*mvvnmfmqfiisqlkek*lnqvpslqlpmkpqh ylkdvsqtldklvqdfg*yvllmehleiltskiilnstihkqifh*ninkykk Frame...FH337Q.Seq.d/ 1358 0.0 own update 2009. 4. 3 Homology vs DNA Score E Sequences producing significant alignments: (bits) Val

  10. 34 CFR 263.21 - What priority is given to certain projects and applicants?

    Science.gov (United States)

    2010-07-01

    ... Children program. A consortium of eligible entities that meets the requirements of 34 CFR 75.127 through 75..., including family-based preschool programs, emphasizing school readiness and parental skills. (3) College... subject matters, including math and science, to enable Indian students to successfully transition...

  11. 26 CFR 1.263A-9 - The avoided cost method.

    Science.gov (United States)

    2010-04-01

    ... ending inventory and cost of goods sold applying all other capitalization provisions, including, for... to cost of goods sold. (ii) Segmentation of inventory—(A) General rule. Under the simplified... inventory, dividing the average by the cost of goods sold for the year, and rounding the result to...

  12. 26 CFR 1.263A-4 - Rules for property produced in a farming business.

    Science.gov (United States)

    2010-04-01

    ... farm; the raising or harvesting of trees bearing fruit, nuts, or other crops; the raising of ornamental... crop bearing tree, an ornamental tree, a vine, a bush, sod, and the crop or yield of a plant that will... farming business includes, but is not limited to, any stock, poultry or other bird, and fish or other...

  13. 31 CFR 26.3 - Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental...

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact... Finance: Treasury Office of the Secretary of the Treasury ENVIRONMENTAL REVIEW OF ACTIONS BY MULTILATERAL... Summaries will be available for review and copying at least 120 days before scheduled consideration of...

  14. 26 CFR 1.263A-3 - Rules relating to property acquired for resale.

    Science.gov (United States)

    2010-04-01

    ... indicate activities outside the area of purchasing (e.g., a marketing representative), such activities must...) Simplified resale method—(1) Introduction. This paragraph (d) provides a simplified method for...

  15. SU-E-J-263: Dosimetric Analysis On Breast Brachytherapy Based On Deformable Image Registration

    International Nuclear Information System (INIS)

    Purpose: To quantitatively compare and evaluate the dosimetry difference between breast brachytherapy protocols with different fractionation using deformable image registration. Methods: The accumulative dose distribution for multiple breast brachytherapy patients using four different applicators: Contura, Mammosite, Savi, and interstitial catheters, under two treatment protocols: 340cGy by 10 fractions in 5 days and 825cGy by 3 fractions in 2days has been reconstructed using a two stage deformable image registration approach. For all patients, daily CT was acquired with the same slice thickness (2.5mm). In the first stage, the daily CT images were rigidly registered to the initial planning CT using the registration module in Eclipse (Varian) to align the applicators. In the second stage, the tissues surrounding the applicator in the rigidly registered daily CT image were non-rigidly registered to the initial CT using a combination of image force and the local constraint that enforce zero normal motion on the surface of the applicator, using a software developed in house. We calculated the dose distribution in the daily CTs and deformed them using the final registration to convert into the image domain of the initial planning CT. The accumulative dose distributions were evaluated by dosimetry parameters including D90, V150 and V200, as well as DVH. Results: Dose reconstruction results showed that the two day treatment has a significant dosimetry improvement over the five day protocols. An average daily drop of D90 at 1.3% of the prescription dose has been observed on multiple brachytherapy patients. There is no significant difference on V150 and V200 between those two protocols. Conclusion: Brachytherapy with higher fractional dose and less fractions has an improved performance on being conformal to the dose distribution in the initial plan. Elongated brachytherapy treatments need to consider the dose uncertainty caused by the temporal changes of the soft tissue

  16. What Do Students Pay for College? Web Tables. NCES 2012-263

    Science.gov (United States)

    Ginder, Scott; Mason, Marcinda

    2012-01-01

    The Integrated Postsecondary Education Data System (IPEDS) has long collected and reported data on tuition, required fees, and room and board charges for first-time, full-time undergraduate (FTFTUG) students. These charges, along with other miscellaneous expenses, constitute what is known as the "published price of attendance" or the "cost of…

  17. 264-263 a.C. : la campaña de Ap. Claudio en Sicilia

    OpenAIRE

    Gómez de Caso Zuriaga, Jaime

    2003-01-01

    El artículo trata de reconstruir el primer año de campaña de la Primera Guerra Púnica, precisando los movimientos militares en las operaciones por tierra y concluyendo que ya en las fuentes antiguas se encuentran entremezclados acontecimientos de esta campaña y de la siguiente, por lo que intenta dilucidar lo que pertenece a cada una en fimción de la lógica de las operaciones y de la topografía. This is an attempt to a hypothetical reconstruction of the fírst year of the First Pun...

  18. 34 CFR 263.20 - What definitions apply to the Demonstration Grants for Indian Children program?

    Science.gov (United States)

    2010-07-01

    ... under the Tribally Controlled College or University Assistance Act of 1978, and the Navajo Community... education means an accredited college or university within the United States cited in section 532 of the... of State or local government. Professional development activities means in-service training...

  19. Nuclear Technology. Course 26: Nondestructive Examination (NDE) Techniques I. Module 26-3, Hydrostatic Tests.

    Science.gov (United States)

    Pelton, Rick; Espy, John

    This third in a series of seven modules for a course titled Nondestructive Examination (NDE) Techniques I describes the principles and practices associated with hydrostatic testing. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student,…

  20. 34 CFR 263.10 - What are the payback reporting requirements?

    Science.gov (United States)

    2010-07-01

    ...-time student. (b) Work-related payback. If the participant proposes a work-related payback, the written... based upon the amount of time the work-related payback has been completed. (c) Cash payback. If a cash... for payments. (Approved by the Office of Management and Budget under control number...

  1. Yeast Interacting Proteins Database: YNL263C, YGR172C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ows with this prey as prey (3) Rows with this prey as bait Rows with this prey as bait (0) Literature on bait (YPD) 6 Literature... on prey (YPD) 6 Literature shared by bait and prey 3 Literature

  2. 26 CFR 1.263(a)-4 - Amounts paid to acquire or create intangibles.

    Science.gov (United States)

    2010-04-01

    ... system. N purchases a customer list from R corporation. N pays R $100,000 in exchange for the customer... independent registrar to obtain a certification from the registrar that Z's quality management system conforms... providing wireless telecommunications services to customers. To induce customer B to enter into a 3-year...

  3. 34 CFR 263.3 - What definitions apply to the Professional Development program?

    Science.gov (United States)

    2010-07-01

    ... collaboration, feedback, and peer networking and support. In-service training means professional activities and...) Periodic assessment of, and feedback sessions on, the participant's performance, provided in...

  4. 26 CFR 1.263A-8 - Requirement to capitalize interest.

    Science.gov (United States)

    2010-04-01

    ... by an unrelated buyer, is not treated as real property by the producing taxpayer (e.g., bricks, nails..., railroad tracks and signals, telephone poles, power generation and transmission facilities,...

  5. Turbo-Equalised H.263-based Video Telephony for GSM/GPRS

    OpenAIRE

    Cherriman, P.J.; Yeap, B.L.; Hanzo, L

    2001-01-01

    The performance of turbo-equalised GSM/GPRS-like videophone transceivers is studied over dispersive fading channels as a function of the number of turbo-equalisation iterations. Iteration gains in excess of 4 dB were attained. The proposed system is capable of providing low-resolution videophone services over GSM/GPRS.

  6. Mobilization of sulfur by green sulfur bacteria : physiological and molecular studies on Chlorobaculum parvum DSM 263

    OpenAIRE

    Donà, Clelia

    2011-01-01

    Green sulfur bacteria are photolithotrophs that use inorganic sulfur compounds as electron donors for photosynthesis. Elemental, solid sulfur is one of the electron donors used. Sulfur is produced by green sulfur bacteria during the oxidation of sulfide to sulfate, and during the oxidation of thiosulfate to sulfur and sulfate. Green sulfur bacteria have been known for long, and the genomes of 12 strains have been sequenced. Yet, it is not clear how green sulfur bacteria can access elemental s...

  7. 26 CFR 1.263A-1 - Uniform capitalization of costs.

    Science.gov (United States)

    2010-04-01

    ... method if the market valuation used by the taxpayer generally equals the property's fair market value... identification method traces costs to a cost objective, such as a function, department, activity, or product, on... objective. (3) Burden rate and standard cost meth- ods—(i) Burden rate method—(A) In gen- eral. A...

  8. 45 CFR 263.5 - When do expenditures in State-funded programs count?

    Science.gov (United States)

    2010-10-01

    ... allowable under the former AFDC, JOBS, Emergency Assistance, Child Care for AFDC recipients, At-Risk Child... previously authorized and allowable under the former AFDC, JOBS, Emergency Assistance, Child Care for...

  9. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  10. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  11. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval

    Science.gov (United States)

    2011-01-25

    ... record. 75 FR 27205 (Final Rule). The Final Rule titled, Hazardous Materials: Incorporation of Special... hazardous materials such as PIH materials (HM-246; 74 FR 1770 (Jan. 13, 2009) (the ``Tank Car Rule'')), FRA... implement a crashworthiness performance standard as discussed in the Tank Car Rule. See 74 FR at 1771....

  12. AFSC/RACE/EcoFOCI: 2011 Gulf of Alaska IERP Cruise TN263/1TT11

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A total of 105 stations were occupied. There were two sample grids (southeast Alaska and Yakutat Bay) and two transects in the vicinity of Kayak Island. At each...

  13. 40 CFR 421.263 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... provided in 40 CFR 125.30 through 125.32, any existing point source subject to this subpart shall achieve... Wet Air Pollution Control 2 2 This allowance applies to either acid or alkaline wet air pollution control scrubbers. If both acid and alkaline wet air pollution control scrubbers are present in...

  14. Luis Razeto, En búsqueda del ser y de la verdad perdidos, Universidad Bolivariana, Santiago, 2004, 263 p.

    OpenAIRE

    Yáñez Artus, Samuel

    2012-01-01

    El problema radical y crucial se halla en el concepto mismo de realidadXavier Zubiri Es una experiencia grata leer un buen libro de buena filosofía, como éste que aquí comento. Acabo de terminar una primera lectura y, por ello mismo, esta presentación hay que circunscribirla en los límites de una aproximación inicial. La meditación filosófica requiere segundas, terceras y cuartas lecturas y, a mi juicio, este libro invita a hacerlas. No haré una descripción detallada de la obra. Lo que deseo,...

  15. Physical modeling of triple near-Earth Asteroid (153591) 2001 SN263 from radar and optical light curve observations

    Czech Academy of Sciences Publication Activity Database

    Becker, T.M.; Howell, E. S.; Nolan, M. C.; Magri, C.; Pravec, Petr; Taylor, P.A.; Oey, J.; Higgins, D.; Világi, J.; Kornoš, L.; Galád, A.; Gajdoš, Š.; Gaftonyuk, N. M.; Krugly, Y. N.; Molotov, I.E.; Hicks, M. D.; Carbognani, A.; Warner, B. D.; Vachier, F.; Marchis, F.; Pollock, J.

    2015-01-01

    Roč. 248, March (2015), s. 499-515. ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229 Grant ostatní: SAV(SK) Vega1/0670/13 Institutional support: RVO:67985815 Keywords : asteroids * near- Earth objects * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  16. 77 FR 263 - Certain Cut-To-Length Carbon-Quality Steel Plate From Italy and Japan: Revocation of Antidumping...

    Science.gov (United States)

    2012-01-04

    ... scope are high strength, low alloy (``HSLA'') steels. HSLA steels are recognized as steels with micro...-Quality Steel Plate From India, Indonesia, Italy, Japan, and Korea, 76 FR 80963 (December 27, 2011) and...''), respectively. See Initiation of Five-Year (``Sunset'') Review, 75 FR 67082 (November 1, 2010). As a result...

  17. A THREE-POSITION SPECTRAL LINE SURVEY OF SAGITTARIUS B2 BETWEEN 218 AND 263 GHz. II. DATA ANALYSIS

    OpenAIRE

    Nummelin, A.; Bergman, ; P.; Hjalmarson, Å.; Friberg, P.; IRVINE, W.M; Millar, T. J.; OhiShi, M; Saito, S.

    2000-01-01

    We present an analysis of the data from our Swedish-ESO Submillimetre Telescope molecular line survey in the 1.3 mm band of the N, M, and NW positions in the Sgr B2 molecular cloud. The line emissions from 42 molecular species, and some of their isotopomers, were analyzed assuming a single temperature and a homogeneous source. In cases where a source size much smaller than the antenna beam (23″) could be estimated, optical depth effects were also accounted for. In this way rotation temperatur...

  18. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  19. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  20. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  1. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  2. Technical-evaluation report on the monitoring of electric power to the reactor-protection system for the Monticello Nuclear Generating Plant. Docket No. 50-263

    International Nuclear Information System (INIS)

    This report documents the technical evaluation of the monitoring of electric power to the reactor protection system (RPS) at the Monticello Nuclear Generating Plant. The evaluation is to determine if the proposed design modification will protect the RPS from abnormal voltage and frequency conditions which could be supplied from the power supplies and will meet certain requirements set forth by the Nuclear Regulatory Commission. The proposed design modifications will protect the RPS from sustained abnormal voltage and frequency conditions from the supplying sources

  3. Investigations on ideal mode of cell disruption in extremely halophilic Actinopolyspora halophila (MTCC 263 for efficient release of glycine betaine and trehalose

    Directory of Open Access Journals (Sweden)

    Jayaranjan R. Kar

    2015-03-01

    Full Text Available Actinopolyspora halophila produces glycine betaine and trehalose intracellularly in considerable quantities. These biomolecules are commercially important as they have applications in food, pharmaceuticals, and agricultural sector. Development of an efficient cell disruption technique is an important step for the release of these biomolecules. In this study, various cell disruption methods such as chemical, enzymatic, physico-mechanical and physical methods were evaluated. Cell disruption by osmotic shock was found to be the best suited method for A. halophila which also has a potential to be industrially scaled up. Cell bursting pressure that is generated during osmotic shock in A. halophila was computed using Morse equation and was found to be π = 238.37 ± 29.54 atm or 2.35 ± 0.29 kPa. In addition, it was found that osmotic shock followed a first order release rate kinetics in A. halophila. The findings can be used for commercially important biomolecules from other halophilic and/or halotolerant microbes.

  4. High cortisol in 5-year-old children causes loss of DNA methylation in SINE retrotransposons: a possible role for ZNF263 in stress-related diseases

    OpenAIRE

    Nätt, Daniel; Johansson, Ingela; Faresjö, Tomas; Ludvigsson, Johnny; Thorsell, Annika

    2015-01-01

    Background Childhood stress leads to increased risk of many adult diseases, such as major depression and cardiovascular disease. Studies show that adults with experienced childhood stress have specific epigenetic changes, but to understand the pathways that lead to disease, we also need to study the epigenetic link prospectively in children. Results Here, we studied a homogenous group of 48 5-year-old children. By combining hair cortisol measurements (a well-documented biomarker for chronic s...

  5. 26 CFR 1.263(a)-5 - Amounts paid or incurred to facilitate an acquisition of a trade or business, a change in the...

    Science.gov (United States)

    2010-04-01

    ... distributing proxy statements requesting shareholder approval of a transaction described in paragraph (a) of... solicitations and other documents seeking shareholder approval of a transaction described in paragraph (a) of... intent, exclusivity agreement, or similar written communication (other than a confidentiality...

  6. Health Manpower Source Book. Manpower Supply and Educational Statistics for Selected Health Occupations: 1968. Public Health Service Publication Number 263, Section 20.

    Science.gov (United States)

    National Institutes of Health (DHEW), Bethesda, MD. Bureau of Health Professions Education and Manpower Training.

    This publication is a compilation of statistics on supply and education of health manpower in medicine and osteopathy, dentistry, optometry, pharmacy, podiatry, veterinary medicine, nursing, public health, and eight selected allied health occupations. The material is organized by occupations and the following information is presented for each…

  7. Days-lost to training and competition in relation to workload in 263 elite show-jumping horses in four European countries

    NARCIS (Netherlands)

    Egenvall, A; Tranquille, C A; Lönnell, A C; Bitschnau, C; Oomen, A; Hernlund, E; Montavon, S; Franko, M A; Murray, R C; Weishaupt, M A; Weeren, van R; Roepstorff, L; van Weeren, René

    2013-01-01

    Orthopaedic, or other, injuries in sports medicine can be quantified using the 'days-lost to training' concept. Both the training regimen and the surface used in training and racing can affect the health of racehorses. Our aim was to associate 'days-lost to training' in elite-level show-jumpers to h

  8. Inhibition of KIT-glycosylation by 2-deoxyglucose abrogates KIT-signaling and combination with ABT-263 synergistically induces apoptosis in gastrointestinal stromal tumor.

    Directory of Open Access Journals (Sweden)

    Thomas Mühlenberg

    Full Text Available Positron emission tomography (PET with 18F-fluorodeoxyglucose (FDG is frequently used for visualizing gastrointestinal stromal tumors (GIST, which are highly glucose-avid tumors. Dramatic metabolic responses following imatinib treatment indicate a high, KIT-dependent glucose turnover which has been particularly helpful for predicting tumor response to imatinib. The glucose analogue 2-deoxyglucose (2DG inhibits glucose metabolism in cancer cells that depend on aerobic glycolysis for ATP production. We show that 2DG inhibits proliferation in both imatinib-sensitive and imatinib-resistant GIST cell lines at levels that can be achieved clinically. KIT-negative GIST48B have 3-14-fold higher IC50 levels than KIT-positive GIST cells indicating that oncogenic KIT may sensitize cells to 2DG. GIST sensitivity to 2DG is increased in low-glucose media (110 mg/dl. 2DG leads to dose- and glucose dependent inhibition of KIT glycosylation with resultant reduction of membrane-bound KIT, inhibition of KIT-phosphorylation and inactivation of KIT-dependent signaling intermediates. In contrast to imatinib, 2DG caused ER-stress and elicited the unfolded protein response (UPR. Mannose but not pyruvate rescued GIST cells from 2DG-induced growth arrest, suggesting that loss of KIT integrity is the predominant effect of 2DG in GIST. Additive anti-tumoral effects were seen with imatinib and BH3-mimetics. Our data provide the first evidence that modulation of the glucose-metabolism by 2DG may have a disease-specific effect and may be therapeutically useful in GIST.

  9. Supplementary Info. to T. Elliot & P.L. Younger, Detection of mixing dynamics during pumping of a flooded coal mine. Groundwater, 52(2): 251–263

    OpenAIRE

    Elliot, Trevor; Younger, P. L.

    2013-01-01

    Contains 9 pages of text covering the History of the Deerplay workings, Test pumping of the Abstraction Borehole on Deerplay Moor, Methodology, Mineral Saturation Indices, Sulfur isotope systematics. Tables S1 and S2. Figures S1 to S5.

  10. Days-lost to training and competition in relation to workload in 263 elite show-jumping horses in four European countries

    OpenAIRE

    Egenvall, Agneta; Tranquille, Carolyne; Lönnell, AC; Bitschnau, C; Oomen, A.; Hernlund, Elin Linnea; Montavan, S; Franko Andersson, M; Murray, RC; Weishaupt, MA; van Weeren, R.; Roepstorff, Lars

    2013-01-01

    Orthopaedic, or other, injuries in sports medicine can be quantified using the ‘days-lost to training’ concept. Both the training regimen and the surface used in training and racing can affect the health of racehorses. Our aim was to associate ‘days-lost to training’ in elite-level show-jumpers to horse characteristics, training and management strategies, and the time spent working on various training and competition surfaces. We designed a longitudinal study of professional riders in four Eu...

  11. Equilibration of the N/Z collective degree in the deep inelastic interaction of 263 MeV 40Ar and 238U and several other similar systems

    International Nuclear Information System (INIS)

    Some recent data of isotopic distributions obtained in the bombardment of heavy targets by Ar and S projectiles are presented. A classical diffusion is shown to reproduce fairly well the first and the second moments of these isotopic distributions. (orig.)

  12. Genome-wide scan of granular corneal dystrophy, type II: confirmation of chromosome 5q31 and identification of new co-segregated loci on chromosome 3q26.3

    OpenAIRE

    Lee, Eun-Ju; Kim, Kwang Joong; Kim, Han-Na; Bok, Jeong; Jung, Sung-Chul; Kim, Eung Kweon; Lee, Jong-Young; Kim, Hyung-Lae

    2011-01-01

    Granular corneal dystrophy, type II (CGD2; Avellino corneal dystrophy) is the most common corneal dystrophy among Koreans, but its pathophysiology is still poorly understood. Many reports showed that even though the causative mutation is the same TGFBI R124H mutation, there are severe and mild phenotypes of the corneal dystrophy. We also observed the phenotype differences in our samples. For this reason, we focused our effort on the identification of unknown genetic factor related to phenotyp...

  13. Comment on "Radiative effect on natural convection flows in porous media, A.A. Mohammadein, M. A. Mansour, Sahar M. Abd El Gaied and Rama Subba Reddy Gorla [Transport in Porous Media 32:263-283, 1998]"

    OpenAIRE

    Pantokratoras, Asterios

    2007-01-01

    In the above paper the authors treat the natural convection boundary layer flow in a Darcy-Brinkman-Forchheimer porous medium. In the energy equation the radiation effect has been taken into account. A two-parameter perturbation method is used for the solution of the equations. The first order results are presented in tables and figures. This is an interesting work but there are some weak points which are presented below:

  14. Comment on Radiative effect on natural convection flows in porous media, A.A. MOHAMMADEIN, M. A. MANSOUR, SAHAR M. ABD EL GAIED and RAMA SUBBA REDDY GORLA [Transport in Porous Media 32:263-283, 1998

    CERN Document Server

    Pantokratoras, Asterios

    2007-01-01

    In the above paper the authors treat the natural convection boundary layer flow in a Darcy-Brinkman-Forchheimer porous medium. In the energy equation the radiation effect has been taken into account. A two-parameter perturbation method is used for the solution of the equations. The first order results are presented in tables and figures. This is an interesting work but there are some weak points which are presented below:

  15. SU-E-T-263: Point Dose Variation Using a Single Ir-192 HDR Brachytherapy Plan for Two Treatments with a Single Tandem-Ovoid Insertion for Cervical Cancer

    International Nuclear Information System (INIS)

    Purpose: To evaluate the point dose variations between Ir-192 HDR treatments on two consecutive days using a single tandem-ovoid insertion without replanning in cervical cancer patients. Methods: This study includes eleven cervical cancer patients undergoing HDR brachytherapy with a prescribed dose of 28 Gy in 4 fractions. Each patient had two tandemovoid insertions one week apart. Each insertion was treated on consecutive days with rescanning and replanning prior to each treatment. To study the effect of no replanning for day 2 treatments, the day 1 plan dwell position and dwell time with decay were applied to the day 2 CT dataset. The point dose variations on the prescription point H (defined according to American Brachytherapy Society), and normal tissue doses at point B, bladder, rectum and vaginal mucosa (based on ICRU Report 38) were obtained. Results: Without replanning, the mean point H dose variation was 4.6 ± 10.7% on the left; 2.3 ± 2.9% on the right. The mean B point variation was 3.8 ± 4.9% on the left; 3.6 ± 4.7% on the right. The variation in the left vaginal mucosal point was 12.2 ± 10.7%; 9.5 ± 12.5% on the right; the bladder point 5.5 ± 7.4%; and the rectal point 7.9 ± 9.1%. Conclusion: Without replanning, there are variations both in the prescription point and the normal tissue point doses. The latter can vary as much as 10% or more. This is likely due to the steep dose gradient from brachytherapy compounded by shifts in the positions of the applicator in relationship to the patients anatomy. Imaging prior to each treatment and replanning ensure effective and safe brachytherapy are recommended

  16. María Julia Olivan y Pablo Alabarces. 678. La creación de otra realidad : Editorial Paidós, Buenos Aires, 2010, 263 páginas

    OpenAIRE

    Bilyk, Pablo Andrés

    2012-01-01

    Sin dudas, 678. La creación de otra realidad inicia el camino de una amplia serie de estudios que, en adelante, dedicarán sus esfuerzos a problematizar las características, rupturas, reproducciones, alcances y limitaciones que presenta este programa televisivo, en el marco de los nuevos entramados mediáticos argentinos. (Párrafo extraído del texto a modo de resumen)

  17. Quality of Student Paper Sources Improves after Individual Consultation with Librarians. A Review of: Reinsfelder, T. L. (2012. Citation analysis as a tool to measure the impact of individual research consultations. College & Research Libraries, 73(3, 263-277.

    Directory of Open Access Journals (Sweden)

    Laura Newton Miller

    2013-06-01

    Full Text Available Objective – To determine whether the quality of sources used for a research paper will improve after a student receives one-on-one instruction with a librarian. To test citation analysis and a rating scale as means for measuring effectiveness of one-on-one consultations.Design – Citation analysis.Setting – Academic library of a large American university.Subjects – Papers from 10 courses were evaluated. In total, 76 students were asked to meet with librarians. Of these, 61 actually participated. Another 36 students from the control group were not asked to meet with a librarian (although 1 partook in a consultation.Methods – Librarians invited faculty to participate in a new service to help improve quality of student research papers. Eligible courses included those with a required research paper component where papers could be evaluated at different times in the project. Faculty instructed students in the class to meet with the librarian after a first draft of a paper was written. Students from seven courses were asked to meet with a librarian. Courses included English Composition (2, Geography (1, Child Development (1, Occupational Therapy (1, Marketing (1 and Women Writers (1. Three courses acted as control groups (all English Composition. After meeting with students to make recommendations, librarians used a rating scale (measuring relevancy, authority, appropriate dates and scope to review the quality of sources in both drafts and final papers.Main Results – One-on-one consultations with a librarian resulted in sources being of a higher quality in the final paper. With the exception of authority, the differences between draft and final paper were statistically significant in all measures (overall quality, relevance, dates and scope. Those in the control group showed no improvement in quality of sources between draft and final paper.Conclusion – Quality of sources in final paper improves after one-on-one consultations with librarians. The use of a rating scale is helpful in objectively measuring quality of sources, although there is potential for subjective interpretation.

  18. Decree of the Czech Labor Safety Office No. 263/1991 amending the Decree No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector

    International Nuclear Information System (INIS)

    Some provisions of the Decree of the Czech Labor Safety Office No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector are amended, particularly in the field of construction activities, assembling, reconstruction and repair of nuclear power facilities. The Decree entered into force on 28 June 1991. (J.B.)

  19. El Tribunal General de la UE clarifica el concepto de actos impugnables por los particulares según el artículo 263(4 TFUE: La sentencia “Microban”

    Directory of Open Access Journals (Sweden)

    Luis González Vaqué

    2012-01-01

    Full Text Available The General Court (Fourth Chamber, Extended Composition annulled Commission Decision 2010/169/EU of 19 March 2010 concerning the non-inclusion of 2,4,4’-trichloro-2’-hydroxydiphenyl ether in the Union list of additives which may be used in the manufacture of plastic materials and articles intended to come into contact with foodstuffs under Directive 2002/72/EC. The General Court concluded that the Commission infringed Regulation No 1935/2004 and Directive 2002/72 in adopting a decision not to include an additive solely on the basis of the withdrawal of the initial application for inclusion of triclosan in the positive list, in circumstances where there was no legal basis allowing the adoption of such a decision; and also declared that it could not be held that the contested decision entailed implementing measures: therefore declared that that decision constituted a regulatory act of direct concern to the applicants, which did not entail any implementing measures, so that the plea of inadmissibility raised by the Commission had to be dismissed without it being necessary to consider whether it was of individual concern to the applicants.

  20. Protein (Cyanobacteria): 470825 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YGHEIYFGERGYKNSGGHLQPCPEWLIKNYAERLKLKFHYTFIPLIESIRIITFLKSIFPFLIAKKNHRKGLNAAINIWLIYK ... ...ical protein P9202_263 Prochlorococcus marinus str. MIT 9202 MALEIIEHLDYGYNLFKIFNNTLSNDGFALLSSPNNNSALDRYNFIR

  1. Drug: D08292 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08292 Drug Olaquindox (INN); Olaquindox [veterinary] (TN) C12H13N3O4 263.0906 263....2493 D08292.gif Antiinfective, antibacterial, veterinary Quinoxalin DNA synthesis inhibitor Antiinfectives [

  2. Non-stationarity of the quasi-perpendicular bow shock: comparison between Cluster observations and simulations

    Czech Academy of Sciences Publication Activity Database

    Comisel, H.; Scholer, M.; Souček, Jan; Matsukiyo, S.

    2011-01-01

    Roč. 29, č. 2 (2011), s. 263-274. ISSN 0992-7689 Institutional research plan: CEZ:AV0Z30420517 Keywords : bow shock * Cluster * plasma waves * shock waves Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.842, year: 2011 http://www.ann-geophys.net/29/263/2011/angeo-29-263-2011.pdf

  3. Reference Librarians use Electronic Sources Six Times More than Print Sources to Answer Patrons' Questions. A review of: Bradford, Jane T., Barbara Costello, and Robert Lenholt. “Reference Service in the Digital Age: An Analysis of Sources Used to Answer Reference Questions.” The Journal of Academic Librarianship 31.3 (May 2005: 263-72.

    Directory of Open Access Journals (Sweden)

    Lorie A. Kloda

    2006-06-01

    Full Text Available Objective – To test the hypothesis that electronic sources are used by librarians more often than print sources to answer questions at the reference desk. Design – Use study. Setting – Small, private university in the United States. Subjects – Five full-time and two part‐time librarians working at the reference desk for four months (two months in the fall of 2002, and two months in the spring of 2003. Methods – The study recorded every question asked by library patrons during the two study periods, with the exception of non‐library related directional questions and hardware problems. For each question recorded, librarians, while working solo at the reference desk, paraphrased the question and recorded the source(s used to answer each question. Although questions were recorded regardless of source – in person, via email, or by telephone – the medium in which each question was asked and answered was not recorded. For the first half of the study period (fall 2002 semester, librarians kept manual records that were subsequently transcribed into a spreadsheet by a student assistant. In the second half of the study period (spring 2003 semester, the librarians entered data directly into a spreadsheet. The study’s data monitor (who was also a study participant was responsible for ensuring the integrity of the data and for assigning a category to each source. The source category ‘librarian’ was problematic in that it was unclear whether or not the actual source of the answer was the librarian or a source located by the librarian. After the first half of the study, the procedure was changed to require that a reference librarian was to label a source used to answer a question as ‘librarian’ only if the answer came from a librarian’s own knowledge, and if it did not require consultation of an outside source. Categories were generated on the fly, as the data monitor reviewed the recorded questions and sources. By the end of the study, 23 categories had emerged. While all sources for answers were categorized, questions themselves were not. During the second part of the study, the gender of the patron asking the question at the reference desk was also recorded. Main results –The results for the fall 2002 and spring 2003 semesters were similar. For the entire study period, librarians used a total of 3,487 sources to answer 2,491 questions. Sources fell into 23 different categories. The top 5 categories used to answer reference questions were databases (23.92%, librarians (23.6%, library catalogue (15.03%, internal Web page (12.27%, and reference books (9.38%. The top five categories accounted for 84.2% of all sources used. For 75% of the questions, librarians referred to a single source for an answer. Almost 60% of the sources used to answer questions were electronic. Of the internal Web pages used to answer questions, the library’s online journal title listings accounted for 76%. Reference books were used to answer questions in less than 10% of cases. Less than 2% of the library’s print reference collection (173 of 9,587 titles was consulted to answer reference questions during the study period. The approximate 60:40 ratio of questions asked by female to male patrons corresponded to the university’s student body ratio. Conclusion – The results of this study confirm the researchers’ hypothesis that librarians use electronic sources with greater frequency than they use print sources to answer patrons’ reference questions. The surprising finding in this study is the proportion (approximately one quarter of reference questions answered by the librarians themselves, without the need to consult an outside source, either print or electronic. The study suggests that a large proportion of the reference collection goes unused in answering patrons’ questions and that librarians often answer a question using only a single a source of information. A reshelving study analyzing use of the reference collection is underway to supplement the results of the current study.

  4. Statistical Measures Alone Cannot Determine Which Database (BNI, CINAHL, MEDLINE, or EMBASE Is the Most Useful for Searching Undergraduate Nursing Topics. A Review of: Stokes, P., Foster, A., & Urquhart, C. (2009. Beyond relevance and recall: Testing new user-centred measures of database performance. Health Information and Libraries Journal, 26(3, 220-231.

    Directory of Open Access Journals (Sweden)

    Giovanna Badia

    2011-03-01

    Full Text Available Objective – The research project sought to determine which of four databases was the most useful for searching undergraduate nursing topics. Design – Comparative database evaluation. Setting – Nursing and midwifery students at Homerton School of Health Studies (now part of Anglia Ruskin University, Cambridge, United Kingdom, in 2005-2006. Subjects – The subjects were four databases: British Nursing Index (BNI, CINAHL, MEDLINE, and EMBASE.Methods – This was a comparative study using title searches to compare BNI (BritishNursing Index, CINAHL, MEDLINE and EMBASE.According to the authors, this is the first study to compare BNI with other databases. BNI is a database produced by British libraries that indexes the nursing and midwifery literature. It covers over 240 British journals, and includes references to articles from health sciences journals that are relevant to nurses and midwives (British Nursing Index, n.d..The researchers performed keyword searches in the title field of the four databases for the dissertation topics of nine nursing and midwifery students enrolled in undergraduate dissertation modules. The list of titles of journals articles on their topics were given to the students and they were asked to judge the relevancy of the citations. The title searches were evaluated in each of the databases using the following criteria: • precision (the number of relevant results obtained in the database for a search topic, divided by the total number of results obtained in the database search;• recall (the number of relevant results obtained in the database for a search topic, divided by the total number of relevant results obtained on that topic from all four database searches;• novelty (the number of relevant results that were unique in the database search, which was calculated as a percentage of the total number of relevant results found in the database;• originality (the number of unique relevant results obtained in the database for a search topic, which was calculated as a percentage of the total number of unique results found in all four database searches;• availability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant results found in the database;• retrievability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant full text articles found from all four database searches;• effectiveness (the probable odds that a database will obtain relevant search results;• efficiency (the probable odds that a database will obtain both unique and relevant search results; and• accessibility (the probable odds that the full text of the relevant references obtained from the database search are available electronically or in print via the user’s library.Students decided whether the search results were relevant to their topic by using a “yes/no” scale. Only record titles were used to make relevancy judgments.Main Results – Friedman’s Test and odds ratios were used to compare the performance of BNI, CINAHL, MEDLINE, and EMBASE when searching for information about nursing topics.These two statistical measures demonstrated the following:• BNI had the best average score for the precision, availability, effectiveness, and accessibility of search results;• CINAHL scored the highest for the novelty, retrievability, and efficiency of results, and ranked second place for all the other criteria;• MEDLINE excelled in the areas of recall and originality, and ranked second place for novelty and retrievability; and• EMBASE did not obtain the highest, or second highest score, for any of the criteria.Conclusion – According to the authors, these results suggest that none of the databases studied can be considered the most useful for searching undergraduate nursing topics. CINAHL and MEDLINE emerge as consistently good performers, but both databases are needed to find relevant material on a topic.Friedman’s Test clearly differentiated between the databases for the accessibility of search results. Odds ratio testing may assist librarians to make decisions about database purchases. BNI scored the highest for availability of results and CINAHL ranked the highest for retrievability. Statistical measures need to be supplemented with qualitative data about user preferences in order to determine which database is the most useful to our users.

  5. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  6. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  7. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  8. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  9. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  10. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  11. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  12. AcEST: BP911741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000008_F05 444 Adiantum capillus-veneris mRNA. clone: YMU001_000008_F05. BP911741 - Show ... 54/95 (56%) Frame = -3 Query: 442 EVYAYILAAKERRFSHIFPS DGTFWLLGSAAFRNGCQVMCMLGIDWRSEALKGLGAGYKL 263 E ++L ... 53/95 (55%) Frame = -3 Query: 442 EVYAYILAAKERRFSHIFPS DGTFWLLGSAAFRNGCQVMCMLGIDWRSEALKGLGAGYKL 263 E ++L ... 51/95 (53%) Frame = -3 Query: 442 EVYAYILAAKERRFSHIFPS DGTFWLLGSAAFRNGCQVMCMLGIDWRSEALKGLGAGYKL 263 E ++L ... R F+ +FPS ... T+WL + N + + +D+ S ++ + GY+ Sbjct: 573 ESLGFLLDHPR ...

  13. Mapping the Structural Requirements in the CB1 Cannabinoid Receptor Transmembrane Helix II for Signal Transduction

    OpenAIRE

    Kapur, Ankur; Samaniego, Patrick; Thakur, Ganesh A.; Makriyannis, Alexandros; Abood, Mary E.

    2008-01-01

    Amino acid residues in the transmembrane domains of the CB1 receptor are important for ligand recognition and signal transduction. We used site-directed mutagenesis to identify the role of two novel and adjacent residues in the transmembrane helix II domain, Ile2.62 and Asp2.63. We investigated the role of the conserved, negatively charged aspartate at position 2.63 in cannabinoid receptor (CB1) function by substituting it with asparagine (D2.63N) and glutamate (D2.63E). In addition, the effe...

  14. 英文摘要

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Lunch with Warren Buffett setsnewrecord Thepriceofaprivatelunchwithrevered investorWarrenBuffetttoppedlastyear's bidonthefinaldayoftheweeklongcontest, after the winning bidder agreed to pay morethan$2.63million.

  15. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  16. Drug: D08130 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08130 Drug Lisdexamfetamine (INN) C15H25N3O 263.1998 263.3785 D08130.gif ATC code: N06BA12 prod ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BA Centrally acting sympathomime ...

  17. 12 CFR 208.43 - Capital measures and capital category definitions.

    Science.gov (United States)

    2010-01-01

    ... has determined, after notice and opportunity for hearing pursuant to 12 CFR 263.203, that the bank is... notice and opportunity for hearing pursuant to 12 CFR 263.203, that, in the most recent examination of... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Capital measures and capital...

  18. Domain Modeling: NP_001020371.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001020371.3 chr16 Eukaryotic proteases d1bmla_ chr16/NP_001020371.3/NP_001020371.3..._apo_16-263.pdb d1buib_ chr16/NP_001020371.3/NP_001020371.3_holo_16-263.pdb blast 28L,29S,249V,250A 34I,35

  19. Why immigrants manage to grab more social benefits? Empirical cross - country analysis

    Czech Academy of Sciences Publication Activity Database

    Anastassova, Lubomira; Paligorova, Teodora

    -, č. 263 (2005), s. 1-42. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : immigration * European Union * social income Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp263.pdf

  20. AcEST: BP914524 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_H02 537 Adiantum capillus-veneris mRNA. clone: YMU001_000059_H02. BP914524 - Show ... 4 ANGREEPLNHVEAERQRREKLNQRFYALRAVVPHVSKMDKASLLNDAALYI QXXXXXXXX 263 ANGREEPLNHVEAERQRREKLNQRFYALRAVVP+VSK ... MDKASLL DA YI ... Sbjct: 444 ANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMD ... KASLLGDAIAYI NELKSKVVK 503 Query: 264 XXXXXXXXASQLEVAKMETLVHRKCS ... 4 ANGREEPLNHVEAERQRREKLNQRFYALRAVVPHVSKMDKASLLNDAALYI QXXXXXXXX 263 ANGREEPLNHVEAERQRREKLNQRFY+LRAVVP+VSK ...

  1. Drug: D08447 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08447 Drug Protriptyline (INN) C19H21N 263.1674 263.3767 D08447.gif Antidepressant, tricyclic S ... r08303] N NERVOUS SYSTEM N06 PSYCHOANALEPTICS N06A ANTIDEPRESSANTS ... N06AA Non-selective monoamine reuptake inhibitors ... ptyline (INN) USP drug classification [BR:br08302] Antidepressants ... Tricyclics Protriptyline D08447 Protriptyline (INN ...

  2. 78 FR 44029 - Establishment of Rules and Policies for the Digital Audio Radio Satellite Service in the 2310...

    Science.gov (United States)

    2013-07-23

    ....263(b) and 25.263(c) published at 78 FR 9605, February 11, 2013, are effective July 23, 2013. FOR...- 130, published at 78 FR 9605, February 11, 2013. The OMB Control Number is 3060-1153. The Commission... one decibel (dB) (cumulative) and exempting terrestrial repeaters operating below 2 watts...

  3. Detection of major histocompatibility complex/human cartilage gp-39 complexes in rheumatoid arthritis synovitis as a specific and independent histologic marker

    NARCIS (Netherlands)

    Baeten, D; Steenbakkers, PGA; Rijnders, AMW; Boots, AM; Veys, EM; De Keyser, F

    2004-01-01

    Objective. Peptide 263-275 is the immunodominant epitope of human cartilage (HC) gp-39, a candidate autoantigen in rheumatoid arthritis (RA). We recently generated and characterized a monoclonal antibody (mAb) called 12A, which is directed against HLA-DR4/HC gp-39(263-275) complexes and inhibits spe

  4. Construction of Reversible Variable Length Code for Digital Image Processing

    OpenAIRE

    NEETU YADAV,; K.C. ROY,; YOGESH KRISHAN

    2010-01-01

    Many image and video coding standard, such as JPEG, H.261, H.263, MPEG-1, MPEG-2 use variable length code (VLC) as their entropy coding scheme. However, VLCs have a big disadvantage when transmitting over anoisy channel, thus error in transmission occurs. Reversible variable lengths codes (RVLCs) are not only prefix codes but also suffix codes. RVLCs are used in MPEG-4, JPEG-2000, H.263+, and H.263++. Reversible variable length codes have been used to augment the error elastic capabilities of...

  5. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  6. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  7. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  8. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  9. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  10. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  11. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  12. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  13. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  14. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  15. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  17. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... practice, as well as tools to help you manage your practice in light of these changes and ... for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail mediaonly@ ...

  18. Dicty_cDB: Contig-U14141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tities = 257/263 (97%) Strand = Plus / Plus Query: 11 aatccnaaacctggnccccaatattatccccnancnactttnccnntatttgaa...tccccn 70 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 11 aatccna...aacctggnccccaatattatccccnancnactttnccnntatttgaatccccn 70 Query: 71 aangnttttganaaatttganatnganaccntgn...| Sbjct: 131 anttatcnacaanatcnagcagntaaannattaaanaaacaaggntggagntntnataaa 190 Query: 191 aaanatntcncctggnttanaanacatgaagnaccna...aanaaatnccnaangaatttgaa 250 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| S

  19. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Statement Policies and Procedures for Identifying and Resolving Conflicts of Interest Physician Resources Physician Resources From The ... for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail mediaonly@ ...

  20. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Scientific Meeting Meeting Information Press Room Information Embargo ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  1. 21 CFR 607.65 - Exemptions for blood product establishments.

    Science.gov (United States)

    2010-04-01

    ... certified under the Clinical Laboratory Improvement Amendments of 1988 (42 U.S.C. 263a) and 42 CFR part 493... the profession of pharmacy including the business of dispensing and selling blood products at...

  2. Operation "North". Czechoslovak Security Apparatus and the Polish Crisis 1980-1984.

    Czech Academy of Sciences Publication Activity Database

    Blažek, Petr

    Vol. 2. Prague : Slavonic Library, 2007 - (Babka, L.; Roubal, P.), s. 263-276 ISBN 978-80-7050-534-2 Institutional research plan: CEZ:AV0Z80630520 Keywords : Czechoslovak Security - Polish crisis Subject RIV: AB - History

  3. Sur, a former late-glacial and Holocene lake at the westernmost margin of the Carpathians

    Czech Academy of Sciences Publication Activity Database

    Petr, L.; Žáčková, P.; Matys Grygar, Tomáš; Píšková, Anna; Křížek, M.; Treml, V.

    2013-01-01

    Roč. 85, č. 3 (2013), s. 239-263. ISSN 0032-7786 Institutional support: RVO:61388980 Keywords : Geochemistry * Geomorphology * Multi-proxy reconstruction * Palaeobotany * Palaeolimnology * Pannonia Subject RIV: DD - Geochemistry Impact factor: 2.778, year: 2013

  4. Univerzita ve věku instrumentální racionality. Adorno, Liessmann a zánik vzdělanosti

    Czech Academy of Sciences Publication Activity Database

    Hauser, Michael

    Praha: Filosofia, 2015, s. 245-263 ISBN 978-80-7007-419-0 Institutional support: RVO:67985955 Keywords : university * education * neoliberalism * Adorno * Liessmann Subject RIV: AA - Philosophy ; Religion

  5. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Store CME Resources Treatment Resources Clinical Drug Trials Translation Services International Volunteerism Guide ACG Professionalism and Wellness ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  6. Alternative GMM Methods for Nonlinear Panel Data Models

    OpenAIRE

    Breitung, Jörg; Lechner, Michael

    1999-01-01

    Not available in German. Frühere Version: Breitung, J. and M. Lechner (1998), Altenative GMM Methods for Nonlinear Panel Data models, discussion paper 81, SFB 373 Humbold-Universität zu Berlin. Download Volltext: (pdf, 263 kb)

  7. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ... video instills confidence in patients about the effectiveness, safety and importance of colonoscopy. Featuring the experience of ...

  8. "Barokní" vesnice - zánik jedné společnosti za zvuku trub a bubnů?

    Czech Academy of Sciences Publication Activity Database

    Himl, Pavel

    Praha : Národní galerie, 2001 - (Vlnas, V.), s. 469-473 ISBN 80-7035-263-9 Institutional research plan: CEZ:AV0Z9062906 Keywords : baroque village * cultural changes Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. First record of Philometra katsuwoni (Nematoda, Philometridae), a parasite of skipjack tuna Katsuwonus pelamis (Perciformes, Scombridae), off South American Atlantic coast

    Czech Academy of Sciences Publication Activity Database

    Cárdenas, M. Q.; Moravec, František; Kohn, A.

    2009-01-01

    Roč. 9, č. 2 (2009), s. 263-266. ISSN 1676-0611 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Katsuwonus * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  10. Living oil: petroleum culture in the American century

    OpenAIRE

    Straß, Hanna

    2015-01-01

    Reseña de libro: Stephanie LeMenager, Living Oil: Petroleum Culture in the American Century (Oxford: Oxford University Press, 2014), xi+263pp. Living oil: petroleum culture in the American century [Reseña de libro

  11. 26 CFR 1.460-5 - Cost allocation rules.

    Science.gov (United States)

    2010-04-01

    ... simplified cost-to-cost method. As in section 263A, the use of the practical capacity concept is not... exempt construction contract reported using the CCM— (A) Marketing and selling expenses,...

  12. Vznik Treťjakovské galerie jako příklad mecenátu bohatého ruského obchodníka

    Czech Academy of Sciences Publication Activity Database

    Vlček, Radomír

    Brno: Tribun EU, 2013 - (Dohnal, J.), s. 471-471. (Knihovnicka.cz). ISBN 978-80-263-0379-4 Institutional support: RVO:67985963 Keywords : Russian history * 19th century * Nationalism * fine arts * Patronage Subject RIV: AB - History

  13. 26 CFR 301.9100-8 - Time and manner of making certain elections under the Technical and Miscellaneous Revenue Act of...

    Science.gov (United States)

    2010-04-01

    ... to have section 263A of the Code apply to costs incurred in the planting, cultivation, maintenance..., cultivation, maintenance, or development of pistachio trees. Consent must be obtained from the...

  14. Oak woodland vegetation of Turkey-a first overview based on multivariate statistics

    Czech Academy of Sciences Publication Activity Database

    Ugurlu, E.; Roleček, Jan; Bergmeier, E.

    2012-01-01

    Roč. 15, č. 4 (2012), s. 590-608. ISSN 1402-2001 Institutional support: RVO:67985939 Keywords : gradient analysis * phytogeography * vegetation classification Subject RIV: EF - Botanics Impact factor: 2.263, year: 2012

  15. Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat

    Index Scriptorium Estoniae

    Ospovat, Aleksandr

    1999-01-01

    Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)

  16. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... that will help improve efficiency and increase profitability. Learn from experts at ACG's live and web-based ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  17. Bryophytes from the area drained by the Peel and Mackenzie Rivers, Yukon and Northwest Territories, Canada

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report is on bryophytes from the area drained by the Peel and Mackenzie rivers in the Yukon territory of Canada. The distribution and general ecology of 263...

  18. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... ACG welcomes inquiries about digestive health from the media and can make experts available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  19. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Patient Website Patient Assistance Programs Practice Management Practice Management From articles to educational programs, ACG provides you ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  20. A checklist of the Pteridophytes of the ‘Flora of Southern Africa’ region

    OpenAIRE

    Nicola C. Anthony; E. A. C. L. E. Schelpe

    1984-01-01

    The 250 species, both indigenous and naturalized, in th e 75 genera of southern African Pteridophytes are listed with their subspecies and varieties (263 tax a in all ) . Coded distribution ranges are given for each taxon.

  1. Nález zásobnic ze střední doby hradištní u závrtu ZMF (Tetín, okr. Beroun)

    Czech Academy of Sciences Publication Activity Database

    Vencl, Slavomil

    2015-01-01

    Roč. 19, č. 1 (2015), s. 263-269. ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Middle Hillfort Period * storage jars * Bohemian Karst Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... Membership More than 13,000 GI professionals worldwide call themselves an ACG Member. Join the community of ... make experts available for interviews upon request. Please call the Communications Team at 301-263-9000 or ...

  3. Variation in NAT2 acetylation phenotypes is associated with differences in food-producing subsistence modes and ecoregions in Africa

    Czech Academy of Sciences Publication Activity Database

    Podgorná, Eliška; Diallo, I.; Vangenot, Ch.; Sanchez-Mazas, A.; Sabbagh, A.; Černý, Viktor; Poloni, E. S.

    2015-01-01

    Roč. 15, č. 263 (2015). ISSN 1471-2148 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : NAT2 * acetylation polymorphism * African Sahel * pastoral nomads * subsistence mode * ecoregion * natural selection Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.368, year: 2014 http://www.biomedcentral.com/1471-2148/15/263

  4. A loss-of-function variant of PTPN22 is associated with reduced risk of systemic lupus erythematosus

    OpenAIRE

    Orrú, Valeria; Tsai, Sophia J.; Rueda, Blanca; Fiorillo, Edoardo; Stanford, Stephanie M.; Dasgupta, Jhimli; Hartiala, Jaana; Zhao, Lei; Ortego-Centeno, Norberto; D’alfonso, Sandra; Arnett, Frank C.; WU Hui; Gonzalez-Gay, Miguel A; Tsao, Betty P.; Pons-Estel, Bernardo

    2008-01-01

    A gain-of-function R620W polymorphism in the PTPN22 gene, encoding the lymphoid tyrosine phosphatase LYP, has recently emerged as an important risk factor for human autoimmunity. Here we report that another missense substitution (R263Q) within the catalytic domain of LYP leads to reduced phosphatase activity. High-resolution structural analysis revealed the molecular basis for this loss of function. Furthermore, the Q263 variant conferred protection against human systemic lupus erythematosus,...

  5. Drug: D02303 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02303 Drug Miloxacin (INN); MIL C12H9NO6 263.043 263.203 D02303.gif Veterinary veterinary medicin...; Veterinary D02303 Miloxacin (INN) CAS: 37065-29-5 PubChem: 7...e map07014 Quinolones Antiinfectives [BR:br08307] Antibacterials Nucleic acid synthesis inhibitor type II topoisome...rase (DNA gyrase, topoisomerase IV) inhibitor [KO:K02469 K02470 K02621 K02622] Other quinolones Miloxacin

  6. Drug: D08288 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08288 Drug Nortriptyline (INN); Nortrilen (TN) C19H21N 263.1674 263.3767 D08288.gif Antidepress...ant, tricyclic Same as: C07274 ATC code: N06AA10 Tricyclic antidepressants serotonin transporte... Serotonergic synapse Enzyme: CYP2D6 [HSA:1565] Genomic biomarker: CYP2D6 [HSA:1565] map07027 Antidepress... D08288 Nortriptyline (INN) USP drug classification [BR:br08302] Antidepressants Tricyclics Nortriptyline D0

  7. Drug: D07793 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07793 Drug Desvenlafaxine (INN) C16H25NO2 263.1885 263.3752 D07793.gif Antidepress...ynapse CYP inhibition: CYP2D6 [HSA:1565] map07027 Antidepressants map07234 Neurot...S SYSTEM N06 PSYCHOANALEPTICS N06A ANTIDEPRESSANTS N06AX Other antidepressants N06AX23 Desvenlafaxine D07793... Desvenlafaxine (INN) USP drug classification [BR:br08302] Antidepressants SSRIs/

  8. The effect of full agonist/antagonist of D1 receptor on cognitive function in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Stuchlík, Aleš; Valeš, Karel

    2008-01-01

    Roč. 11, Suppl.1 (2008), s. 263-263. ISSN 1461-1457. [CINP Congress /26./. 13.07.2008-17.07.2008, Munich] R&D Projects: GA MŠk(CZ) 1M0517; GA MZd(CZ) NR9178; GA ČR(CZ) GA309/07/0341 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * D1 receptor * schizophrenia * cognitive function Subject RIV: FH - Neurology

  9. PIP2: A new key player in nucleolar structure and transcription of ribosomal genes?

    Czech Academy of Sciences Publication Activity Database

    Yildirim, Sukriye; Castano, Enrique; Philimonenko, Vlada; Dzijak, Rastislav; Sobol, Margaryta; Hozák, Pavel

    Urbino : Italian Society of Microscopical Sciences, 2011. s. 263-263. [Multinational Congress on Microscopy /10./. 04.09.2011-09.09.2011, Urbino] R&D Projects: GA MŠk LC545; GA MŠk(CZ) LC06063; GA ČR GAP305/11/2232; GA ČR(CZ) GD204/09/H084 Institutional research plan: CEZ:AV0Z50520514 Keywords : nanoparticles * immunogold detection * cell nucleus * histochemistry Subject RIV: EB - Genetics ; Molecular Biology

  10. En uendelig saga?

    DEFF Research Database (Denmark)

    Skovgaard-Petersen, Henrik

    2012-01-01

    The article discusses the position of private (non-privileged) applicants in direct proceedings before the Court of Justice of the European Union (CJEU), particularly in the light of recent decisions by the General Court in Case T-18/10, Kanatami (n.y.r.) (appeal, Case C-583/11 P) and Case T-262/....../10, Microban (n.y.r.). The article undertakes a critical examination of the interpretation of the amended Art. 263(4) TFEU. It concludes by noting that the General Court has taken a cautious approach and calls for a clarification of Art. 263(4) by the CJEU....

  11. AcEST: DK963182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_N14 595 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_N14. 5' end seq ... ATEYSLRIIKGVVAPVRRVKRTKVTTCQQAKRVPF---------RTFTMESPSG QCL 263 V QA E ++R K + PVRR + +C + VPF + +P G L Sbj ... Query: 126 EYSLRIIKGVVAPVRRVKRTKVTTCQQAKRVPFRTFTMESPSG QCL 263 EY R I G+V V+ V + QA +P T E+PSG Q L Sbjct: 1 ... 24 EYLDRDIYGLVGEVKAVNLAPIEASLQAGSIPVITSLGETPSG QIL 169 >sp|P75079|Y035_MYCPN Uncharacterized prote ... tives = 33/66 (50%) Frame = +3 Query: 219 PFRTFTMESPSG QCLLDSEKIKFTCAIRQRKIKYNQILDMSKVGKNSVTIIYNVQAKTIF 39 ...

  12. Material properties of transition objects 3200 Phaethon and 2003 EH1

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jiří; Koten, Pavel; Spurný, Pavel; Čapek, David; Shrbený, Lukáš; Štork, Rostislav

    Cambridge: Cambridge University Press, 2010, s. 218-222. (IAU Symposium Proceedings Series. IAU S263). ISBN 978-0-521-76488-9. ISSN 1743-9213. [Symposium of the International Astronomical Union /263./. Rio de Janeiro (BR), 03.08.2009-07.08.2009] R&D Projects: GA AV ČR IAA300030813; GA ČR GA205/09/1302 Institutional research plan: CEZ:AV0Z1003909 Keywords : meteors * meteoroids * minor planets Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  13. The nutritive value and role of Panicum turgidum Forssk. in the arid ecosystems of the Egyptian desert

    OpenAIRE

    Heneidy, Selim Z.; Halmy, Marwa W.

    2009-01-01

    Panicum turgidum is one of the most drought resistant plants in the Egyptian desert. Five habitat types were selected for the study: sand dunes (North Sinai and in Wady El-Natrun), gravel desert, coastal plain, and water runnels of a wadi bed (South Sinai and Eastern Desert). About 47.4% of the studied sites were subjected to high grazing pressure, 26.3% to moderate grazing pressure; the remaining 26.3% were subjected to low grazing pressure. Concentration of the nutrients (K, Na, Ca, P an...

  14. Nationwide German Multicenter Study on the Prevalence of Antibiotic Resistance in Streptococcal Blood Isolates from Neutropenic Patients and Comparative In Vitro Activities of Quinupristin-Dalfopristin and Eight Other Antimicrobials

    OpenAIRE

    Reinert, Ralf René; von Eiff, Christof; Kresken, Michael; Brauers, Johannes; Hafner, Dieter; Al-Lahham, Adnan; Schorn, Holger; Lütticken, Rudolf; Peters, Georg

    2001-01-01

    In a prospective multicenter study (1996 to 1999), 156 episodes of bacteremic streptococcal infections of neutropenic patients were evaluated. Streptococcus oralis (26.3%), S. pneumoniae (26.3%), S. agalactiae (11.5%), S. mitis (9%), and S. pyogenes (5.8%) were the predominant species. Four strains (2.6%) were found to be intermediately resistant to penicillin. One strain (0.6%) was found to be highly resistant to penicillin (MIC, 8 mg/liter). Reduced susceptibility to penicillin was detected...

  15. Mechanism of gold solvent extraction from aurocyanide solution by quaternary amines: models of extracting species based on hydrogen bonding

    Institute of Scientific and Technical Information of China (English)

    马刚; 闫文飞; 陈景; 严纯华; 高宏成; 周维金; 施鼐; 吴谨光; 徐光宪; 黄昆; 余建民; 崔宁

    2000-01-01

    The mechanism of gold solvent extraction from KAu(CN)2 solution was investigated by means of FTIR, EXAFS, ICP and radioactive tracer methods. Two extraction systems were studied, namely N263-tributyl phosphate(TBP)-n-dodecane and N263-iso-octanol-n-dodecane. High-resolution FT IR spectroscopy indicated that the CN stretching vibrations of the two extraction systems differred greatly. In order to interpret the significant difference in CN stretching vibrations, twoextracting species models are proposed——supramolecular structures based on the formation ofhydrogen bonds between Au(CN)2- and modifiers such as TBP and iso-octanol.

  16. EST Table: FS895931 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS895931 E_FL_ftes_20D04_R_0 10/09/28 48 %/263 aa ref|XP_975194.1| PREDICTED: similar to something...l|GB19080-PA 10/09/10 48 %/263 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS823506 ftes ... ... about silencing protein 10 [Tribolium castaneum] gb|EFA01562.1| hypothetical protein TcasGA2...68 aa AGAP002960-PA Protein|2R:30130647:30132122:-1|gene:AGAP002960 10/09/10 41 %/309 aa gnl|Ame

  17. Mechanism of gold solvent extraction from aurocyanide solution by quaternary amines: models of extracting species based on hydrogen bonding

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The mechanism of gold solvent extraction from KAu(CN)2 solution was investigated by means of FTIR, EXAFS, ICP and radioactive tracer methods. Two extraction systems were studied, namely N263-tributyl phosphate(TBP)-n-dodecane and N263-iso-octanol-n-dodecane. High-reso- lution FT IR spectroscopy indicated that the CN stretching vibrations of the two extraction systems differred greatly. In order to interpret the significant difference in CN stretching vibrations, two extracting species models are proposed supramolecular structures based on the formation of hydrogen bonds between Au(CN)2- and modifiers such as TBP and iso-octanol.

  18. Divergent sodium channel defects in familial hemiplegic migraine

    OpenAIRE

    Kahlig, Kristopher M.; Rhodes, Thomas H.; Pusch, Michael; Freilinger, Tobias; Pereira-Monteiro, José M.; Ferrari, Michel D; van den Maagdenberg, Arn M. J.M.; Dichgans, Martin; George, Alfred L.

    2008-01-01

    Familial hemiplegic migraine type 3 (FHM3) is a severe autosomal dominant migraine disorder caused by mutations in the voltage-gated sodium channel NaV1.1 encoded by SCN1A. We determined the functional consequences of three mutations linked to FHM3 (L263V, Q1489K, and L1649Q) in an effort to identify molecular defects that underlie this inherited migraine disorder. Only L263V and Q1489K generated quantifiable sodium currents when coexpressed in tsA201 cells with the human β1 and β2 accessory ...

  19. PSM-R: Revised Optimism-Pessimism Scale for the MMPI-2 and MMPI.

    Science.gov (United States)

    Malinchoc, M; Offord, K P; Colligan, R C

    1995-03-01

    The Revised Optimism-Pessimism (PSM-R) scale was developed for use with either the MMPI-2 or the MMPI. The scale measures explanatory style on a continuum from optimistic to pessimistic by using 263 MMPI items of the original 298-item Optimism-Pessimism (PSM) scale. These 263 items are common to both the MMPI-2 and MMPI. PSM-R norms are based on a random sample of 1,408 normal adults who also were used for developing norms for the original PSM scale. Reliability estimates (.93 for men; .94 for women) indicate that the PSM-R scale is as accurate as the original PSM scale. PMID:7797644

  20. Experiments with Superheavy Nuclei

    Science.gov (United States)

    Hofmann, S.

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α -α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  1. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO3, HReO4) ΔHads(ReO3) = -190 ± 10 kJ/mol; ΔSads(ReO3) = -179±30 J/mol K; ΔHads(HReO4) = -77 ± 5 kJ/mol; ΔSads(HReO4) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176Re, 152-155Er, 151-154Ho, 218Po, and 214Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  2. Experiments with superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)

    1999-03-01

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author) 34 refs, 7 figs

  3. Chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Schaedel, M. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan). Advanced Science Research Center; GSI Helmholtz Center for Heavy Ion Research, Darmstadt (Germany)

    2012-07-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  4. New elements produced at GSI

    Science.gov (United States)

    Hofmann, Sigurd

    1998-12-01

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed.

  5. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A. [Paul-Scherrer-Inst., Villigen (Switzerland); Gaeggeler, H.W. [Dept. of Chemistry and Biochemistry, Univ. of Bern (Switzerland); Paul-Scherrer-Inst., Villigen (Switzerland)

    1999-07-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) {r_reversible} X(ads) (X = ReO{sub 3}, HReO{sub 4}) {delta}H{sub ads}(ReO{sub 3}) = -190 {+-} 10 kJ/mol; {delta}S{sub ads}(ReO{sub 3}) = -179{+-}30 J/mol K; {delta}H{sub ads}(HReO{sub 4}) = -77 {+-} 5 kJ/mol; {delta}S{sub ads}(HReO{sub 4}) = -187{+-}50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes {sup 169,170,174,176}Re, {sup 152-155}Er, {sup 151-154}Ho, {sup 218}Po, and {sup 214}Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  6. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, J.C.; Mizel, A.; Cote, M.; Cohen, M.L.; Louie, S.G. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States))

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (B[sub o]), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (B[sub o]). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated B[sub o] for Hs is comparable to that of diamond. [copyright] [ital 1999] [ital The American Physical Society

  7. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  8. Experiments with superheavy nuclei

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z =107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant= decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z = 107) to element 112, for which a cross-section of 1 pb was measured. Based on these results, it is likely that the production of isotopes of element 114 close to the island of spherical Super Heavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed. (author)

  9. Synthesis of heavy and superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. (Gesellschaft fur Schwerionenforshung (GSI), Darmstadt (Germany))

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-de-excitation channels. The isotopes were ambiguously identified by means of [alpha]-[alpha] correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on this results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reaction using [sup 208]Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use the neutron deficient projectile isotopes and use of actinide targets is discussed.

  10. New elements produced at GSI

    International Nuclear Information System (INIS)

    In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using lead or bismuth targets and 1n-deexcitation channels. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical SuperHeavy Elements (SHE) could be achieved by fusion reactions using 208Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. The likelihood of broadening the energy window by investigation of radiative capture reactions, use of neutron deficient projectile isotopes and use of actinide targets is discussed

  11. Developmental Dynamics of Emotion and Cognition Processes in Preschoolers

    Science.gov (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.; Weaver, Jennifer Miner

    2013-01-01

    Dynamic relations during the preschool years across processes of control and understanding in the domains of emotion and cognition were examined. Participants were 263 children (42% non-White) and their mothers who were seen first when the children were 3 years old and again when they were 4. Results indicated dynamic dependence among the…

  12. Ergodicity breaking in frustrated disordered systems: replicas in mean-field spin-glass models

    Czech Academy of Sciences Publication Activity Database

    Janiš, Václav; Kauch, Anna; Klíč, Antonín

    2015-01-01

    Roč. 88, č. 3 (2015), s. 245-263. ISSN 0141-1594 Institutional support: RVO:68378271 Keywords : ergodicity and thermodynamic homogeneity * real replicas * ergodicity and replica-symmetry breaking * asymptotic solution Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.954, year: 2014

  13. Active pharmaceutical ingredient (api) from an estuarine fungus, Microdochium nivale (Fr.)

    Digital Repository Service at National Institute of Oceanography (India)

    Bhosale, S.H.; Patil, K.B.; Parameswaran, P.S.; Jagtap, T.G.

    factor to the IL-2 enhacer. EMBO J., 9, 2529-2536 (1990). Rodriguez-Couto, S., E. Lopez and M.A. Sanroman: Utilisation of grape seed for laccase production in solid- state fermentation. J. Food Engineering, 74, 263-267 (2006). Rodriguez, M.A., G. Cabrera...

  14. Neutralizing antibodies in slowly progressing HIV-1 infection

    DEFF Research Database (Denmark)

    Schønning, Kristian; Nielsen, C; Iversen, Johan; Nielsen, Jens Ole; Hansen, J E

    1995-01-01

    with SPI generally neutralized the contemporaneous isolate, whereas serum from individuals with RPI did not [geometric mean antibody titer (GMT), 45 vs. 3; p = 0.0047]. There was no difference in neutralizing ability against HIVMN (GMT,2,593 vs. 2,263; p = 0.74) and only a small difference against...

  15. Expressivity of apomixis in 2n + n hybrids from an apomictic and a sexual parent: insights into variation detected in Pilosella (Asteraceae: Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Krahulcová, Anna; Krahulec, František; Rosenbaumová, R.

    2011-01-01

    Roč. 24, č. 1 (2011), s. 263-274. ISSN 0934-0882 R&D Projects: GA ČR GA206/08/0890 Institutional research plan: CEZ:AV0Z60050516 Keywords : inheritance of apomixis * residual sexuality * unreduced hybrids Subject RIV: EF - Botanics Impact factor: 1.869, year: 2011

  16. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva

    2006-01-01

    Roč. 563, č. 1 (2006), s. 263-267. ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  17. The Best and the Rest: Revisiting the Norm of Normality of Individual Performance

    Science.gov (United States)

    O'Boyle, Ernest, Jr.; Aguinis, Herman

    2012-01-01

    We revisit a long-held assumption in human resource management, organizational behavior, and industrial and organizational psychology that individual performance follows a Gaussian (normal) distribution. We conducted 5 studies involving 198 samples including 633,263 researchers, entertainers, politicians, and amateur and professional athletes.…

  18. Redescription of Heliconema africanum (Linstow, 1899) n. comb. (Nematoda: Physalopteridae), a nematode parasite of freshwater eels (Anguilla spp.) in South Africa

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Weyl, O.L.F.

    2013-01-01

    Roč. 85, č. 3 (2013), s. 263-269. ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Heliconema * South Africa Subject RIV: EA - Cell Biology Impact factor: 1.035, year: 2013

  19. Philometra johnii sp nov (Nematoda, Philometridae), a new gonad-infecting philometrid from the sin croaker Johnius dussumieri (Cuvier) (Perciformes, Sciaenidae) from marine waters of Iraq

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 263-268. ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * new species * marine fish * Johnius * Iraq * Arabian Gulf Subject RIV: EA - Cell Biology Impact factor: 0.965, year: 2013

  20. 10 CFR Appendix G to Part 20 - Requirements for Transfers of Low-Level Radioactive Waste Intended for Disposal at Licensed Land...

    Science.gov (United States)

    2010-01-01

    ... CFR part 172. Information on hazardous, medical, or other waste, required to meet Environmental Protection Agency regulations, as codified in 40 CFR parts 259, 261 or elsewhere, is not addressed in this... Administrator of EPA as required by 40 CFR part 263. Generator means a licensee operating under a Commission...

  1. Genetic polymorphisms in DNA repair and oxidative stress pathways may modify the association between body size and postmenopausal breast cancer

    Czech Academy of Sciences Publication Activity Database

    McCullough, L. E.; Eng, S. M.; Bradshaw, P. T.; Cleveland, R. J.; Steck, S. E.; Terry, M. B.; Shen, J.; Crew, K.D.; Rössner ml., Pavel; Ahn, J.; Ambrosone, Ch.B.; Teitelbaum, S. L.; Neugut, A. I.; Santella, R. M.; Gammon, M. D.

    2015-01-01

    Roč. 25, č. 4 (2015), s. 263-269. ISSN 1047-2797 Institutional support: RVO:68378041 Keywords : breast cancer * body mass index * oxidative stress * DNA repair * Epidemiology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.000, year: 2014

  2. A New Point of View on the Relationship Between Global Solar Irradiation and Sunshine Quantifiers

    Czech Academy of Sciences Publication Activity Database

    Brabec, Marek; Badescu, V.; Dumitrescu, A.; Paulescu, M.

    2016-01-01

    Roč. 126, March (2016), s. 252-263. ISSN 0038-092X Institutional support: RVO:67985807 Keywords : global solar irradiation * sunshine quantifiers * sunshine number * Angstrom equation * statistical modeling * regression analysis Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 3.469, year: 2014

  3. Sensitivity analysis of an inverse procedure for determination of elastic coefficients for strong anisotropy

    Czech Academy of Sciences Publication Activity Database

    Seiner, Hanuš; Landa, Michal

    2004-01-01

    Roč. 43, č. 4 (2004), s. 253-263. ISSN 0041-624X Institutional research plan: CEZ:AV0Z2076919 Keywords : elastic anisotropy * group velocity * non-destructive evaluation Subject RIV: JJ - Other Materials Impact factor: 1.175, year: 2004

  4. Midway Atoll Site P18 12/4/2002 12-13M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P18 28.263 N, 177.337 W, between 12 and 13 meters along a permanent transect.

  5. Preschool-Aged Children's Understanding of Gratitude: Relations with Emotion and Mental State Knowledge

    Science.gov (United States)

    Nelson, Jackie A.; de Lucca Freitas, Lia Beatriz; O'Brien, Marion; Calkins, Susan D.; Leerkes, Esther M.; Marcovitch, Stuart

    2013-01-01

    Developmental precursors to children's early understanding of gratitude were examined. A diverse group of 263 children was tested for emotion and mental state knowledge at ages 3 and 4, and their understanding of gratitude was measured at age 5. Children varied widely in their understanding of gratitude, but most understood some aspects of…

  6. Psychosociální souvislosti antisociálního chování dospívajících: hlavní výsledky projektu SAHA

    Czech Academy of Sciences Publication Activity Database

    Sobotková, Veronika; Blatný, Marek; Jelínek, Martin; Hrdlička, M.

    Praha: Univerzita Karlova v Praze, 2009, s. 176-193. ISBN 978-80-7308-263-5. [Škola jako místo setkávání II. Praha (CZ), 20.04.2009-20.04.2009] Institutional research plan: CEZ:AV0Z70250504 Keywords : antisocial behaviour * typology * early adolescence Subject RIV: AN - Psychology

  7. AcEST: BP917928 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_D11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000107_D11. BP917928 - Show ... MMLA-SQMLTGILLAMHYVGHVDYAFASVQHL 68 Query: 263 LCDLPSG LLIKHSRRGDACIY 201 + D+PSG ++++++ A ++ Sbjct: 69 MTD ... VPSG MILRYAHANGASLF 89 >sp|Q9UNH5|CC14A_HUMAN Dual speci ...

  8. 21 CFR 316.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) Greater safety in a substantial portion of the target populations, for example, by the elimination of an... Service Act (42 U.S.C. 262-263). (9) Marketing application means an application for approval of a new drug... approval letter of a marketing application for a sponsor of a designated orphan drug, no approval will...

  9. Study of IV B elements carbonate complexes 1. Stability constant of thorium (IV) pentacarbonate complex

    International Nuclear Information System (INIS)

    A method for the solvent extraction of thorium (IV) by chelation and neutronic activation analysis, allows the determination of stability constant of thorium (IV) pentacarbonate complexe at an ionic strength of 1.0 and 2.5: log β = 26.2 ± 0.2 and 26.3 ± 0.2. 10 refs

  10. Postup izotachoforetického stanovení kyseliny thioglykolové v moči za odsolení a úpravy pH analyzovaného vzorku

    Czech Academy of Sciences Publication Activity Database

    Chýlková, J.; Fadrná, Renata

    2004-01-01

    Roč. 98, č. 5 (2004), s. 260-263. ISSN 0009-2770 R&D Projects: GA AV ČR KSK4040110 Keywords : thiodiglykolic acid * TDGA * isotachophores Subject RIV: CG - Electrochemistry Impact factor: 0.348, year: 2004

  11. 1976-77 Internal Revenue Service Comparison Study. Final Report.

    Science.gov (United States)

    Applied Management Sciences, Inc., Silver Spring, MD.

    Application forms for the Basic Educational Opportunity Grant (BEOG) program for 1976-1977 were compared to 1975 tax forms filed with the Internal Revenue Service (IRS). Comparisons were also made to data from a similar 1974-1975 study. Based on a sample of 212,263 applicants, findings include the following: during 1976-1977, 70.7 percent of all…

  12. 26 CFR 1.162-12 - Expenses of farmers.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses of farmers. 1.162-12 Section 1.162-12... farmers. (a) Farms engaged in for profit. A farmer who operates a farm for profit is entitled to deduct... 263A and the regulations thereunder. For taxable years beginning after July 12, 1972, where a farmer...

  13. Dynamika dusíku a expanze ovsíku vyvýšeného (Arrhenatherum elatius) na vřesovištích v Národním parku Podyjí

    Czech Academy of Sciences Publication Activity Database

    Fabšičová, Martina; Sedláková, Iva; Holub, Petr; Tůma, Ivan; Chytrý, M.; Záhora, J.

    Praha: Agentura ochrany přírody a krajiny ČR, 2003 - (Pivničková, M.), s. 255-263 ISBN 80-86064-86-7 Institutional research plan: CEZ:AV0Z6005908 Keywords : atmospheric nitrogen deposition * Calluna vulgaris * Arrhenatherum elatius Subject RIV: EF - Botanics

  14. Disease: H00332 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ieving continuous improvement in reductions in foodborne listeriosis--a risk-based approach. J Food Prot 68:... assessment of Listeria monocytogenes in ready-to-eat foods: the FAO/WHO approach. FEMS Immunol Med Microbiol 35:263-7 (2003) ...

  15. A Century of Change: The Evolution of School Library Resources, 1915-2015

    Science.gov (United States)

    Lamb, Annette

    2015-01-01

    School libraries have been in existence since at least the eighth century. However, it wasn't until the twentieth century that the school library was seen primarily as "a source of enrichment for the curriculum, and a means of developing reading and study habits in the pupils" (Clyde 1981, 263). While the formats available and tools for…

  16. Morfologicko-fyziologické rozdíly sivena amerického Salvelinus fontinalis a jeho hybrida Salvelinus alpinus x Salvelinus fontinalis chovaných v recirkulačních systémech

    Czech Academy of Sciences Publication Activity Database

    Halačka, Karel; Vítek, T.; Mareš, J.

    Brno : Tribun EU, 2012 - (Soukalová, K.). s. 12 ISBN 978-80-263-0307-7. [Česká ichtyologická konference /13./. 24.10.2012-26.10.2012, Červená nad Vltavou] Institutional support: RVO:68081766 Keywords : Hybridization * Aquaculture Subject RIV: EH - Ecology, Behaviour

  17. Statistical properties of turbulence: a new approach to characterize transport in fusion plasmas

    Czech Academy of Sciences Publication Activity Database

    Goncalves, B.; Hidalgo, C.; Pedrosa, M. A.; Silva, C.; Erents, K.; Matthews, G.; Hron, Martin; Loarte, A.; Pitts, R. A.

    2003-01-01

    Roč. 53, č. 10 (2003), s. 827-853. ISSN 0011-4626. [Workshop "Electric Fields Structures and Relaxation in Edge Plasmas"/6th./. St.Petersburg, 13.06.2003-14.06.2003] Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma, Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.263, year: 2003

  18. 77 FR 54482 - Allocation of Costs Under the Simplified Methods

    Science.gov (United States)

    2012-09-05

    ... Internal Revenue Service 26 CFR Part 1 RIN 1545-BG07 Allocation of Costs Under the Simplified Methods... under the simplified production method or the simplified resale method. The proposed regulations provide... allocation of costs under the simplified methods of accounting under section 263A of the Internal...

  19. Chain-Growth Copolymerization of Functionalized Ethynylarenes With 1,4-Diethynylbenzene and 4,4 ́-Diethynylbiphenyl Into Conjugated Porous Networks

    Czech Academy of Sciences Publication Activity Database

    Stahlová, S.; Slováková, E.; Vaňkátová, P.; Zukal, Arnošt; Kubů, Martin; Brus, Jiří; Bondarev, D.; Moučka, R.; Sedláček, J.

    2015-01-01

    Roč. 67, JUN 2015 (2015), s. 252-263. ISSN 0014-3057 R&D Projects: GA ČR(CZ) GA15-01897S Institutional support: RVO:61388955 ; RVO:61389013 Keywords : Polyacetylenes * Diethynylbenzene * Diethynylbiphenyl Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 3.005, year: 2014

  20. Region of the Rychlebské Hory Mountains—Tectonically Controlled Landforms and Unique Landscape of Granite Inselbergs (Sudetic Mountains)

    Czech Academy of Sciences Publication Activity Database

    Štěpančíková, Petra; Stemberk, Jakub

    Cham: Springer, 2016 - (Pánek, T.; Hradecký, J.), s. 263-276 ISBN 978-3-319-27536-9 Institutional support: RVO:67985891 Keywords : Rychlebské hory * Žulovská pahorkatina * tectonic landforms * fault scarp * inselberg * granite landforms Subject RIV: DB - Geology ; Mineralogy

  1. The signature of diffusion in the binary system of omicron Leonis: a key for AmFm scenarios?

    Czech Academy of Sciences Publication Activity Database

    Gebran, M.; Hadrava, Petr; Jasniewicz, G.; Richard, O.

    2015-01-01

    Roč. 357, č. 2 (2015), 137/1-137/9. ISSN 0004-640X R&D Projects: GA ČR GB14-37086G Institutional support: RVO:67985815 Keywords : binaries * spectroscopic * stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.263, year: 2014

  2. Social and Emotional Learning in Classrooms: A Survey of Teachers' Knowledge, Perceptions, and Practices

    Science.gov (United States)

    Buchanan, Rohanna; Gueldner, Barbara A.; Tran, Oanh K.; Merrell, Kenneth W.

    2009-01-01

    A survey study was conducted to examine teachers' knowledge, perceptions, and practices regarding social and emotional learning (SEL) in the classroom. Teachers from two states (N = 263) provided a range of responses regarding how to promote SEL in their classrooms, increase the effectiveness of SEL, and reduce barriers to implementation. Results…

  3. Cyclotron produced radiopharmaceuticals

    Czech Academy of Sciences Publication Activity Database

    Kopička, Karel; Fišer, Miroslav; Hradilek, Pavel; Hanč, Petr; Lebeda, Ondřej

    2003-01-01

    Roč. 53, č. 2 (2003), s. A763-A768. ISSN 0011-4626 R&D Projects: GA AV ČR KSK4055109 Keywords : cyclotron * radionuclides * radiopharmaceuticals Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.263, year: 2003

  4. 78 FR 30922 - Agency Information Collection Activities: Submission for OMB Review; Joint Comment Request

    Science.gov (United States)

    2013-05-23

    ...' previous argument that the structure of a securitization should be considered when determining whether a... Deaf (TDD) users may call (202) 263-4869. FDIC: Gary A. Kuiper, Counsel, (202) 898-3877, Legal Division... 21, 2013, the agencies requested comment on a number of proposed revisions to the Call Report (78...

  5. Meningococcal adhesion suppresses proapoptotic gene expression and promotes expression of genes supporting early embryonic and cytoprotective signaling of human endothelial cells

    Czech Academy of Sciences Publication Activity Database

    Linhartová, Irena; Basler, Marek; Ichikawa, J.; Pelicic, V.; Osička, Radim; Lory, S.; Nassif, X.; Šebo, Peter

    2006-01-01

    Roč. 263, - (2006), s. 109-118. ISSN 0378-1097 R&D Projects: GA ČR GA310/06/0720 Institutional research plan: CEZ:AV0Z50200510 Keywords : neisseria meningitidis * adherence * signaling Subject RIV: EE - Microbiology, Virology Impact factor: 2.068, year: 2006

  6. Struktura a zpracování hesel v lexikální databázi Pralex

    Czech Academy of Sciences Publication Activity Database

    Světlá, Jindra

    Brno: Tribun EU, 2011 - (Světlá, J.; Jarošová, A.; Rangelova, A.), s. 9-18 ISBN 978-80-263-0097-7 Institutional research plan: CEZ:AV0Z90610521 Keywords : lexical database * processing of entries Subject RIV: AI - Linguistics

  7. The cestode community in northern fur seals (Callorhinus ursinus) on St. Paul Island, Alaska

    Czech Academy of Sciences Publication Activity Database

    Kuzmina, T.A.; Hernández-Orts, Jesús S.; Lyons, E.T.; Spraker, T.R.; Kornyushyn, V.V.; Kuchta, Roman

    2015-01-01

    Roč. 4, č. 2 (2015), s. 256-263. ISSN 2213-2244 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Adenocephalus pacificus (Diphyllobothrium pacificum) * Anophryocephalus cf. ochotensis * Cestoda * Diphyllobothridea * Diplogonoporus tetrapterus * Otariidae, North Pacific * Tapeworms * Tetrabothriidea Subject RIV: EG - Zoology

  8. Budování hesláře lexikální databáze Pralex

    Czech Academy of Sciences Publication Activity Database

    Světlá, Jindra

    Brno : Tribun EU, 2011 - (Světlá, J.; Jarošová, A.; Rangelova, A.), s. 19-27 ISBN 978-80-263-0097-7 Institutional research plan: CEZ:AV0Z90610521 Keywords : lexical database * list of entries Subject RIV: AI - Linguistics

  9. My Intelligence May Be More Malleable than Yours: The Revised Implicit Theories of Intelligence (Self-Theory) Scale Is a Better Predictor of Achievement, Motivation, and Student Disengagement

    Science.gov (United States)

    De Castella, Krista; Byrne, Donald

    2015-01-01

    The belief that intelligence is malleable has important consequences for achievement and motivation (Blackwell et al. "Child Development," v78, p246-263. 2007; Dweck, 1999; Robins & Pals, "Self and Identity," v1, p313-336, 2002). However, believing that it is possible to improve intelligence does not necessarily mean…

  10. 12 CFR 265.7 - Functions delegated to Director of Division of Banking Supervision and Regulation.

    Science.gov (United States)

    2010-01-01

    ...(a)(3) of Regulation K (12 CFR 211.24(a)(3)); (B) Of a U.S. banking organization to establish a... improvement plan under subpart D of the Board's Rules of Practice for Hearings (12 CFR part 263). (4... Treasury Department regulations (17 CFR part 403) implementing the Government Securities Act of 1986,...

  11. Optimal selection for BRCA1 and BRCA2 mutation testing using a combination of ' easy to apply ' probability models

    NARCIS (Netherlands)

    Bodmer, D.; Ligtenberg, M. J. L.; van der Hout, A. H.; Gloudemans, S.; Ansink, K.; Oosterwijk, J. C.; Hoogerbrugge, N.

    2006-01-01

    To establish an efficient, reliable and easy to apply risk assessment tool to select families with breast and/or ovarian cancer patients for BRCA mutation testing, using available probability models. In a retrospective study of 263 families with breast and/or ovarian cancer patients, the utility of

  12. Cyclotron targets and production technologies used for radiopharmaceuticals in NPI

    Czech Academy of Sciences Publication Activity Database

    Fišer, Miroslav; Kopička, Karel; Hradilek, Pavel; Hanč, Petr; Lebeda, Ondřej; Panek, T.; Vognar, M.

    2003-01-01

    Roč. 53, č. 2 (2003), s. A737-A743. ISSN 0011-4626 R&D Projects: GA AV ČR KSK4055109 Keywords : cyclotron * radiopharmaceuticals Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.263, year: 2003

  13. 21 CFR 73.450 - Riboflavin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Riboflavin. 73.450 Section 73.450 Food and Drugs... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.450 Riboflavin. (a) Identity. (1) The color additive riboflavin is the riboflavin defined in the Food Chemicals Codex, 3d Ed. (1981), pp. 262-263, which...

  14. Molecular characterisation of Neoparamoeba strains isolated from gills of Scophthalmus maximus

    Czech Academy of Sciences Publication Activity Database

    Fiala, Ivan; Dyková, Iva

    2003-01-01

    Roč. 55, č. 1 (2003), s. 11-16. ISSN 0177-5103 R&D Projects: GA ČR GA206/00/0265 Institutional research plan: CEZ:AV0Z6022909; CEZ:MSM 123100003 Keywords : Paramoeba * Neoparamoeba * phylogenetic position Subject RIV: EA - Cell Biology Impact factor: 1.263, year: 2003

  15. 27 CFR 19.634 - Receipt and storage of liquor bottles.

    Science.gov (United States)

    2010-04-01

    ... CFR 31.263. Liquor bottles, including those of less than 200 ml capacity, shall be stored in a safe... liquor bottles. 19.634 Section 19.634 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Liquor Bottle and...

  16. 12 CFR 225.43 - Procedures for filing, processing, publishing, and acting on notices.

    Science.gov (United States)

    2010-01-01

    ... paragraph shall be in accordance with the Rules of Practice for Formal Hearings (12 CFR part 263). At the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Procedures for filing, processing, publishing... (REGULATION Y) Regulations Change in Bank Control § 225.43 Procedures for filing, processing, publishing,...

  17. Kvalitativní metody

    Czech Academy of Sciences Publication Activity Database

    Čermák, Ivo; Chrz, Vladimír; Zábrodská, Kateřina; Urbánek, Tomáš

    Brno: Psychologický ústav AV ČR, v.v.i, 2014 - (Blatný, M.), s. 243-263 ISBN 978-80-86174-18-1 Institutional support: RVO:68081740 Keywords : qualitative methods * collective biography * discourse analysis * narrative oriented inquiry * semiotics Subject RIV: AN - Psychology

  18. EST Table: FS914324 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS914324 E_FL_fufe_31P03_F_0 10/09/28 79 %/263 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  19. Stability of Solutions to Semilinear Stochastic Evolution Equations

    Czech Academy of Sciences Publication Activity Database

    Leha, G.; Maslowski, Bohdan; Ritter, G.

    1999-01-01

    Roč. 17, č. 6 (1999), s. 1009-1051. ISSN 0736-2994 R&D Projects: GA ČR GA201/95/0629 Institutional research plan: CEZ:AV0Z1019905; CEZ:AV0Z1019905 Keywords : stochastic evolution equations * Lyapunov stability * forward inequality Subject RIV: BA - General Mathematics Impact factor: 0.263, year: 1999

  20. Model of the influence of energetic disorder on inter-chain charge carrier mobility in poly[2-methoxy-5-(2´-ethylhexyloxy)-p-phenylene vinylene

    Czech Academy of Sciences Publication Activity Database

    Toman, Petr; Nešpůrek, Stanislav; Weiter, M.; Vala, M.; Sworakowski, J.; Bartkowiak, W.; Menšík, Miroslav

    2009-01-01

    Roč. 20, č. 3 (2009), s. 263-267. ISSN 1042-7147 Institutional research plan: CEZ:AV0Z40500505 Keywords : charge transport * conducting polymers * photochromism Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.532, year: 2009

  1. Thermal imaging of the FU Ori type object 2MASS J06593158-0405277 = V960 Mon

    Science.gov (United States)

    Varricatt, W. P.; Kerr, T. H.; Carroll, T.; Moore, E.; Milne, P.

    2015-10-01

    A FU Ori-type outburst of 2MASS J06593158-0405277 (V960 Mon) was discovered by Maehara, Kojima and Fujii (ATel #6770). Further observational studies (ATel #6797, #6838, #6862, #6901, #7025, #7578) and archival data research (Jurdana- & #138;epi & #263; & Munari, 2016, NewA, 43, 87) confirmed the FU Ori nature of this object.

  2. Fatigue damage of nitinol stents in simulated physiological solution

    Czech Academy of Sciences Publication Activity Database

    Vlach, P.; Major, Štěpán; Musil, M.; Jakl, L.

    Kazan : Foliant Kazan, 2012 - (Shlyannikov, V.; Goldstein, R.; Makhutov, N.), s. 263-269 ISBN 978-5-905576-18-8. [European conference on fracture /19./. Kazan (RU), 26.08.2012-31.08.2012] Institutional support: RVO:68378297 Keywords : nitinol * stent-graft * corrosion Subject RIV: JL - Materials Fatigue, Friction Mechanics

  3. Physiological role of phenolic biostimulants isolated from brown seaweed Ecklonia maxima on plant growth and development

    Czech Academy of Sciences Publication Activity Database

    Aremu, A.O.; Masondo, N.A.; Rengasamy, K.R.R.; Amoo, S.O.; Grúz, Jiří; Bíba, Ondřej; Šubrtová, Michaela; Pěnčík, Aleš; Novák, Ondřej; Doležal, Karel; van Staden, J.

    2015-01-01

    Roč. 241, č. 6 (2015), s. 1313-1324. ISSN 0032-0935 R&D Projects: GA MŠk LK21306; GA MŠk(CZ) LO1204; GA ČR GA14-34792S Institutional support: RVO:61389030 Keywords : Asparagaceae * Auxins * Conservation Subject RIV: EF - Botanics Impact factor: 3.263, year: 2014

  4. Intramolecular Cascade Hydroarylation/Cycloisomerization Strategy for the Synthesis of Polycyclic Aromatic and Heteroaromatic Systems

    Czech Academy of Sciences Publication Activity Database

    Storch, Jan; Bernard, Martin; Sýkora, Jan; Karban, Jindřich; Čermák, Jan

    2013-01-01

    Roč. 2013, č. 2 (2013), s. 260-263. ISSN 1434-193X R&D Projects: GA ČR GAP207/10/1124; GA TA ČR TA01010646 Institutional support: RVO:67985858 Keywords : fused-ring systems * helical structures * platinum Subject RIV: CC - Organic Chemistry Impact factor: 3.154, year: 2013

  5. Do Hours Spent Viewing Television at Ages 3 and 4 Predict Vocabulary and Executive Functioning at Age 5?

    Science.gov (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Calkins, Susan D.; Marcovitch, Stuart D.

    2015-01-01

    We examined the impact of television viewing at ages 3 and 4 on vocabulary and at age 5 on executive functioning in the context of home learning environment and parental scaffolding. Children (N = 263) were seen in the lab when they were 3 years old and then again at ages 4 and 5. Parents completed measures assessing child television viewing and…

  6. Special Problems in Landslide Modelling: Mathematical and Computational Methods

    Czech Academy of Sciences Publication Activity Database

    Nedoma, Jiří

    New York : Nova Science Publishers, 2010 - (Werner, E.; Friedman , H.), s. 263-389 ISBN 978-1-60741-258-8. - (Natural Disaster Research, Prediction and Mitigation Series) Institutional research plan: CEZ:AV0Z10300504 Keywords : landslides * elasticity * visco-elasticity * visco-plasticity * contact problems * finite element method Subject RIV: BA - General Mathematics

  7. Leukocyte count affects expression of reference genes in canine whole blood samples

    NARCIS (Netherlands)

    Piek, C.J.; Brinkhof, B.; Rothuizen, J.; Dekker, A.; Penning, L.C.

    2011-01-01

    Background The dog is frequently used as a model for hematologic human diseases. In this study the suitability of nine potential reference genes for quantitative RT-PCR studies in canine whole blood was investigated. Findings The expression of these genes was measured in whole blood samples of 263 i

  8. Increasing Prevalence of Methicillin-Resistant Staphylococcus aureus Causing Nosocomial Infections at a University Hospital in Taiwan from 1986 to 2001

    OpenAIRE

    Hsueh, Po-Ren; Teng, Lee-Jene; Chen, Wen-Hwei; Pan, Huei-Ju; Chen, Mei-Lin; Chang, Shan-Chwen; Luh, Kwen-Tay; Lin, Fang-Yue

    2004-01-01

    A rapid emergence of nosocomial methicillin-resistant Staphylococcus aureus (MRSA) infection (from 26.3% in 1986 to 77% in 2001) was found. The susceptibility of 200 nonduplicate blood isolates of MRSA and 100 MRSA isolates causing refractory bacteremia to 22 antimicrobial agents disclosed that glycopeptides, quinupristin-dalfopristin, and linezolid remained the most active agents.

  9. Drug: D01170 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01170 Drug Zinc oxide (JP16/USP); Zinc oxide (TN) ZnO 79.9241 81.4084 D01170.gif Astringent: Pr ... CAS: 1314-13-2 PubChem: 7848233 NIKKAJI: J44.263A ATOM ... 2 1 Z Zn 23.5808 -18.6908 2 O0 O 25.5408 -18.6908 ...

  10. Over-wintering Daphnia: uncoupling the effects of temperature and food on offspring size and filtering screen morphology in D. galeata

    Czech Academy of Sciences Publication Activity Database

    Macháček, Jiří; Seďa, Jaromír

    2013-01-01

    Roč. 35, č. 5 (2013), s. 1069-1079. ISSN 0142-7873 R&D Projects: GA ČR(CZ) GA206/09/1325 Institutional support: RVO:60077344 Keywords : Daphnia size * filtering screens * phenotypic plasticity * embryonic induction * temperature effect Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.263, year: 2013

  11. Language contacts of the Slavic and Arabic world (from the perspektive of Czech)

    Czech Academy of Sciences Publication Activity Database

    Karlíková, Helena

    München: LINCOM Europa, 2010 - (Krčmová, M.), s. 263-278. (LINCOM studies in communication. 5). ISBN 978-3-86290-200-2 R&D Projects: GA ČR GA405/07/1092; GA MŠk(CZ) LC546 Institutional research plan: CEZ:AV0Z90610518 Keywords : linguistics * etymology Subject RIV: AI - Linguistics

  12. Autobiografie z onoho světa. Susan Taubes: Divorcing a Maria Rybakova: Anna Grom i jeje prizrak

    Czech Academy of Sciences Publication Activity Database

    Ulbrechtová, Helena

    Ostrava : Ostravská univerzita v Ostravě. Filozofická fakulta, 2012, s. 209-223. ISBN 978-80-7464-161-9. - (Spisy Filozofické fakulty Ostravské univerzity. 263/2012) Institutional support: RVO:68378017 Keywords : Taubes, Susan * Rybakova, Maria * Third space * Gnosticisme Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Hobojista Arnošt König a jeho působení v pražském hudebním životě

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra

    2012-01-01

    Roč. 49, č. 3 (2012), s. 263-284. ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Arnošt König * oboist * Prague´s musical life * Antonín Dvořák Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. A survey of aphid parasitoids in Kahramanmaras, Turkey (Hymenoptera: Braconidae, Aphidiinae, and Hymenoptera: Aphelinidae)

    Czech Academy of Sciences Publication Activity Database

    Aslan, M. M.; Uygun, N.; Starý, Petr

    2004-01-01

    Roč. 32, č. 3 (2004), 255-263. ISSN 0334-2123 R&D Projects: GA AV ČR(CZ) IAA6007105; GA AV ČR(CZ) IBS5007102 Institutional research plan: CEZ:AV0Z5007907 Keywords : parasitoids Subject RIV: EG - Zoology Impact factor: 0.543, year: 2004

  15. Prevalence of Demodex spp among alcohol-dependent patients

    Directory of Open Access Journals (Sweden)

    Mehmet Hanifi Kokacya

    2016-06-01

    Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263

  16. Hypernuclei on the Nuclotron: Old Problems and New Prospects

    Czech Academy of Sciences Publication Activity Database

    Bartke, J.; Batusov, Yu.; Filipkowski, A.; Majling, Lubomír; Nikitin, V.; Parfenov, A.

    Dubna : JINR, Dubna, 2001 - (Baldin, A.; Burov, V.; Malakhov, A.), s. 256-263 [Proceedings of the International Seminar on High Energy Phisics Problems /15./. Dubna (RU), 01.01.2001] R&D Projects: GA ČR GA202/00/1667 Keywords : relativistic hypernuclei * weak decays of hypernuclei Subject RIV: BF - Elementary Particles and High Energy Physics

  17. K pojmu fonologické slovo v češtině

    Czech Academy of Sciences Publication Activity Database

    Bičan, Aleš

    Brno : Tribun EU, 2014 - (Boček, V.; Vykypěl, B.), s. 13-23 ISBN 978-80-263-0734-1 R&D Projects: GA ČR GP13-15361P Institutional support: RVO:68378092 Keywords : phonological word * phonology * grammatical word Subject RIV: AI - Linguistics

  18. Dilatometric and extensometric monitoring of rock blocks displacements within Machu Picchu archeological site, Peru

    Czech Academy of Sciences Publication Activity Database

    Vilímek, Vít; Klimeš, Jan; Zvelebil, J.; Astete, F.

    Tokyo: Springer, 2009 - (Sassa, K.; Canuti, P.), s. 259-263 ISBN 978-3-540-69966-8 Institutional research plan: CEZ:AV0Z30460519 Keywords : landslide monitoring * Machu Picchu * dilatometric and extensometric measurements Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  19. Domain Modeling: NP_066574.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066574.2 chr2 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr2/NP_066574.2.../NP_066574.2_holo_254-335.pdb blast 255K,259C,261E,262C,263G,264K,265A,266F,267F,268D

  20. Understanding the degree of awareness among medical professionals regarding the ethics of pharmaceutical marketing activities in context of revised medical council of India code of ethics

    Directory of Open Access Journals (Sweden)

    Renuka H. Munshi

    2016-04-01

    Conclusions: Most physicians do maintain a code of ethics with regards to accepting gifts and they felt that inexpensive gifts do not influence clinical judgment. Consultants were of the view that amended MCI code of ethics would not affect their clinical practice significantly. [Int J Basic Clin Pharmacol 2016; 5(2.000: 263-268

  1. GenBank blastx search result: AK241073 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241073 J065067D08 AL670399.4 AL670399 Mouse DNA sequence from clone RP23-263M10 on chromosome ... ein, the gene for a novel protein similar to human tax ... interacting protein 1, the Ctns gene for nephropat ...

  2. GenBank blastx search result: AK242630 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242630 J090022D11 AL670399.4 AL670399 Mouse DNA sequence from clone RP23-263M10 on chromosome ... ein, the gene for a novel protein similar to human tax ... interacting protein 1, the Ctns gene for nephropat ...

  3. GenBank blastx search result: AK058787 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058787 001-002-E05 AL670399.4 Mouse DNA sequence from clone RP23-263M10 on chromosome 11 Conta ... ein, the gene for a novel protein similar to human tax ... interacting protein 1, the Ctns gene for nephropat ...

  4. Navrávačky - autobiografický žáner medzi autentickosťou a fikciou

    Czech Academy of Sciences Publication Activity Database

    Zelenková, Anna

    Brno: Tribun EU, 2013 - (Pospíšil, I.; Zelenková, A.), s. 121-132 ISBN 978-80-263-0385-5 Institutional support: RVO:68378017 Keywords : Tatarka, Dominik * Tapings * Slovak modernism * autobiography * cultural memory Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Search for a new resonance decaying to a W or Z boson and a Higgs boson in the ℓℓ/ℓν/νν+bb¯ final states with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2015-01-01

    Roč. 75, č. 6 (2015), s. 263. ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * mass spectrum * (Z0 Higgs particle) * technicolor * background * triplet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.084, year: 2014

  6. Developing regional weight-for-age growth references for malaria-endemic countries to optimize age-based dosing of antimalarials = Développer des références régionales de croissance pour le rapport poids/âge dans les pays où le paludisme est endémique, afin d’optimiser la posologie des médicaments antipaludiques en fonction de l’âge = Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, D.J.; Buuren, S. van; Kuile, F.O. ter; Stasinopoulos, D.M.; Rigby, R.A.; Terlouw, D.J.

    2015-01-01

    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  7. Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, Daniel J.; van Buuren, Stef; ter Kuile, Feiko O.; Stasinopoulos, D. Mikis; Rigby, Robert A.; Terlouw, Dianne J.

    2015-01-01

    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  8. Perceived Social Support and Locus of Control as the Predictors of Vocational Outcome Expectations

    Science.gov (United States)

    Isik, Erkan

    2013-01-01

    The purpose of this study was to examine the relationships of vocational outcome expectation to social support which is an environmental factor and locus of control which is a personal factor. With this purpose, using Social Cognitive Career Theory as the theoretical framework, 263 undergraduate students completed Vocational Outcome Expectations…

  9. Zlepšení energetické bilance ČOV

    Czech Academy of Sciences Publication Activity Database

    Bartoník, A.; Holba, Marek; Plotěný, K.; Škvoran, O.; Horák, P.; Počínková, M.

    Brno: Asociace pro vodu ČR, 2011, s. 15-20. ISBN 978-80-263-0045-8. [Voda 2011. Poděbrady (CZ), 19.10.2011-21.10.2011] Institutional research plan: CEZ:AV0Z60050516 Keywords : energy balance * energy savings * wastewater treatment Subject RIV: EF - Botanics

  10. A scent shield to survive: identification of the repellent compounds secreted by the male offspring of the cuckoo bumblebee Bombus vestalis

    Czech Academy of Sciences Publication Activity Database

    Lhomme, P.; Ayasse, M.; Valterová, Irena; Lecocq, T.; Rasmont, P.

    2015-01-01

    Roč. 157, č. 3 (2015), s. 263-270. ISSN 0013-8703 Institutional support: RVO:61388963 Keywords : Hymenoptera * Apidae * Psithyrus * social parasitism * repellent * GC-EAD * chemical camouflage Subject RIV: EG - Zoology Impact factor: 1.616, year: 2014

  11. 76 FR 78235 - Dairyland Power Cooperative: CapX 2020 Hampton-Rochester-La Crosse Transmission Line Project

    Science.gov (United States)

    2011-12-16

    ... Falls, MN 55009. Phone: 507-263-2804. Dairyland Power Cooperative, 500 Old State Highway 35, Alma, WI.... People's Cooperative Services, 3935 Hwy 14 E., Rochester, MN 55903. Phone: 507-288-4004. Plainview Public..., 2012, Wanamingo Community Center, 401 Main Street, Wanamingo, Minnesota; January 11, 2012, Cannon...

  12. Rocks and walls: natural versus secondary habitats

    Czech Academy of Sciences Publication Activity Database

    Láníková, Deana; Lososová, Z.

    2009-01-01

    Roč. 44, č. 3 (2009), s. 263-280. ISSN 1211-9520 R&D Projects: GA ČR GA206/09/0329 Institutional research plan: CEZ:AV0Z60050516 Keywords : alien species * chasmophytic vegetation * diversity Subject RIV: EF - Botanics Impact factor: 1.320, year: 2009

  13. Educators vs. Entrepreneurs: Traits and Bias in the Teaching of SWOT

    Science.gov (United States)

    Clark, Andre

    2011-01-01

    A study of the marks allocated by 10 tutors to 263 students' SWOT (Strengths, Weaknesses, Opportunities, Threats) analyses on a range of business education courses reveals a largely hidden assumption regarding the balance of the four factors. To investigate the significance of this in light of the suggestion in the trait literature that…

  14. RBS and PIXE characterisation of Nd : KGW waveguiding films

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Peřina, Vratislav; Havránek, Vladimír; Jelínek, Miroslav; Lančok, Ján

    2003-01-01

    Roč. 53, č. 1 (2003), s. A241-A246. ISSN 0011-4626 R&D Projects: GA AV ČR KSK1010104 Keywords : RBS * pixe * waveguiding films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.263, year: 2003

  15. RBS and PIXE characterisation of Nd:KGW waveguiding films

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Peřina, Vratislav; Havránek, Vladimír; Jelínek, Miroslav; Lančok, Ján

    2003-01-01

    Roč. 43, č. 1 (2003), s. A241-A246. ISSN 0011-4626 Institutional research plan: CEZ:AV0Z1048901 Keywords : thin Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.263, year: 2003

  16. GenBank blastx search result: AK243151 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243151 J100032L04 AL732567.8 AL732567 Zebrafish DNA sequence from clone CH211-263A23 in linkag ... milar to SYNPR (synaptoporin), the grops1 gene for green -sensitive opsin 1, the grops 2 genefor green -sensi ...

  17. GenBank blastx search result: AK059467 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059467 001-028-D09 AL732567.8 Zebrafish DNA sequence from clone CH211-263A23 in linkage group ... milar to SYNPR (synaptoporin), the grops1 gene for green -sensitive opsin 1, the grops 2 genefor green -sensi ...

  18. GenBank blastx search result: AK061127 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061127 006-207-H01 AL732567.8 Zebrafish DNA sequence from clone CH211-263A23 in linkage group ... milar to SYNPR (synaptoporin), the grops1 gene for green -sensitive opsin 1, the grops 2 genefor green -sensi ...

  19. Relationships among Dogmatism, Family Ideology, and Religiosity in Master's-Level Counseling Students.

    Science.gov (United States)

    Hunter, Steve; Harris, Morag B. Colvin; Trusty, Jerry

    1998-01-01

    Presents the results of a survey of the perceptions of master's-level students (N=263) in the areas of dogmatism, family ideology, and religiosity. Findings indicate that graduating participants were significantly lower in levels of dogmatism than were beginning participants. Data analysis also revealed that family ideology was more strongly…

  20. Self-Regulation in Early Adolescence: Relations with Mother-Son Relationship Quality and Maternal Regulatory Support and Antagonism

    Science.gov (United States)

    Moilanen, Kristin L.; Shaw, Daniel S.; Fitzpatrick, Amber

    2010-01-01

    The purpose of the current investigation was to examine relations among maternal regulatory support, maternal antagonism, and mother-son relationship quality in relation to boys' self-regulation during early adolescence. As part of a larger longitudinal study on 263 low-income, ethnically diverse boys, multiple informants and methods were used to…

  1. Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.

    2015-01-01

    Roč. 142, OCT 2015 (2015), s. 257-263. ISSN 0013-9351 Grant ostatní: OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 4.373, year: 2014

  2. alpha-Tocopheryl succinate inhibits angiogenesis by disrupting paracrine FGF2 signalling

    Czech Academy of Sciences Publication Activity Database

    Neužil, Jiří; Swettenham, E.; Wang, X.F.; Dong, L.F.; Stapelberg, M.

    2007-01-01

    Roč. 581, č. 24 (2007), s. 4611-4615. ISSN 0014-5793 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50520701 Keywords : mitocans * proliferating endothelial cells * apoptosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2007

  3. Reference: OCTAMOTIF2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available OCTAMOTIF2 Chaubet N, Philipps G, Chaboute M-E, Ehling M, Gigot C Nucleotide sequences of two corn ... rn histone H3 genes. Genomic organization of the corn ... histone H3 and H4 genes. Plant Mol Biol 6:253-263 ...

  4. Spontaneous restoration of target vegetation in old-fields in a central European landscape: a repeated analysis after three decades

    Czech Academy of Sciences Publication Activity Database

    Jírová, Alena; Klaudisová, A.; Prach, Karel

    2012-01-01

    Roč. 15, č. 2 (2012), 245-252. ISSN 1402-2001 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : succession * vegetation * abandoned fields Subject RIV: EH - Ecology, Behaviour Impact factor: 2.263, year: 2012

  5. Testing Collective Memory: Representing the Soviet Union on Multiple-Choice Questions

    Science.gov (United States)

    Reich, Gabriel A.

    2011-01-01

    This article tests the assumption that state-mandated multiple-choice history exams are a cultural tool for disseminating an "official" collective memory. Findings from a qualitative study of a collection of multiple-choice questions that relate to the history of the Soviet Union are presented. The 263 questions all come from New York State…

  6. The Relation of Maternal Emotional and Cognitive Support during Problem Solving to Pre-Academic Skills in Preschoolers

    Science.gov (United States)

    Leerkes, Esther M.; Blankson, A. Nayena; O'Brien, Marion; Calkins, Susan D.; Marcovitch, Stuart

    2011-01-01

    Using a sample of 263 mother-child dyads, we examined the extent to which maternal emotional and cognitive support during a joint problem-solving task when children were 3-years-old predicted children's academic skills 1 year later independent of each other, the quality of the home learning environment, and maternal emotional responsiveness. When…

  7. Frühes Eisenbahnwesen und Technologietransfer in den Böhmischen Ländern und in der Habsburgermonarchie 1837-1842

    Czech Academy of Sciences Publication Activity Database

    Hlavačka, Milan

    Wien : Österreichisches Staatsarchiv, 2004 - (Dinhobl, G.), s. 263-282 ISBN 3-7065-4031-2. - (Mitteilungen des Österreichischen Staatsarchivs. Sonderband. 7) Institutional research plan: CEZ:AV0Z8015903 Keywords : history * railway * technology Subject RIV: AB - History

  8. 40 CFR 721.10193 - 1-Butanaminium, N-(3-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts.

    Science.gov (United States)

    2010-07-01

    ...-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts. 721.10193 Section 721.10193 Protection of...-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts. (a) Chemical substance and...-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts (PMN P-06-263, Chemical B; CAS...

  9. Gclust Server: 197185 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 197185 Bja_bll4256 Cluster Sequences - 263 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 197...185 Cluster ID 197185 Sequence ID Bja_bll4256 Link to cluster sequences Cluster Seq

  10. 77 FR 65728 - Final Interim Staff Guidance Augmenting NUREG-1537, “Guidelines for Preparing and Reviewing...

    Science.gov (United States)

    2012-10-30

    .... Disposition: On June 20, 2011 (76 FR 35922), the NRC published for public comment the draft ISG, ``Staff..., ADAMS Accession Nos. ML11216A140, ML11220A263, and ML11217A018. On October 13, 2011 (76 FR 63668), the...'' (ADAMS Accession No. ML111810010). On April 10, 2012 (77 FR 21592), the NRC published for public...

  11. A review of the distribution of Yellowhammer (Emberiza citrinella) dialects in Europe reveals the lack of a clear macrogeographic pattern

    Czech Academy of Sciences Publication Activity Database

    Petrusková, T.; Diblíková, L.; Pipek, P.; Frauendorf, E.; Procházka, Petr; Petrusek, A.

    2015-01-01

    Roč. 156, č. 1 (2015), s. 263-273. ISSN 0021-8375 Institutional support: RVO:68081766 Keywords : Emberiza citrinella * Song variation * Dialect nomenclature * Online sources * Macrogeographic patterns Subject RIV: EG - Zoology Impact factor: 1.711, year: 2014

  12. Fine Mapping and Evolution of a QTL Region on Cattle Chromosome 3

    Science.gov (United States)

    Donthu, Ravikiran

    2009-01-01

    The goal of my dissertation was to fine map the milk yield and composition quantitative trait loci (QTL) mapped to cattle chromosome 3 (BTA3) by Heyen et al. (1999) and to identify candidate genes affecting these traits. To accomplish this, the region between "BL41" and "TGLA263" was mapped to the cattle genome sequence assembly Btau 3.1 and a…

  13. Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 263-265. ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-53.pdf

  14. The DSM-IV Construct of Cocaine Dependence in a Treatment Sample of Black, Mexican American, and White Men.

    Science.gov (United States)

    Schafer, John; Caetano, Raul

    1996-01-01

    The unidimensionality of the fourth edition of the "Diagnostic and Statistical Manual of Mental Disorders" (DSM-IV) construct of cocaine dependence was examined among 263 black, 212 Mexican American, and 256 white men in treatment. Results generally support a unidimensional model of the cocaine dependence indicators, with one indicator considered…

  15. 78 FR 3916 - Certain Blu-Ray Disc Players, Components Thereof and Products Containing the Same; Termination of...

    Science.gov (United States)

    2013-01-17

    ... infringement of certain claims of U.S. Patent No. 6,263,505. 77 FR 1725 (Jan. 11, 2012). The notice of... Corporation and Sony Computer Entertainment Inc., both of Tokyo, Japan; Sony Corporation of America of New York, New York; Sony Electronics Inc. of San Diego, California; and Sony Computer Entertainment...

  16. Effect of sodium hypochlorite exposure on infectivity of Cryptosporidium parvum oocysts for neonatal BALB/c mice.

    OpenAIRE

    Fayer, R

    1995-01-01

    Oocysts of Cryptosporidium parvum suspended in 5.25, 2.63, or 1.31% aqueous sodium hypochlorite (Clorox laundry bleach) for 10, 30, 60, or 120 min at 21 degrees C were administered by gastric intubation to neonatal BALB/c mice. Microscopic examination of intestinal tissue sections revealed developmental stages of C. parvum in all of the mice.

  17. Specific domain knockout of murine DNA damage-inducible protein homolog 2 (Ddi2)

    Czech Academy of Sciences Publication Activity Database

    Sivá, Monika; Chawengsaksophak, Kallayanee; Svoboda, Michal; Kašpárek, Petr; Procházka, Jan; Sedláček, Radislav; Konvalinka, Jan; Grantz Šašková, Klára

    2016-01-01

    Roč. 25, č. 2 (2016), s. 262-263. ISSN 0962-8819. [Transgenic Technology Meeting (TT2016) /13./. 20.03.2016-23.03.2016, Praha] Institutional support: RVO:61388963 ; RVO:68378050 Keywords : ubiquitin * aspartic protease * embryonic lethality * shuttling protein Subject RIV: CE - Biochemistry

  18. Midway Atoll Site P18 12/4/2002 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P18 (28.263 N, 177.337 W), between 2 and 3 meters along a permanent transect.

  19. Preschool Classroom Processes as Predictors of Children's Cognitive Self-Regulation Skills Development

    Science.gov (United States)

    Fuhs, Mary Wagner; Farran, Dale C.; Nesbitt, Kimberly Turner

    2013-01-01

    This research focuses on the associations between interactive processes of early childhood classrooms and gains in children's cognitive self-regulation (CSR) across the preschool year. Data from 803 children (45.8% female; "M" = 54 months; 39.1% Caucasian, 26.3% African American, 24.6% Hispanic, 9.9% Other) were collected at fall and…

  20. Invaze tančících lupičů těl

    Czech Academy of Sciences Publication Activity Database

    Schmarc, Vít

    Praha: Akropolis, 2012 - (Veberová, V.; Bílek, P.; Papoušek, V.; Skalický, D.), s. 250-263 ISBN 978-80-87481-67-7 Institutional support: RVO:68378068 Keywords : socialist realism * ideology * manipulation * subject * collective Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. Magnetic and transport properties of CeCo.sub.12./sub. B.sub.6./sub. and CeFe.sub.2./sub.Co.sub.10./sub. B.sub.6./sub. compounds under pressure

    Czech Academy of Sciences Publication Activity Database

    Míšek, M.; Arnold, Zdeněk; Isnard, O.; Mayot, H.; Skorokhod, Yuriy; Kamarád, Jiří

    2008-01-01

    Roč. 113, č. 1 (2008), s. 263-266. ISSN 0587-4246 R&D Projects: GA ČR(CZ) GA106/06/0368 Institutional research plan: CEZ:AV0Z10100521 Keywords : magnetic ordering * magnetic phase boundaries Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.321, year: 2008

  2. Activity and mechanism of action of insect oostatic peptides in flesh fly

    Czech Academy of Sciences Publication Activity Database

    Slaninová, Jiřina; Bennettová, Blanka; Nazarov, Elšan; Šimek, Petr; Holík, Josef; Vlasáková, Věra; Hlaváček, Jan; Černý, B.; Tykva, Richard

    2004-01-01

    Roč. 32, - (2004), s. 263-273. ISSN 0045-2068 R&D Projects: GA ČR GA203/02/0247 Institutional research plan: CEZ:AV0Z4055905 Keywords : oostatic activity * binding experiments * degradation Subject RIV: CC - Organic Chemistry Impact factor: 1.240, year: 2004

  3. Microflares and the Statistics of X-ray Flares

    Czech Academy of Sciences Publication Activity Database

    Hannah, I.G.; Hudson, H. S.; Battaglia, M.; Christe, S.; Kašparová, Jana; Krucker, S.; Kundu, M.R.; Veronig, A.

    2011-01-01

    Roč. 159, 1-4 (2011), s. 263-300. ISSN 0038-6308 R&D Projects: GA ČR GP205/06/P135 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * flares * X-rays Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.611, year: 2011

  4. Breast cancer and serum ferritin - Menopausal status perspective: Menopause - A fickle determinant

    Directory of Open Access Journals (Sweden)

    Harshal P. Narkhede

    2014-02-01

    Conclusions: Serum ferritin levels abide no obvious influence of age or menopausal status in breast cancer patients as well as post-menopausal women devoid of metabolic syndrome. The present study reiterates the possible role of iron in breast carcinogenesis. [Int J Res Med Sci 2014; 2(1.000: 258-263

  5. AcEST: DK956530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TH Cysteine proteinase RD21a OS=Arabidopsis t... 195 2e-49 sp|Q94B08|GCP1_ARATH Germination...V YSE +L +AV Sbjct: 238 KNAKVVTIDSYEDVPTYSEESLKKAV 263 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine p

  6. Isotope exchange study of the dissociation of metal - humic substance complexes

    Czech Academy of Sciences Publication Activity Database

    Mizera, J.; Jansová, A.; Hvoždová, I.; Beneš, P.; Novák, František

    2003-01-01

    Roč. 53, A (2003), s. A97-A101. ISSN 0011-4626 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 210000019 Keywords : isotope exchange * dissociation of metal * humic substance complexes Subject RIV: EH - Ecology, Behaviour Impact factor: 0.263, year: 2003

  7. 37 CFR 256.2 - Royalty fee for compulsory license for secondary transmission by cable systems.

    Science.gov (United States)

    2010-07-01

    ... interpreted in accordance with 47 CFR 76.51, as effective June 24, 1981. ... Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES... which $263,800 exceeds such actual gross receipts, except that in no case shall a cable system's...

  8. Stručně k slovanskému nominativu plurálu zájmena druhé osoby

    Czech Academy of Sciences Publication Activity Database

    Vykypěl, Bohumil

    Brno : Tribun EU, 2014 - (Boček, V.; Vykypěl, B.), s. 67-69 ISBN 978-80-263-0734-1 R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavonic languages * linguistics * etymology Subject RIV: AI - Linguistics

  9. Defining roles of RNA silencing in mammalian cells

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Petr

    2007-01-01

    Roč. 3, č. 1 (2007), s. 254-263. [ RNA i2007: The Expanding Roles of Small RNA s. 29.03.2007-30.3.2007, Oxford] R&D Projects: GA AV ČR IAA501110701 Institutional research plan: CEZ:AV0Z50520514 Keywords : dsRNA * RNA i * Dicer Subject RIV: EB - Genetics ; Molecular Biology

  10. "Al costume di diversi paesi". Theorie der Architektur in der Frühen Neuzeit

    Czech Academy of Sciences Publication Activity Database

    Muchka, Ivan

    Ljubljana: Založba ZRC, 2015 - (Lavrič, A.; Lazarini, F.; Murovec, B.), s. 263-275. (Opera Instituti Artis Historiae). ISBN 978-961-254-873-5 Institutional support: RVO:68378033 Keywords : Sebastiano Serlio * architecture * Early Modern Age Subject RIV: AL - Art, Architecture , Cultural Heritage

  11. Goal-Oriented hp-Adaptivity for Elliptic Problems

    Czech Academy of Sciences Publication Activity Database

    Šolín, Pavel; Demkowicz, L.

    2004-01-01

    Roč. 193, 6-8 (2004), s. 449-468. ISSN 0045-7825 R&D Projects: GA ČR GP102/01/D114 Keywords : hp-finite elements * hp-adaptivity * Dual problem Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.263, year: 2004

  12. 49 CFR 171.3 - Hazardous waste.

    Science.gov (United States)

    2010-10-01

    ... have identification numbers which must be displayed on hazardous waste manifests. See 40 CFR parts 262...: In 40 CFR part 263, the EPA sets forth requirements for the cleanup of releases of hazardous wastes. ... 49 Transportation 2 2010-10-01 2010-10-01 false Hazardous waste. 171.3 Section...

  13. Poznámka k pojmu expanze v etymologické lexikografii

    Czech Academy of Sciences Publication Activity Database

    Boček, Vít

    Brno: Tribun EU, 2014 - (Boček, V.; Vykypěl, B.), s. 25-31 ISBN 978-80-263-0734-1 R&D Projects : GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : etymological dictionaries * loanwords * expansion * etymology Subject RIV: AI - Linguistics

  14. John Eisler

    Czech Academy of Sciences Publication Activity Database

    Platovská, Marie

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 260-263 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : SIAL * architecture of the 20th century and 21th century * Richard Meier Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Polypseudorotaxanes between .alpha.-cyclodextrin and poly(propylene glycol)-b-poly(ethylene glycol)-b-poly(propylene glycol) copolymers studied by MALDI-TOF mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Horský, Jiří; Walterová, Zuzana

    2016-01-01

    Roč. 74, January (2016), s. 256-263. ISSN 0014-3057 Grant ostatní: OPPK(XE) CZ.2.16/3.1.00/24504 Institutional support: RVO:61389013 Keywords : polypseudorotaxanes * reverse pluronics * cyclodextrin Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.005, year: 2014

  16. Export of Medicines and Health-Care Products Increases Constantly

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ The export of medicines and healthcare products from China hit a new high in 2006 and became the major driving force for the development of the sector. The export value reached US$19.61 billion, an increase of 26.3% over 2006.

  17. Midway Atoll Site P18 12/4/2002 17-18M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P18 28.263 N, 177.337 W, between 17 and 18 meters along a permanent transect.

  18. Utilization of an Academic Nursing Center.

    Science.gov (United States)

    Cole, Frank L.; Mackey, Thomas

    1996-01-01

    Using data from an academic nursing center that cared for 3,263 patients over eight months, diseases were classified using International Classification of Diseases codes, and procedures were classified using Current Procedural Terminology codes. Patterns of health care emerged, with implications for clinical teaching. (SK)

  19. Oenothera coronifera, a new alien species for the Czech flora, and Oenothera stricta, recorded again after nearly two centuries

    Czech Academy of Sciences Publication Activity Database

    Mihulka, Stanislav; Pyšek, Petr; Pyšek, A.

    2003-01-01

    Roč. 75, - (2003), s. 263-270. ISSN 0032-7786 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/1239 Institutional research plan: CEZ:AV0Z6005908 Keywords : alien plants * casual occurrence * Oenothera Subject RIV: EF - Botanics

  20. Midway Atoll Site P18 12/4/2002 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P18 (28.263 N, 177.337 W), between 1 and 2 meters along a permanent transect.