WorldWideScience

Sample records for bledo pira creciendo

  1. Piraña and PCluster: a modeling environment and cluster infrastructure for NONMEM.

    Science.gov (United States)

    Keizer, Ron J; van Benten, Michel; Beijnen, Jos H; Schellens, Jan H M; Huitema, Alwin D R

    2011-01-01

    Pharmacokinetic-pharmacodynamic modeling using non-linear mixed effects modeling (NONMEM) is a powerful yet challenging technique, as the software is generally accessed from the command line. A graphical user interface, Piraña, was developed that offers a complete modeling environment for NONMEM, enabling both novice and advanced users to increase efficiency of their workflow. Piraña provides features for the management and creation of model files, the overview of modeling results, creation of run reports and handling of datasets and output tables, and the running of custom R scripts on model output. Through the secure shell (SSH) protocol, Piraña can also be used to connect to Linux clusters (SGE, MOSIX) for distribution of workload. Modeling with NONMEM is computationally burdensome, which may be alleviated by distributing runs to computer clusters. A solution to this problem is offered here, called PCluster. This platform is easy to set up, runs in standard network environments, and can be extended with additional nodes if needed. The cluster supports the modeling toolkit Perl speaks NONMEM (PsN), and can include dedicated or non-dedicated PCs. A daemon script, written in Perl, was designed to run in the background on each node in the cluster, and to manage job distribution. The PCluster can be accessed from Piraña, and both software products have extensively been tested on a large academic network. The software is available under an open-source license. PMID:20627442

  2. Datação das formações Rio Claro e Piraçununga por termoluminescência Thermoluminescence dating of Rio Claro and Piraçununga Formations

    Directory of Open Access Journals (Sweden)

    Sandra Regina Ferreira

    2008-06-01

    Full Text Available As formações Rio Claro e Piraçununga recobrem extensas áreas da Depressão Periférica Paulista, sobretudo na região das cidades homônimas, sobrepondo-se às formações Corumbataí e Pirambóia, em contato discordante. Caracterizam-se por fácies de areias finas a médias, localmente apresentando estratificações plano-paralelas e cruzadas e delgadas intercalações de lamas e cascalhos. As areias foram datadas pelo método de termoluminescência e apresentaram idade do Pleistoceno. A idade mais antiga, de 745.000 anos AP, foi determinada em amostras da formação Rio Claro; as demais apresentaram resultados entre 400.000 e 145.000 anos AP, para ambas unidades. A idade mais recente, de 15.000 anos AP, foi obtida em amostra de depósito coluvionar sobreposto à formação Piraçununga, próximo ao limite Pleistoceno/Holoceno.The Rio Claro and Piraçununga formations cover extensive areas of the Paulista Peripheral Depression, dominantly in the region of Rio Claro and Piraçununga cities. These units lie over the Corumbataí and Pirambóia formations, exhibiting discordant contacts. The Rio Claro and Piraçununga formations are composed of fine to medium sand facies, showing local cross-stratifications and parallel beddings with thin interbeddings of mud and gravel. These sands were dated by the Thermoluminescence Method, which indicated they were from the Pleistocene age. The oldest age (745,000 years BP was found in deposits of the Rio Claro Formation; the other ages varied from 400,000 years BP to 145,000 years BP, for both formations. The youngest age (15,000 years BP - close to Pleistocene/Holocene limit was found in colluvial deposits, which rest on the Piraçununga Formation.

  3. Datação das formações Rio Claro e Piraçununga por termoluminescência Thermoluminescence dating of Rio Claro and Piraçununga Formations

    OpenAIRE

    Sandra Regina Ferreira; Maria Rita Caetano Chang

    2008-01-01

    As formações Rio Claro e Piraçununga recobrem extensas áreas da Depressão Periférica Paulista, sobretudo na região das cidades homônimas, sobrepondo-se às formações Corumbataí e Pirambóia, em contato discordante. Caracterizam-se por fácies de areias finas a médias, localmente apresentando estratificações plano-paralelas e cruzadas e delgadas intercalações de lamas e cascalhos. As areias foram datadas pelo método de termoluminescência e apresentaram idade do Pleistoceno. A idade mais antiga, d...

  4. Piraňa

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    2007-01-01

    Roč. 90, č. 3 (2007), s. 165-166. ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610518 Keywords : declension * semantics * etymology Subject RIV: AI - Linguistics

  5. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae) em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae) in Piraí do Sul, Paraná, southern Brazil

    OpenAIRE

    Fernanda G. Braga; Yoshiko S. Kuniyoshi

    2010-01-01

    Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...

  6. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae in Piraí do Sul, Paraná, southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda G. Braga

    2010-06-01

    Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although

  7. Una bola de nieve está creciendo en los servicios sanitarios: los pacientes supervivientes de cáncer The growing snowball in health services: long-term cancer survivors

    Directory of Open Access Journals (Sweden)

    Tàrsila Ferro

    2011-06-01

    Full Text Available Una de las consecuencias del progreso en el diagnóstico y el tratamiento del cáncer es el aumento de la supervivencia observado en las últimas décadas en Europa y en España. El número de nuevos casos de cáncer continúa aumentando principalmente debido al envejecimiento de la población, por lo que es previsible que el número de personas que viven años tras un diagnóstico de cáncer continúe creciendo. Este hecho supone un elemento de presión a los sistemas sanitarios, que muestran sus limitaciones para atenderlos con el modelo actual de seguimiento. Deben plantearse nuevos escenarios asistenciales, tanto desde la perspectiva de la gestión sanitaria como de la clínica. A pesar de no haber suficiente evidencia científica sobre cómo sistematizar el seguimiento de los casos, se están impulsando diversas estrategias, sobre todo en otros países, para lograr una mayor adecuación en la provisión de servicios a estos pacientes. En España tales experiencias son muy escasas, pero dada la situación emergente, que bien puede ser comparada a un efecto en bola de nieve, se requiere la revisión y la reformulación del modelo actual para ofrecer una respuesta más efectiva y ajustada a la realidad. El propósito de este artículo es identificar las prioridades de atención de estos pacientes desde el punto de vista sanitario, revisar los modelos organizativos que se ensayan en otros países y proponer un marco de referencia, basado en la integración de niveles asistenciales, incluyendo atención primaria de la salud, que es la Cenicienta en este problema, como aproximación a un modelo que permita evaluar las mejores opciones asistenciales para estos pacientes en nuestro entorno sanitario.One of the consequences of diagnostic and therapeutic progress in cancer is the increased survival observed in the last few decades in Spain and elsewhere in Europe. New cancer cases are increasing steadily due to population aging, among other factors

  8. Creciendo Sin Drogas: Guia de Prevencion para Padres (Growing Up Drug-Free: A Parent's Guide to Prevention).

    Science.gov (United States)

    Office of Elementary and Secondary Education (ED), Washington, DC. Safe and Drug Free Schools Program.

    This publication is part of the Department of Education's ongoing effort to provide information to emerging populations in their native language on how to create and maintain drug-free and safe schools across the nation. Throughout the publication are personal stories and artwork of elementary and secondary school students that promote the message…

  9. Biology and conservation status of Piraja’s Lancehead Snake Bothrops piraña Amaral, 1923 (Serpentes: Viperidae, Brazil

    Directory of Open Access Journals (Sweden)

    M.A.D. Freitas

    2014-09-01

    Full Text Available The venomous snake Bothrops pirajai (Amaral, 1923 is endemic to Brazil. Despite being described almost a century ago, very little is known about this species, which has never been studied in situ. Here, we present new data on the biology and natural history of B. pirajai based on a review of existing museum specimens and a field study (1504 man hours carried out throughout the species range. The distribution of B. pirajai was found to be restricted to the eastern Atlantic forest of the state of Bahia, Brazil, between Todosos Santos Bay, Itabuna and Ilhéus (12050’S-14050’S, 88-835 m. We recommend the species be uplisted to Endangered in the International Union for the Conservation of Nature’s global Red List of Threatened Species as its estimated extent of occurrence is under 5000km2. The effective conservation of B. pirajai will rely on addressing two key issues: improving our knowledge of the species and successfully mitigating habitat loss and fragmentation.

  10. Crystal structure of pira toxin-I: a calcium-independent, myotoxic phospholipase A2 - homologue from Bothrops pirajai venom

    International Nuclear Information System (INIS)

    Full text. Phospho lipases A2 (PLA2) are small enzymes that specifically hydrolysed the sn-2 ester bond of phospholipids, preferentially in lamellar or micellar aggregates at membrane surfaces. These enzymes are widely distributed in nature and have been extensively studied. Toxic proteins from venoms from Bothrops species include catalytically active PLA2s and calcium independent PLA2Lys 49 homologues. The substitution of Asp49 by Lys greatly diminishes the ability of these PLA2 to bind calcium, an ion that plays a critical role in the stabilization of the tetrahedral transition state intermediate in the catalytic mechanism. The Lys 49 PLA2 homologues and therefore catalytically inactive yet maintain cytolytic and myotoxic activities and furthermore retain the ability to disrupt the integrity of both plasma membranes and model lipid bilayers by a poorly understood Ca 2+ independente mechanism. Lys49 PLA2 homologues demonstrate a specific toxic activity against skeletal muscle, affecting only muscle fibers and leaving other tissue structure such as connective tissue, nerves and vessels essentially unharmed. In order to improve our understanding of the molecular basis of the myotoxic and Ca 2+ -independent membrane damaging activities, we have determined the crystal structure of Pr TX-I, a Lys49 variant from the venom of B. pirajai. The model presented has been determined at 2.8 angstrom resolution and refined to a crystallographic residual of 19.7% (Rfree=29.7%). (author)

  11. La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-12-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  12. ¿Reducir creciendo? La estrategia del sector aéreo para mitigar su papel en el cambio climático visto desde la soberanía alimentaria

    OpenAIRE

    Gascón Gutiérrez, Jordi

    2012-01-01

    En los últimos años, los estudios turísticos han ido dando una creciente relevancia al rol del turismo (y concretamente del transporte aéreo) en el cambio climático. Sin embargo, aún no se ha incorporado al análisis las consecuencias que el turismo, como vector del cambio climático, tiene sobre otros sectores económicos. Tampoco se ha analizado qué consecuencias puede tener para esos otros sectores algunas de las propuestas que la industria y diferentes instituciones plantean para amortiguar ...

  13. Protein (Cyanobacteria): 249773 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782242.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAQLWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCQEGQRFGALKSGKRQG

  14. Protein (Cyanobacteria): 249820 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09780023.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREELIAQIEQMEPEGLVYLDEAGMNSSDSDYPYGYCEEGTTLPMPSNQGRGKGRGELYGPRGLNNNFLTPL ...

  15. Protein (Cyanobacteria): 249776 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09783561.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERWKQQREEFIAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSYMAPWCDQQLLAPF

  16. Protein (Cyanobacteria): 249772 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781578.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  17. Protein (Cyanobacteria): 249770 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782144.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  18. Protein (Cyanobacteria): 144862 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNLSRILRETSKQNHYDGCGFQNPAGMKKAGMGIPTIQDRAKQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYLCINHSDYYVLDADIACETFRSEIGLQCLK ...

  19. Protein (Cyanobacteria): 249781 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781797.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERDEQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSMIAAWCHQQLLAPF

  20. Protein (Cyanobacteria): 144863 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNWLRALREISKPNHCDGCGFQNLEGMKKAGMGIPTIQDRARQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYSSINKGEYFVLDAGARRSGMK ...

  1. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel

    2012-09-01

    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los 20 y 66 DDS, respectivamente, y también se redujo a una menor saturación de Al. En suelos con 60% de saturación de Al se observó una gran producción de esporas a los 41 DDS, siendo 'Aurora' el de más alta densidad de esporas a los 66 DDS. A los 20 DDS se observó una relación negativa (r = -0.37, p < 0,001 entre la colonización MA temprana y la masa de las raíces. Además, dicha relación fue más fuerte (r = -0.49, p < 0,001 cuando las plantas fueron cultivadas en alta saturación de Al. Una temprana colonización MA se observó en todos los cultivares ensayados cuando se cultivaron en alta saturación de Al y fue superior en las variedades aparentemente más tolerantes a Al, sugiriendo que una temprana colonización MA puede ser un factor importante en la tolerancia a Al para plantas agrícolas cultivadas en suelos ácidos.

  2. Field Insect Pests and Crop Damage Assessment of Pigeon Pea (Cajanus cajan [L.] Huth grown under Ratoon and in Mixture with Maize Evaluación de Campo de Insectos Pestes y Daño del cultivo de Gandul (Cajanus cajan [L.] Huth creciendo bajo Rebrotes o en Mezcla con Maíz

    Directory of Open Access Journals (Sweden)

    Madang A Dasbak

    2012-03-01

    Full Text Available The widespread adoption of cropping systems that are sustainable and environmentally friendly is vital for the macroeconomic survival of civilization. Intercropping could ensure stability of insect populations in a system. A 3-yr (2005-2007 field trial was therefore carried out in Nigeria under regular and ratoon crops to evaluate five recently developed pigeon pea (Cajanus cajan [L.] Huth genotypes (ICPL 87, ICPL 161, ICPL 85063, ICP 7120, and ICPL 87119 from the International Crops Research Institute for Semi-Arid Tropics (ICRISAT and one local variety for their relative performance and susceptibility to insect pests. The pigeon pea genotypes were in a mixture with two maize genotypes (Zea mays L., open-pollinated and hybrid in regular crops for 2 yr (2005-2006 followed by a ratoon crop for 1 yr (2007. Termites (Odontotermes badius, crickets (Gymnogryllus lucens, and variegated grasshoppers (Zonocerus variegatus were the crop's seedling pests and caused minimal damage. Clavigralla spp. infestations were high at the reproductive stage causing 24% and 29% seed damage in regular and ratoon pigeon pea crops, respectively. Maize slightly suppressed insect pest incidence and damage to pigeon pea pods and seeds but significantly (P La extendida adopción de sistemas de cultivo que son sustentables y benignos para el medio ambiente es vital para la supervivencia macro-económica de la civilización. El intercultivo podría asegurar la estabilidad de población de insectos en un sistema. Un ensayo de campo de 3 anos (2005-2007 fue realizado en Nigeria bajo condiciones de cultivo regular y ratoon para evaluar cinco genotipos de poroto gandul (Cajanus cajan [L.] Huth: ICPL 87, ICPL 161, ICPL 85063, ICP 7120, e ICPL 87119 desde International Crops Research Institute for Semi-Arid Tropics (ICRISAT y una variedad local, por sus rendimientos y susceptibilidades relativas a insectos plaga. Los genotipos de poroto gandul estaban en mezcla con dos genotipos de maíz (Zea mays L., de polinización abierta e híbrido en cultivos regulares por 2 anos (2005-2006 seguido por un ratoon por 1 ano (2007. Termitas (Odontotermes badius, grillos (Gymnogryllus lucens y saltamontes variegado (Zonocerus variegatus fueron las plagas de plántula del cultivo, causando dano mínimo. Infestaciones con Clavigralla spp. fueron altas en el estado reproductivo causando 24% y 29% de dano seminal en cultivos regular y de poroto gandul ratoon. El maíz suprimió la incidencia de la plaga y el dano a las vainas y semillas de poroto gandul pero redujeron significativamente (P < 0,01 el rendimiento de grano en los cultivos de poroto gandul en 2005 y 2006, pero no en ratoon en 2007. Los genotipos de poroto gandul difirieron significativamente (P < 0,05 en incidencia de la plaga al estado de vaina en cultivos regular y ratoon y en rendimiento de grano (P < 0,01 bajo el cultivo regular. El rendimiento de granos de los cultivos de poroto gandul ratoon fue aproximadamente 60% de aquel del cultivo regular. Los genotipos ICPL 161 e ICPL 87 se recomendaron para adopción por los agricultores basados en tolerancia a las plagas y alto rendimiento de granos o como idiotipos en programas de hibridación de poroto gandul.

  3. Growing up with HIV/AIDS: a study on adolescents with HIV/AIDS and their family caregivers Creciendo con VIH/SIDA: un estudio con adolescentes portadoras de VIH/SIDA y sus cuidadoras familiares Crescendo com HIV/AIDS: estudo com adolescentes portadoras de HIV/AIDS e suas cuidadoras-familiares

    Directory of Open Access Journals (Sweden)

    Ana Amélia Antunes Lima

    2008-06-01

    Full Text Available This is an exploratory study with a qualitative approach, which looks at the adolescent process with HIV/AIDS. The purpose is to identify how the adolescent process occurs, from the perspective of these teenagers and their family caregivers. The investigation was performed in Porto Alegre, RS between May and July 2005, and the subjects were four adolescents and three caregivers. Data were collected by means of interviews, which were subject to the content analysis technique. The study revealed that both teenagers and family caregivers did not show concern with the changes typical of the period, especially regarding sexuality questions. Yet, the underlying diagnosis and coping with HIV remain in the family core in order to protect these agents against the stigma of the disease.Es un estudio exploratorio con abordaje cualitativo, que trata del proceso de desarrollo de la adolescencia en portadoras de VIH/SIDA, con el objetivo de identificar cómo ocurre el proceso de la adolescencia, en la visión de estas adolescentes y de sus cuidadoras familiares.La investigación se realizó en Porto Alegre-RS, entre los meses de mayo y julio de 2005; los sujetos fueron cuatro adolescentes y tres cuidadoras. La colecta de las informaciones se hizo por medio de entrevistas que fueron sometidas a la técnica de análisis de contenido. El estudio reveló que las adolescentes y sus cuidadoras familiares, manifestaron preocupación con los cambios propios de ese período, especialmente en asuntos relacionados a la sexualidad. Se hizo evidente que el diagnóstico y la convivencia con el VIH permanecen ocultos en el contexto familiar, con el objetivo de proteger, a estos actores, del estigma de la enfermedad.Estudo exploratório com abordagem qualitativa, que trata do processo de adolescer de portadoras de HIV/AIDS, com o objetivo de identificar como ocorre o processo da adolescência, na ótica dessas adolescentes e de suas cuidadoras-familiares. A investigação foi realizada em Porto Alegre, RS, entre os meses de maio e julho de 2005, sendo que os sujeitos foram quatro adolescentes e três cuidadoras. A coleta das informações ocorreu por meio de entrevistas que foram submetidas à técnica de análise de conteúdo. O estudo revelou que tanto as adolescentes quanto suas cuidadoras-familiares não manifestaram preocupação com as transformações próprias do período, especialmente nas questões que envolvem a sexualidade. Evidenciou-se que o diagnóstico e a convivência com o HIV ainda permanecem velados no círculo familiar, visando a proteção desses atores com relação ao estigma da doença.

  4. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    OpenAIRE

    Filip Cvitić; Jesenka Pibernik

    2014-01-01

    Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010), given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira) in 2002 (Williams, 2004). Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explore...

  5. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products

    OpenAIRE

    Ola M. EL-Houssini; Nagwan H. Zawilla; Mohammad, Mohammad A.

    2013-01-01

    Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over conce...

  6. Analysis of the genome of a Korean isolate of the Pieris rapae granulovirus enabled by its separation from total host genomic DNA by pulse-field electrophoresis.

    Directory of Open Access Journals (Sweden)

    Yong Hun Jo

    Full Text Available BACKGROUND: Most traditional genome sequencing projects involving viruses include the culture and purification of the virus particles. However, purification of virions may yield insufficient material for traditional sequencing. The electrophoretic method described here provides a strategy whereby the genomic DNA of the Korean isolate of Pieris rapae granulovirus (PiraGV-K could be recovered in sufficient amounts for sequencing by purifying it directly from total host DNA by pulse-field gel electrophoresis (PFGE. METHODOLOGY/PRINCIPAL FINDINGS: The total genomic DNA of infected P. rapae was embedded in agarose plugs, treated with restriction nuclease and methylase, and then PFGE was used to separate PiraGV-K DNA from the DNA of P. rapae, followed by mapping of fosmid clones of the purified viral DNA. The double-stranded circular genome of PiraGV-K was found to encode 120 open reading frames (ORFs, which covered 92% of the sequence. BLAST and ORF arrangement showed the presence of 78 homologs to other genes in the database. The mean overall amino acid identity of PiraGV-K ORFs was highest with the Chinese isolate of PiraGV (~99%, followed up with Choristoneura occidentalis ORFs at 58%. PiraGV-K ORFs were grouped, according to function, into 10 genes involved in transcription, 11 involved in replication, 25 structural protein genes, and 15 auxiliary genes. Genes for Chitinase (ORF 10 and cathepsin (ORF 11, involved in the liquefaction of the host, were found in the genome. CONCLUSIONS/SIGNIFICANCE: The recovery of PiraGV-K DNA genome by pulse-field electrophoretic separation from host genomic DNA had several advantages, compared with its isolation from particles harvested as virions or inclusions from the P. rapae host. We have sequenced and analyzed the 108,658 bp PiraGV-K genome purified by the electrophoretic method. The method appears to be generally applicable to the analysis of genomes of large viruses.

  7. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas Evaluation of cuban hemp, nut sedge, johnson grass and herb of grace extracts in weed control

    OpenAIRE

    Liliana Osorio Salazar; Francisco Antonio Valverde; Carmen Rosa Bonilla Correa; Manuel Salvador Sánchez Orozco; Carmen Elena Mier Barona

    2009-01-01

    En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique), Cyperus rotundus L (coquito), Sorghum bicolor L (sorgo), y Ruta graveolens L (ruda) sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga) y Amaranthus dubius Mart (bledo) y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo co...

  8. Herança de coloração de bulbos em cebola (Allium cepa L.) com resistência a Colletotrichum gloeosporioides Inheritace of bulb color in onion (Alllum cepa L.) resitant to Colletotrichum gloeosporioides

    OpenAIRE

    A.I.I. Cardoso; P.T. Della Vecchia; L.P. Faria

    1995-01-01

    O objetivo deste trabalho foi determinar a herança de coloração de bulbos de cebola a partir do cruzamento de bulbos brancos com resistência a Colletotrichum gloeosporioides (Mal de 7 voltas) segregantes da população Roxa do Barreiro com bulbos amarelos de linhagens endogâmicas obtidas das variedades Super Precoce e Pira Ouro. Para tal obtiveram-se as gerações F1 e F2 entre (Super Precoce x Barreiro "Branca") e entre (Pira Ouro x Barreiro "Branca"). Nas gerações F1 obtiveram-se apenas bulbos ...

  9. CHRISTIAN PHILOSOPHERS OF THE WEST ABOUT THE “COLD WAR”, TOTALITARIANISM AND COMMUNISM: COMPARATIVE ANALYSIS OF REINHOLD NIEBUHR’S AND GIORGIO LA PIRA’S CONCEPTS

    Directory of Open Access Journals (Sweden)

    T. V. Zonova

    2012-01-01

    Full Text Available The author examines the legacy of two great Christian thinkers, the American Reinhold Niebuhr and the Italian Giorgio La Pira, both very influential during the Cold War. Niebuhr was a Protestant theologian and political adviser to the American establishment. The Mayor of Florence, La Pira, was a prominent Italian statesman and an eminent Catholic thinker. The author analyzes their views on international relations, in particularly on the western policy towards the Soviet Union, the use of nuclear weapons, the war in Vietnam and communism. The legacy of two thinkers is highly topical in front of the ethical dimension of choices needed in international politics today.

  10. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae, e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Oscar A. Shibatta

    2005-12-01

    Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.

  11. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae), e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae) and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    OpenAIRE

    Oscar A. Shibatta

    2005-01-01

    Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR), bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm) e pesados (peso total, peso das gônadas femininas e ...

  12. Unigene BLAST: CBRC-OLAT-20-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-20-0023 gnl|UG|Ola#S14467333 AU177041 Sugano-Kawakami 5' end enriched cDNA library (OL ... pir|A28172| spasmolysin precursor - African clawed frog , mRNA sequence /clone=OLa24.11c /clone_end=5' /gb= ...

  13. Unigene BLAST: CBRC-OLAT-20-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-20-0023 gnl|UG|Ola#S14467278 AU176944 Sugano-Kawakami 5' end enriched cDNA library (OL ... pir|A28172| spasmolysin precursor - African clawed frog , mRNA sequence /clone=OLa23.05c /clone_end=5' /gb= ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0018 ref|NP_458664.1| hypothetical protein STY4579 [Salmonella ... enterica subsp. ente ... CT18] ref|NP_807874.1| hypothetical protein t4276 [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ... 031 probable membrane protein STY4579 [imported] - Salmonella ... enterica subsp. enterica serovar Typhi (strain CT1 ...

  15. NCBI nr-aa BLAST: CBRC-LAFR-01-1831 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1831 ref|NP_457167.1| putative bacteriophage tail protein [Salmonella ... enterica subs ... 18] ref|NP_457891.1| hypothetical protein STY3700 [Salmonella ... enterica subsp. enterica serovar Typhi str. CT18] ... |NP_806373.1| putative bacteriophage tail protein [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ...

  16. NCBI nr-aa BLAST: CBRC-XTRO-01-3964 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3964 ref|NP_456962.1| hypothetical protein STY2661 [Salmonella ... enterica subsp. ente ... CT18] ref|NP_804301.1| hypothetical protein t0432 [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ... 809 probable membrane protein STY2661 [imported] - Salmonella ... enterica subsp. enterica serovar Typhi (strain CT1 ...

  17. NCBI nr-aa BLAST: CBRC-LAFR-01-1918 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1918 ref|NP_457167.1| putative bacteriophage tail protein [Salmonella ... enterica subs ... 18] ref|NP_457891.1| hypothetical protein STY3700 [Salmonella ... enterica subsp. enterica serovar Typhi str. CT18] ... |NP_806373.1| putative bacteriophage tail protein [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ...

  18. NCBI nr-aa BLAST: CBRC-LAFR-01-1218 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1218 ref|NP_457167.1| putative bacteriophage tail protein [Salmonella ... enterica subs ... 18] ref|NP_457891.1| hypothetical protein STY3700 [Salmonella ... enterica subsp. enterica serovar Typhi str. CT18] ... |NP_806373.1| putative bacteriophage tail protein [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-04-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0109 ref|NP_456055.1| putative amino acid permease [Salmonella ... enterica subsp. ente ... ref|NP_460437.1| putative amino acid transporter [Salmonella ... typhimurium LT2] ref|NP_805144.1| putative amino a ... cid permease [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ...

  20. NCBI nr-aa BLAST: CBRC-LAFR-01-0393 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0393 ref|NP_457167.1| putative bacteriophage tail protein [Salmonella ... enterica subs ... 18] ref|NP_457891.1| hypothetical protein STY3700 [Salmonella ... enterica subsp. enterica serovar Typhi str. CT18] ... |NP_806373.1| putative bacteriophage tail protein [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ...

  1. NCBI nr-aa BLAST: CBRC-FRUB-02-0852 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0852 ref|NP_455864.1| hypothetical protein STY1429 [Salmonella ... enterica subsp. ente ... CT18] ref|NP_805327.1| hypothetical protein t1543 [Salmonella ... enterica subsp. enterica serovar Typhi Ty2] pir||A ... onserved hypothetical protein STY1429 [imported] - Salmonella ... enterica subsp. enterica serovar Typhi (strain CT1 ...

  2. Unigene BLAST: CBRC-PMAR-01-0297 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0297 gnl|UG|Pma#S35054800 PMAH-aaa35b01.g1 Lamprey_EST_Olfactory Petro...myzon marinus cDNA 5' similar to sp|P09967|GLB1_PETMA Globin I >pir||A26042 globin I - sea lamprey, mRNA seq

  3. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  4. Micropropagação de cebola a partir de bulbinhos induzidos in vitro Micropropagation of onion from in vitro induced bulblet

    Directory of Open Access Journals (Sweden)

    Benedita Maria Rodrigues

    1996-01-01

    Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the

  5. Influencia del pie de injerto en la composición del aceite esencial de mandarina

    OpenAIRE

    Pedruzzi, Lilian; Santos, Ana Cristina dos; Atti Serafini, Luciana; Moyna, Patrick

    2004-01-01

    Se estudiaron los aceites esenciales de cáscaras de frutos y hojas de mandarinas injertadas, cultivadas en Rio Grande do Sul (Brasil), para establecer la influencia del pie, comparándolas con la misma variedad creciendo de semillas.

  6. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    Directory of Open Access Journals (Sweden)

    Filip Cvitić

    2014-07-01

    Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.

  7. NCBI nr-aa BLAST: CBRC-DNOV-01-2842 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2842 ref|YP_217085.1| O-antigen polymerase [Salmonella ... enterica subsp. enterica ser ... is str. SC-B67] pir||A47677 O-antigen polymerase - Salmonella ... choleraesuis gb|AAB49386.1| O-antigen polymerase [ ... lla enterica] gb|AAX66004.1| O-antigen polymerase [Salmonella ... enterica subsp. enterica serovar Choleraesuis str. ...

  8. UTILIZAÇÃO DE RECURSOS ERGOGÊNICOS NUTRICIONAIS E/OU FARMACOLÓGICOS EM UMA ACADEMIA DA CIDADE DE BARRA DO PIRAÍ, RJ

    OpenAIRE

    Luana Palmeira Pereira

    2014-01-01

    The habit of doing workouts combined with use of nutritional ergogenic or pharmacological has grown considerably in the last years. Whether for esthetic reasons or in order to improve some performance aspects, athletes consume a large amount of these products. In this sense, the purpose of this study is: survey the consumers profile of a nutritional ergogenic resources in Barra do Piraí gyms (RJ state), enumerate the products used by users of both sexes and verify the prescription source of t...

  9. Agricultural Land-Use in Eroding Uplands : A Case Study in the Philippines

    Directory of Open Access Journals (Sweden)

    Dondeyne, S.

    1995-01-01

    Full Text Available "Sa pira ka adlaw maubos ang lupa kang tubig kag wara't lupa nga mabilin kag ang mga tawo sa Valderrama maagto sa America kag ang mga taga America maagto sa Valderrama" Anthony R Tamb3| 8 yegrs (farmers chj|d (One day the water will eat all the soil and nothing will be left, and the people of Valderrama will come to America, and the. Americans will come to Valderrama.

  10. The business of piracy in Somalia

    OpenAIRE

    Percy, Sarah; Shortland, Anja

    2010-01-01

    This paper argues that contrary to conventional wisdom, Somali piracy is likely to increase if Somalia's domestic stability is improved, and that naval counter-piracy efforts had limited and unpredicted effects. To make this argument we analyze the underlying factors driving piracy off the coast of Somalia and examine the effectiveness of the international naval anti-piracy mission. We show that while the navies perform well with respect to their declared aims, they failed to resolve the pira...

  11. Unigene BLAST: CBRC-PMAR-01-0678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0678 gnl|UG|Pma#S35054800 PMAH-aaa35b01.g1 Lamprey_EST_Olfactory Petro...myzon marinus cDNA 5' similar to sp|P09967|GLB1_PETMA Globin I >pir||A26042 globin I - sea lamprey, mRNA sequence /clone_end=5' /gb=DW023815 /gi=83673407 /ug=Pma.780 /len=785 7.4 40% ...

  12. Does Reliable Pirated Product Lead to More Piracy?

    OpenAIRE

    Yuanzhu Lu; Sougata Poddar

    2012-01-01

    Conventional wisdom would suggest if a pirated product, which is cheaper than the original product, becomes more reliable then the relative demand of the pirated product or the rate of piracy will increase when consumers have different willingness to pay. However, is this always true? We address this question in a framework where the original product developer makes costly investment to deter pirate(s) in a given regime of IPR protection. We show that the relationship between the rate of pira...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  14. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  15. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  16. ServiciosWeb aplicados a la Visualizaci´on

    OpenAIRE

    Ganuza, María Luján; Martig, Sergio R.; Castro, Silvia Mabel

    2007-01-01

    Dada la creciente demanda en visualización de grandes volúmenes de datos está creciendo la tendencia a desarrollar ambientes distribuidos introduciendo el concepto de Servicio Web. Los Servicios Web encapsulan aplicaciones y las publican como servicios que liberan datos basados en XML a la red y los exponen para ser utilizados en Internet, pudiendo ser dinámicamente localizados, suscriptos y accedidos utilizando un amplio rango de plataformas, dispositivos, aplicaciones, etc. Se plantea en...

  17. Rigidez arterial aumentada en la infección por VIH:factores asociados

    OpenAIRE

    Sánchez Parra, Clara

    2015-01-01

    En los pacientes infectados por el virus de la inmunodeficiencia humana (VIH) la importancia de la enfermedad cardiovascular (ECV) arteriosclerótica ha venido creciendo de forma progresiva desde la introducción y ulterior generalización del tratamiento antirretroviral de gran actividad (TARGA), objetivándose un a umento de la morbilidad y la mortalidad cardiovasculares en estos pacientes. Numerosos estudios relacionan este hecho con la presencia de diversos factores como son una mayor prevale...

  18. Posibilidades de reducción de los residuos sólidos (no peligrosos) en el Municipio de Barbosa : un estudio de caso

    OpenAIRE

    Mejía Ríos, Luis Santiago

    2007-01-01

    Este trabajo muestra los diferentes mecanismo utilizados en la actualidad para disminuir la cantidad de residuos sólidos en el municipio de Barbosa, explicando desde el problema de las externalidades que se generan en el sitio de disposición final y el medio ambiente, pasando por el desarrollo del manejo integral de estos desechos y formas en las cuales se puede contribuir al mejoramiento de esta situación que cada vez sigue creciendo.

  19. Comunicándonos con las cosas

    OpenAIRE

    Miguel Delgado; Sergio Ciruela; Nicolás Marín

    2009-01-01

    Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  20. Editorial

    OpenAIRE

    Ortiz Chacha, Christian Soledad

    2014-01-01

    Luego de cuatro años de trabajo continuo, la Revista Electrónica Medicina, Salud y Sociedad, sigue creciendo y renovándose. Tal como se anunció en el volúmen anterior, la Revista ahora cuenta con el apoyo irrestricto de la Universidad Veracruzana incursionando así, al acervo de publicaciones de esta entidad, pero la primera en modalidad electrónica.

  1. Incidencia, diagnóstico, comportamiento y alternativas de manejo de la marchitez del aguacate con énfasis en Phytophthora cinnamomi Rands

    OpenAIRE

    Ramírez Gil, Joaquín Guillermo

    2013-01-01

    Resumen: El cultivo de aguacate en Colombia viene creciendo en área sembrada, consecuencia directa de las excelentes perspectivas de exportación, una demanda interna insatisfecha y las buenas condiciones agroclimáticas para su desarrollo, especialmente variedades comerciales como Hass. A pesar de esto los productores se han visto inmersos en muchas dificultades, especialmente relacionadas con las enfermedades, donde sobresale por su frecuencia y perdidas que causa la marchitez, patología asoc...

  2. Análise sensorial, teores de nitrato e de nutrientes de alface cultivada em hidroponia sob águas salinas Sensory analysis, nitrate and nutrient concentration of lettuce grown in hydroponics under saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2012-03-01

    Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of

  3. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  4. Dual Effects of IL-1 Overactivity on the Immune System in a Mouse Model of Arthritis due to Deficiency of IL-1 Receptor Antagonist

    Institute of Scientific and Technical Information of China (English)

    Jian Yan; Yan Jiao; Hong Chen; Feng Jiao; Karen A.Hasty; John M.Stuart; Weikuan Gu

    2013-01-01

    Previous studies have revealed the significance of cytokine interleukin 1 (IL-1) in the onset and progression of meumatoid arthritis (RA).The precise molecular mechanisms related to IL-1 underlying RA is still elusive.We conducted a whole genome-wide transcriptomal comparison of wild-type (WT) and arthritis-prone IL-1 receptor antagonist (IL-Irn) deficient BALB/c mice to address this issue.To refine our search efforts,gene expression profiling was also performed on paired wild-type and arthritis-resis nt IL-1m deficient DBA/1 mice as internal controls when identifying causative arthritis candidate genes.Two hundred and fifteen trans dpts were found to be dysregulated greater than or equal to 2-fold in the diseased mice.The altered transcriptome in BALB/c mice revealed increased myeloid cell activities and impaired lymphocyte functionality,suggesting dual regulatory effects of IL-1 hyperactivil on immunological changes associated with arthritis development.Phase-specific gene expression changes were identified,such as early increase and late decrease of heat shock protein coding genes.Moreover,common gene expression changes were also observed,especially the upregulation of paired Ig-like receptor A (Pira) in both early and late phases of arthritis.Real-time PCR was performed to validate the expression of Pira and an intervention experiment with a major histocompatibility complex (MHC) class I inhibitor (brefeldin A) was carried out to investigate the role of suppressing Pira activity.We conclude that global pattern changes of common and distinct gene expressions may represent novel opportunities for better control of RA through early diagnosis and development of alternative therapeutic strategies.

  5. Ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil fosfônico e a dormência e produtividade de tubérculos de batata Giberellic acid, carbon-disulphide and 2-4 chloro-ethyl phosphonic and the dormancy and yield of potato tubers

    Directory of Open Access Journals (Sweden)

    Ricardo Antonio Ayub

    1999-01-01

    Full Text Available Com o objetivo de avaliar a eficiência do ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil-fosfônico (EthrellR na quebra de dormência e na produção de batata, cv. "Marijke", foi conduzido um ensaio no período de 1990/ 91 em Piraí do Sul, PR . A superioridade do tratamento com o ácido 2-4-cloroetil-fosfônico em relação ao ácido giberélico e ao bissulfureto de carbono, aliada a sua facilidade de aplicação, justifica a sua recomendação com vistas a quebra de dormência de tubérculos do genótipo de batata em estudo, para a região de Piraí do Sul, PR, onde a dose de 842 mg.L-1 de EthrellR ocasionou a produção máxima de 23395 kg/ha.In order to evaluate the efficiency of giberellic acid, carbon-disulphide, and 2-4 chloro-ethyl phosphonic acid (EthrellR on dormancy breaking and yield of potato cv. 'Marijke', an essay was conducted at Piraí do Sul, PR, Brazil, during 1990/1991. The superiority of the EthrellR treatment over giberellic acid and carbon-disulphide, and its easy application, justify its use for dormancy breaking of potato tubers, for the studied genotype and location, at the rate of 842 mg.L-1, resulting in a potato yield of 23,395 kg/ha.

  6. Monogenoidea en Serrasalmus rhombeus (Linnaeus, 1766) de la Cuenca Amazónica Boliviana

    OpenAIRE

    Leslie Córdova; Antoine Pariselle

    2013-01-01

    El presente trabajo analiza la diversidad de parásitos monogenoideos como un carácter indepen- diente, esperando que por su alta especifi cidad, éstos parásitos puedan caracterizar las poblaciones de sus hospederos, la piraña blanca, Serrasalmus rhombeus . El estudio se llevó acabo en cuatro sub-cuencas de la Cuenca Amazónica Boliviana (Iténez, Beni, Madre de Dios e Ichilo); se obtuvie- ron 1135 parásitos, los cuales fueron agrupados en seis géneros y once especies: Anacanthorus jegui, A. ama...

  7. Desempenho de cultivares de alface crespa em dois ambientes de cultivo em sistema hidropônico Performance of lettuce cultivars grown in two environments, in the NFT hydroponic system

    OpenAIRE

    SF Blat; SV Sanchez; JAC Araújo; D Bolonhezi

    2011-01-01

    Este trabalho foi desenvolvido em Ribeirão Preto-SP, de 06/02 a 07/04 de 2006. O objetivo foi avaliar o desempenho de cinco cultivares de alface (Pira Roxa, Belíssima, Locarno, Crespona Gigante e Verônica) em dois ambientes de cultivo (casa de vegetação climatizada e não climatizada) em sistema hidropônico NFT. O delineamento experimental foi em blocos casualizados para cada ambiente com três repetições sendo cinco cultivares. Os ambientes foram comparados por meio de análise conjunta. Avalia...

  8. Identidade, riqueza e abundãncia de pequenos mamíferos (Rodentia e Didelphimorphia) de área de Floresta com Araucária no estado do Paraná, Brasil

    OpenAIRE

    Guilherme Grazzini; Cássio Marcelo Mochi-Junio; Heloisa de Oliveira; Jaqueline dos Santos Pontes; Fernanda Gatto-Almeida; Liliani Marilia Tiepolo

    2015-01-01

    Roedores e Marsupiais são componentes importantes da fauna na região Neotropical. Estudos sobre a riqueza e abundância destes animais são raros na Floresta Ombrófila Mista (FOM) e aqui apresentamos um inventário conduzido na Floresta Nacional de Piraí do Sul. Esta área possui uma área aproximada de 150 ha, cercada por pastos e plantações de Pinus. A amostragem foi feita através de armadilhas de queda, Sherman e Tomahawk, dispostas nos principais tipos de vegetação encontrados. Pelo menos um c...

  9. Care in Practice. On Normativity, Concepts, and Boundaries.

    OpenAIRE

    Mol, Annemarie; Moser, Ingunn; Piras, Enrico Maria; Turrini, Mauro; Pols, Jeanette; Zanutto, Alberto

    2011-01-01

    In recent years many STS scholars have dealt with care practices in dif¬ferent fields. Starting from Care in Practice. On Tinkering in Clinics, Homes and Farms [Transcript-Verlag, Bielefield, 2010, 325 pp.], a book edited by Annemarie Mol, Ingunn Moser and Jeannette Pols, this debate aims to discuss the meaning and de-velopment of the concept of care and its accomplishment in practice. Mauro Turrini, Enrico Maria Piras and Alberto Zanutto wrote two commentaries on the book, while the editors ...

  10. Comparisons between the measured and calculated by KASKAD neutron-physics characteristics of the cores WWER-1000/320 at Kozloduy NPP during the fuel campaign

    International Nuclear Information System (INIS)

    The report shows comparisons of calculation results by code package KASKAD and experimental data for the last cycles of Kozloduy NPP Unit 5 and Unit 6. The results are related to:-critical boric acid concentration during the cycles;-assemblies relative power distribution (restored and calculated fields) in the core at different moments of operation. The comparisons of relative power distribution in the assemblies are performed: 1)between the SVRK restored Kq's fields and BIPR-7A calculated ones and 2) using PIR-A code of KASKAD and SVRK measured data. The comparisons of the assemblies' relative power distribution show a sufficient agreement for Unit 5, cycle 14, but for Unit 6, cycle 13 there are many discrepancies between the calculated and restored by SVRK relative power coefficients by assemblies. When compared to PIR-A restored Kq's all absolute errors enter in BIPR-7A passport limits. There is not agreement between BIPR-7A passport limits for some groups of TVSA assemblies when compared the calculated to SVRK restored Kq's. The measured boric acid concentration differs by more than 0.40g/kg from the corresponding calculated one to the end of cycles. This leads to a longer actual fuel cycle than the predicted one by more than 3% as it is in BIPR-7A passport. (authors)

  11. Produção e indicadores fisiológicos de alface sob hidroponia com água salina Production and physiologic indicators of lettuce grown in hydroponics with saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2010-03-01

    Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes

  12. Caracterización de los síntomas de angina en mujeres pos síndrome coronario agudo en el marco de la teoría de Lenz y col

    OpenAIRE

    Ochoa Larrota, Yamile

    2013-01-01

    muerte en la población femenina con un total 12, 962 casos reportados para el 2011, según informe del Departamento Administrativo Nacional de Estadística DANE, con tendiente feminización de la mortalidad; se prevé que estas cifras continuarán creciendo significativamente para el 2030, convirtiéndose así en el asesino silencioso de las mujeres representando el 65% del total de muertes en la población femenina1 . Este artículo expone la Caracterización de los síntomas de angina en mujeres que e...

  13. Monográfico Análisis del Discurso Digital · Presentación

    OpenAIRE

    Cristina Vela Delfa; Lucía Cantamutto

    2016-01-01

    El interés por el estudio de los discursos digitales ha ido creciendo, hasta convertirse en un área de trabajo en completa ebullición. Desde distintas disciplinas, como la sociología, la semiología, la filosofía de la ciencia, la psicología, las ciencias de la información y de la comunicación, y la lingüística, han proliferado las investigaciones destinadas a entender este fenómeno comunicativo y discursivo. Los trabajos sobre estos entornos de interacción se multiplican en el ámbito internac...

  14. La deuda pública y sus implicaciones. un modelo

    OpenAIRE

    Salas, Gustavo

    2010-01-01

    La crisis de la deuda pública es generalmente un reflejo de una crisis fiscal, como lo muestra el modelo que se propone este artículo en el que el endeudamiento externo ha sido suscrito por el gobierno. Al interrumpirse el financiamiento externo, los gobiernos no pudieron reducir los déficits con tanta rapidez y tuvieron que recurrir a fuentes internas. El modelo muestra que si la economía no está creciendo, la financiación con deuda constituye un factor adicional de perturbación a la estabil...

  15. INCENDIARIOS "Es preferible morir por el fuego, en combate, que morir en casa, por el hambre: Fidel Castro" Arson

    OpenAIRE

    Lisieux Elaine de BorbaTelles; Helena Dias de Castro Bins; Alcina Juliana Soares Barros; Franklin Escobar Córdoba

    2012-01-01

    Antecedentes. El concepto de fuego siempre ha atraído la atención del hombre. En la literatura abundan referencias a este término, que tanto puede representar poder y pasión como terror y destrucción. El incendio es un delito de fácil ejecución, pero de difícil investigación. La prevalencia de este delito es de 1,13%. La incidencia de este crimen está creciendo alrededor del mundo, provocando un impacto social importante por las pérdidas financieras, muertes, lesiones físicas y secuelas emoci...

  16. Es preferible morir por el fuego, en combate, que morir en casa, por el hambre: Fidel castro

    OpenAIRE

    Borba Telles, Lisieux Elaine de; Bins, Helena Dias de Castro; Barros, Alcina Juliana Soares; Escobar Córdoba, Franklin

    2012-01-01

    Antecedentes. El concepto de fuego siempre ha atraído la atención del hombre. En la literatura abundan referencias a este término, que tanto puede representar poder y pasión como terror y destrucción. El incendio es un delito de fácil ejecución, pero de difícil investigación. La prevalencia de este delito es de 1,13%. La incidencia de este crimen está creciendo alrededor del mundo, provocando un impacto social importante por las pérdidas financieras, muertes, lesiones físicas y secuelas emoci...

  17. Oficina de gestión de proyectos de ATP Ingeniería S.A.S.

    OpenAIRE

    Giraldo Mora, Ledy Magnolia.; Cometa Sánchez, Andruly Carolina.

    2012-01-01

    En la actualidad empresarial, se requiere que las organizaciones sean dinámicas y se adecuen a las exigencias del mercado. Atp ingeniería SAS, empresa con el 60% de sus operaciones proyectizadas y que ha venido creciendo vertiginosamente los últimos 5 años, necesita análisis de situación actual, por medio de un diagnóstico de sus procesos, calidad y practicas o políticas actuales frente al manejo de los proyectos. Partimos del supuesto de la necesidad de una oficina de proyectos para ATP INGE...

  18. Morfología y microclima urbano: la forma espacial, su influencia en el bienestar climático en plazas de clima cálido húmedo

    OpenAIRE

    Rodríguez Algeciras, José Abel

    2013-01-01

    En su evolución la ciudad ha ido creciendo en extensión, densidad y complejidad; y en paralelo la intención de revitalizar sus núcleos fundacionales resulta un hecho palpable. La insatisfacción climática que usuarios locales y extranjeros experimentan en los espacios públicos deviene una problemática de especial atención. Esta investigación analiza la relación entre morfología urbana y microclima en el comportamiento climático de plazas en ciudades históricas cubanas, con la...

  19. El/la educador/a social en la mejora de la empleabilidad del colectivo de desempleados/as de larga duración.

    OpenAIRE

    López de la Hoz, Marta

    2014-01-01

    En la sociedad actual, el incremento progresivo de desempleados de larga duración supone la reaparición de un colectivo en riesgo de exclusión social y es por lo que se plantea la necesidad de implementar acciones que contribuyan su inclusión laboral. A medida que aumenta el tiempo de inactividad va creciendo el distanciamiento entre las habilidades y destrezas que se poseen y las exigidas por el mercado laboral así como se va produciendo un deterioro psicosocial que dificulta ...

  20. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Jorge Thierer

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la en...

  1. Integración de computación heterogénea con hadoop para cloud computing

    OpenAIRE

    Rodríguez, Nelson R.; Murazzo, Maria A.; Villafañe, Daniela A.; Alves, Maximiliano; Medel, Diego

    2013-01-01

    La potencia de procesamiento de las supercomputadoras de ayer está ahora disponible en el desktop, aunque la necesidad de mayor poder computacional para resolver los problemas más grandes continúa creciendo. Los sistemas de cluster escalables hoy tienen la promesa de ejecución ilimitada a un costo muy conveniente. El paralelismo constituye una alternativa real para reducir el tiempo de ejecución de las aplicaciones. Arquitecturas paralelas homogéneas con elementos de proceso de característ...

  2. Realidad aumentada bajo tecnología móvil basada en el contexto aplicada a destinos turísticos

    OpenAIRE

    Leiva Olivencia, José Luis

    2014-01-01

    En este trabajo se define un marco para la personalización de contenidos turísticos mediante sistemas de recomendación contextuales en un sistema de realidad aumentada. La realidad aumentada ofrece la posibilidad de mostrar información de forma intuitiva, rápida, interactiva y atractiva. Estas características hacen que su aplicación en sectores como el turismo, patrimonio, cultura y publicidad esté creciendo considerablemente. Uno de los principales inconvenientes de los sistemas de rea...

  3. Interacciones entre "Pythium ultimum" y bacterias de la rizosfera en la patogénesis de la podredumbre del tallo del brócoli

    OpenAIRE

    Parra Sáez, María Angeles

    2015-01-01

    sintomatología que se asocia comúnmente a la enfermedad denominada podredumbre blanda bacteriana ocasionada por la bacteria Erwinia carotovora. Sin embargo, en este trabajo se ha aislado al hongo Pythium ultimum creciendo, al mismo tiempo, con varias especies de bacterias que habitan corrientemente en los suelos del interior del tallo floral de piezas de brócoli maduras afectadas de podredumbre blanda en cultivos del sureste de España durante el año 2012. P. ultimum causa “damping-off” en num...

  4. La adquisición del lenguaje infantil en la etapa de 0-3 años

    OpenAIRE

    Díez Martín, Tania

    2014-01-01

    El lenguaje es vital y de suma importancia en el desarrollo del niño, y por ello con este trabajo se pretende explicar la relevancia que tiene desde el primer ciclo de Educación Infantil. Este lenguaje es imprescindible para la socialización del niño y para entender el propio entorno que le rodea, y está influenciado por la familia, la sociedad y la escuela. Según va creciendo el niño, aumenta este lenguaje, no obstante, los mayores avances tienen lugar en la etapa de 0-3 años. No ...

  5. La importancia de la inteligencia emocional : propuestas de intervención educativa para educación infantil

    OpenAIRE

    Meis Leiro, Lucía

    2015-01-01

    [ESP] Hace ya más de quince años que apareció el concepto de Inteligencia Emocional y aunque su importancia ha ido creciendo, en general, los aspectos emocionales todavía se encuentran bastante descuidados en el ámbito escolar, tanto en el ciclo de Educación Infantil como en posteriores etapas educativas. Por esta razón, el propósito de este trabajo es profundizar en la importancia que posee la Inteligencia Emocional, ya que ésta es un componente esencial del ser humano que tiene importantes ...

  6. Comparación entre diferentes materiales inestables utilizados dentro del proceso de entrenamiento: Revisión Sistemática

    OpenAIRE

    Bustamante Aranguren, Paula

    2014-01-01

    RESUMEN: Introducción: la popularidad de los entrenamientos realizados en superficies inestables para mejorar el rendimiento deportivo ha ido creciendo en los últimos años. El objetivo de esta revisión fue conocer la efectividad de los ejercicios realizados en inestabilidad durante los entrenamientos deportivos. Métodos: se realizó una búsqueda bibliográfica sobre el tema en bases electrónicas de datos: Medline, PubMed, PEDro, Elsevier, Cochrane Library y Google Académico,mediante las pala...

  7. Quickbird image segmentation for mapping crops and their agro-environmental associated measures

    OpenAIRE

    López-Granados, Francisca; Castillejo-González, I.L.; Peña-Barragán, J.M.; Jurado-Expósito, M.; Sánchez De La Orden, Manuel; García-Torres, L.; García-Ferrer Porras, Alfonso

    2009-01-01

    En la últimas décadas han ido creciendo considerablemente los conocimientos y la sensibilización sobre la protección al medioambiente en muy diversas áreas, entre las que se encuentra la Agricultura. El uso intensivo del laboreo ocasiona graves daños medioambientales como la erosión del suelo, la contaminación de las aguas superficiales (escorrentía y colmatación de embalses), el descenso del contenido de la materia orgánica y de la biodiversidad de los suelos labra...

  8. El paciente geriátrico en urgencias The geriatric patient and emergency care

    OpenAIRE

    F.J. Martín-Sánchez; C. Fernández Alonso; Merino, C.

    2010-01-01

    La demanda en la atención urgente ha ido creciendo progresivamente en los últimos años y este incremento es más acusado en la población anciana. Teniendo en consideración que el paciente anciano requiere evaluaciones más complejas con una mayor realización de pruebas complementarias y consultas a otros especialistas, estancias más prolongadas en urgencias y mayor porcentaje de ingresos, el progresivo envejecimiento poblacional puede llegar a repercutir seriamente en la presión asistencial de ...

  9. Evaluación y diseño de algoritmos eficientes para la mejora de un transcodificador de vídeo HEVC/VP9

    OpenAIRE

    Torre Moya, Enrique de la

    2014-01-01

    En los últimos años, la demanda de contenidos multimedia y de dispositivos para visualizarlos ha crecido enormemente, un ejemplo de ello son los smartphone y tabletas, con los que desde cualquier lugar podemos visualizar contenido multimedia. El problema radica en que el tráfico que generan estas aplicaciones está creciendo y crecerá más rápido de lo que serán capaces de transportar las infraestructuras de transmisión, tanto cableadas como inalámbricas, es por ello que son nece...

  10. Evaluación por competencias en Educación Superior. Uso y diseño de rúbricas por los docentes universitarios

    OpenAIRE

    Velasco-Martínez, Leticia; Tójar-Hurtado, Juan Carlos

    2015-01-01

    El aprendizaje basado en competencias debe suponer una reconfiguración de la Educación Superior que dé respuesta a las actuales demandas formativas. El uso de la rúbrica en la Universidad se considera un instrumento de innovación docente que favorece la evaluación por competencias, tanto para estudiantes como para docentes. Desde su aparición en el ámbito universitario, su aplicación en los sistemas de evaluación ha ido creciendo paulatinamente. Sin embargo, aún no existe un cuerpo sólido de ...

  11. Estudio Mujeres y Discapacidad: necesidades y fortalezas

    OpenAIRE

    Arnanz Villalta, Enrique; Cámara Sánchez, Antonio; Cubilledo García, Beatriz; Kebir Tio, Mouna; Salsón Martín, Salsón

    2011-01-01

    El 58% de las mujeres con discapacidad en España son mujeres, creciendo la diferencia entre sexos - a favor del género femenino - a partir de los 45 años,. Las causas de su vulnerabilidad son múltiples: menor autoestima como consecuencia de estereotipos sociales, falta de información, escaso nivel de formación , etc. Esta investigación cualitativa identifica las principales necesidades y potencialidades que condicionan la experiencia de bienestar de las mujeres con discapacidad física que...

  12. El garbanzal: diseño e implantación de un modelo de información para la toma de decisiones

    OpenAIRE

    Cabanillas Albaladejo, Jose Luis

    2013-01-01

    Hasta el año 2007 en España todo era prosperidad económica, las empresas crecían y alcanzaban cifras record de beneficios, el PIB, creciendo al 3,5%, alcanzaba los 1.000.000 M € y las familias afrontaban una nueva era donde todos eran ricos. Sin embargo, como demuestra la experiencia, a todo ciclo económico de crecimiento le sucede un nuevo periodo de recesión, cumpliendo la definición propia de ciclo. En este nuevo escenario las empresas se ven ahogadas por los riesgos asumidos durante la...

  13. Crecimiento demográfico y cambio climático

    OpenAIRE

    Wilfredo Bulege Gutiérrez

    2013-01-01

    El mundo seguirá creciendo. Las más recientes proyecciones de las Naciones Unidas no prevén todavía un punto de inflexión en el crecimiento poblacional en el transcurso del presente siglo, pero se estima que, dadas las tendencias demográficas registradas, para mediados de siglo seremos alrededor de 9 mil 300 millones de habitantes en el planeta. La dinámica demográfica es la principal fuerza conductora del cambio ambiental global, pues constituye una presión para ocupar cada vez más espacios,...

  14. Análisis del entorno del e-learning empresarial en Bogotá

    OpenAIRE

    2012-01-01

    El sector de e-learning en Colombia ha venido creciendo significativamente en los últimos años, logrando ocupar un lugar destacado y reconocido dentro de las organizaciones empresariales que buscan capacitar a sus empleados, tanto internos como externos, de una manera eficiente y eficaz pero sin incurrir en altas inversiones en recursos físicos y humanos. Esta investigación se enfoca en un análisis del entorno de las empresas que ofrecen servicios de e-learning empresarial en diferentes secto...

  15. Psicofármacos y conducta suicida. Estudio de casos y controles

    OpenAIRE

    Manchón Asenjo, Mº Jesús

    2014-01-01

    El suicidio es una de las causas de muerte que ha venido creciendo en los últimos años. Según datos de la Organización Mundial de la Salud, en el mundo ocurren alrededor de un millón de suicidios al año. Esto representa una muerte cada minuto, casi 3,000 muertes cada día, y un intento de suicidio cada tres 5 segundos. Por encima de estas cifras, entre 10 y 20 millones de individuos manifiestan conductas suicidas de modo repetitivo, principalmente quienes ya han realizado intentos suicidas y q...

  16. Microfinanzas Américas: Las 100 mejores: 2011 Title: Microfinance Americas: The Top 100: 2011

    OpenAIRE

    Renso Martínez

    2011-01-01

    Microfinanzas 100 presenta una fotografía anual de las 100 instituciones microfinancieras más destacadas de América Latina y el Caribe. Al igual que los dos últimos años, los rankings han sido elaborados con base en el desempeño de las instituciones en tres áreas críticas: alcance, eficiencia y transparencia. El panorama general es positivo; la actividad microfinanciera continúa creciendo en la región. Cuando se miran las cifras más de cerca, surge una imagen más compleja. Si bien el crecimie...

  17. Eficiencia e innovación para el éxito de las empresas tradicionales: El caso del grupo Nicolás Correa

    Directory of Open Access Journals (Sweden)

    José Ignacio Galán Zazo

    2004-01-01

    Full Text Available Este artículo describe cómo las empresas establecidas en industrias tradicionales pueden tener éxito en presencia de discontinuidades. Este estudio sugiere que para sobrevivir y seguir creciendo continuamente es necesario que los directivos equilibren en sus empresas los modelos de exploración y de explotación. Los directivos deben conseguir eficiencia en el corto plazo pero simultáneamente deben ser flexibles y creativos de modo que puedan crear e incorporar innovaciones radicales a largo plazo.

  18. Open Access: el papel de las bibliotecas en los repositorios institucionales de acceso abierto.

    OpenAIRE

    Hernández Pérez, Tony; Rodríguez Mateos, David; Bueno de la Fuente, Gema

    2007-01-01

    En España, como en muchos otros países, el número de repositorios institucionales ha ido creciendo paulatinamente en los últimos tres años. En febrero de 2007 estos repositorios contienen ya más de 30000 documentos en acceso abierto, es decir, disponibles a texto completo de forma gratuita, y con posibilidad de descarga, impresión o copia sin coste añadido. La práctica totalidad de estos repositorios están siendo gestionados por los servicios de biblioteca de las distintas instituciones que l...

  19. El escenario actual de la alimentación en México = The actual scene of the feeding in Mexico

    OpenAIRE

    Soria Sánchez, Graciela; Palacio Muñoz, Víctor Herminio

    2014-01-01

    La soberanía alimentaria y la seguridad alimentaria en México son afectadas por múltiples factores, principalmente el mercado mundial. La población está creciendo y las tierras de cultivo están siendo utilizadas cada vez más para producir biocombustible, e n lugar de producir alimentos para consumo humano. Por otro lado, los acuerdos de libre comercio no han mejorado las condiciones de vida de los campesinos. Por el contrario, se ha generado mayor desigualdad económica y exclusión de la parti...

  20. Laboratorios virtuales y docencia de la automática en la formación tecnológica de base

    OpenAIRE

    Cerezo Coca, Francisco

    2015-01-01

    Recientemente, ha surgido un interés por aprender a programar, debido a las oportunidades profesionales que da este tipo de estudios universitarios. Es fácil de entender porque el número de trabajos para programadores e ingenieros informáticos está creciendo rápidamente. Por otro lado, un amplio grupo de psicólogos opinan que el pensamiento computacional es una destreza fundamental para cualquiera, no sólo para los ingenieros informáticos. Para leer, escribir y realizar operaciones aritmética...

  1. Manifestaciones de piritas framboidales en fumarolas de la Isla Decepción (Antártida): Implicancias genéticas Framboidal pyrite in fumaroles on Deception Island (Antarctica): Genetic implications

    OpenAIRE

    Mariano R. Agusto; Alberto T. Caselli; María dos Santos Afonso

    2004-01-01

    Se da a conocer el hallazgo y la posible génesis de piritas framboidales en las bocas de las fumarolas de la isla Decepción, Antártida. Los sulfuros se han depositado en las tefras, alrededor de los fragmentos tamaño lapilli. El proceso de formación de las piritas framboidales comienza con una reacción entre el vidrio de los piroclastos y el sulfuro de hidrógeno, nucleándose y creciendo inicialmente microcristales de monosulfuro de hierro. Luego, los microcristales reaccionan a greigita y se ...

  2. Los adolescentes en el mundo del alcohol

    OpenAIRE

    Nieto Valdivieso, Noelia

    2015-01-01

    El consumo de alcohol en la adolescencia es uno de los problemas más graves que existen hoy en nuestra sociedad, fenómeno que ha ido creciendo desde principios de los años ochenta. La edad de inicio del consumo de los jóvenes está disminuyendo, cada vez, son más los adolescentes, que empiezan a consumir a una edad más temprana, la edad media actual, son los 13 años. Este consumo precoz lleva consigo problemas en su desarrollo. A este problema se le añade la actitud normalizada, la institucion...

  3. CARACTERÍSTICAS FOLIARES Y TASAS VITALES DE ÁRBOLES SUCESIONALES TARDÍOS DE UN BOSQUE TROPICAL PERENNIFOLIO

    OpenAIRE

    CRISTINA MARTÍNEZ-GARZA; HENRY F. HOWE

    2010-01-01

    Para acelerar la sucesión vegetal y restaurar la vegetación en áreas degradadas (e.g., pastizales abandonados) se ha sugerido utilizar especies sucesionales tardías. Para determinar cómo la dinámica foliar está relacionada con altas tasas de crecimiento y supervivencia en sitios sucesionales tempranos, evaluamos la hipótesis de que la plasticidad en la demografía foliar está positivamente correlacionada con el establecimiento de árboles de siete especies sucesionales tardías creciendo en ambi...

  4. Power supply using wireless transmission

    OpenAIRE

    Mandrisi Puig, Ester

    2010-01-01

    En el presente proyecto se trata estudiar y construir una solución efectiva para el problema de la alimentación de los dispositivos sin cables cuyo uso ha ido creciendo en los últimos años. La principal motivación, pues, viene de la dependencia real que existe de toda clase de baterías y cargadores que requiere el uso de dichos dispositivos. Para conseguir un entorno realmente sin cables, resulta necesario un sistema que no solo sea inalámbrico en cuanto a transmisión de datos, sino también e...

  5. Diversidad de abejas sin aguijón (hymenoptera:meliponini) utilizadas en meliponicultura en colombia

    OpenAIRE

    Guiomar Nates Parra; Juan Manuel Rosso Londoño

    2013-01-01

    En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura), es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 d...

  6. Implicaciones medioambientales asociadas a un vertedero de residuos sólidos urbanos.El caso de Villamayor

    OpenAIRE

    Septién Rodríguez, Marta

    2011-01-01

    [ES] Estudio sobre las implicaciones medioambientales asociadas a un vertedero de residuos sólidos urbanos. Se estudia el caso de Villarmayor (Salamanca). La gestión de residuos es un problema importante a nivel Mundial. Las poblaciones de los países en desarrollo están creciendo rápidamente y, cada vez más, llegando a ser zonas urbanizadas. En los países desarrollados, el consumismo lleva a la sustitución rápida de las mercancías y grandes cantidades de envases desechados. Ambas tendencias l...

  7. Gestión del conocimiento: mayor producción y competitividad. Perspectivas para los sistemas de producción ovino-caprinos

    OpenAIRE

    Óscar Ospina; Henry Grajales; Carlos Manrique C.

    2011-01-01

    Los ovinos se presentan hoy día en Colombia como una de las especies promisorias para el sector pecuario, con un despertar en la actividad que se manifiesta con un incremento del inventario, que según Faostat (datos debatibles), ha pasado de 2’400.000 cabezas en el año 2000 a 3’400.000 para el 2008; por su lado, las cabras han pasado de 1’200.000 a 1’300.000 cabezas en el mismo periodo, creciendo, aunque con un ritmo menor que el de las ovejas. Según esta base de datos, la misma tendencia se ...

  8. A multi-scale analysis of transforming agricultural markets in the context of globalization: implications for natural resources, food prices and rural poverty in Latin America

    OpenAIRE

    Flachsbarth, Insa

    2015-01-01

    Vivimos una época en la que el mundo se transforma aceleradamente. La globalización está siguiendo un curso imparable, la población mundial así como la población urbana siguen creciendo, y en los países emergentes los ingresos promedios aumentan, resultando en un cambio también acelerado de las dietas y hábitos alimentarios. En conjunto esos factores están causando un aumento fundamental de la demanda de alimentos. Junto con la apertura de los mercados agrícolas, estos procesos han provocado ...

  9. La escolarización en Gambia

    OpenAIRE

    Anna Farjas Bonet

    2002-01-01

    Actualmente en Gambia el número total de alumnos matriculados en escuelas de modelo británico es mucho más alto que en escuelas coránicas formales o madrasas. De todas formas, la popularidad de los centros coránicos formales va creciendo, aunque lentamente, en todo el país. Las escuelas de modelo británico aún son vistas por la población rural como un elemento extranjero. De hecho, la educación occidental ha sido vista como un elemento extranjero desde su introducción. Las escuelas, sobre...

  10. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias...

  11. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén; Fernández Sánchez, Enrique

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias al desarrollo ...

  12. Propuestas para el desarrollo y comercialización del turismo ornitológico en Extremadura

    OpenAIRE

    Hernández Mogollón, José Manuel; Campón Cerro, Ana María; García Durán, José María

    2011-01-01

    El turismo ornitológico es una de las grandes apuestas en el desarrollo turístico de Extremadura dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO) en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia...

  13. Diseño, fabricación y control de calidad de lentes intraoculares multifocales

    OpenAIRE

    Remón Martín, Laura

    2012-01-01

    El mercado de lentes intraoculares (LIOs) está creciendo de manera espectacular en los últimos años debido al auge de cirugía de cataratas. La mayoría de las lentes implantadas en la actualidad son monofocales diseñadas simplemente para compensar la visión de lejos del paciente. Sin embargo, existen otros tipos de lentes denominadas multifocales (LIOMs) que proporcionan buena visión tanto de lejos como de cerca y suponen una alternativa prometedora en pacientes de más de 50 años para la compe...

  14. Purificación y separación de ácidos láctico y lactobiónico obtenidos en fermentaciones de co-cultivos a partir de permeados de lactosuero

    OpenAIRE

    Vicente Valdivielso, Héctor J.

    2015-01-01

    La actividad de la industria láctea viene creciendo progresivamente desde hace varios años. La búsqueda de nuevos productos y la producción en masa de los ya existentes hacen que aumente directamente la cantidad de residuos procedentes de su actividad. Un ejemplo es el suero lácteo, formado, entre otros, por ácido láctico y ácido lactobiónico. Debido a su alto poder contaminante y, por otro lado, su alto valor industrial, se viene estudiando su aplicabilidad a otros procesos, de manera q...

  15. Provisión de servicios de la Internet de las Cosas sobre redes de sensores basadas en 6LoWPAN

    OpenAIRE

    Vadillo Gutiérrez, Óscar

    2014-01-01

    RESUMEN: El interés por las redes de sensores inalámbricas ha ido creciendo durante los últimos años, permitiendo así la interconexión y el intercambio de información con dispositivos de bajo coste, dando lugar a lo que se conoce como la Internet de las Cosas. Aunque el paradigma de dicho concepto plantea que cualquier dispositivo estará conectado a Internet, las propias capacidades de los nodos y la escasez de direcciones Internet Protocol Version 4 (IPv4) ha hecho inviable hacer realidad co...

  16. Acerca de la formación psicoanalítica. Entrevista a Fanny Elman de Schutt.

    OpenAIRE

    Pilar de Miguel

    1981-01-01

    Nos parece interesante plantear el problema de la formación psicoanalítica en un momento en que "lo psicoanalítico" está creciendo en nuestro medio. En un momento en el que surgen demandas de algo diferente de "lo psiquiátrico" y crece el interés hacia una teoría, una práctica y, por consiguiente, hacia una formación que durante largo tiempo ha tenido escasa difusión en nuestro país.

  17. Acerca de la formación psicoanalítica. Entrevista a Fanny Elman de Schutt.

    Directory of Open Access Journals (Sweden)

    Pilar de Miguel

    1981-01-01

    Full Text Available Nos parece interesante plantear el problema de la formación psicoanalítica en un momento en que "lo psicoanalítico" está creciendo en nuestro medio. En un momento en el que surgen demandas de algo diferente de "lo psiquiátrico" y crece el interés hacia una teoría, una práctica y, por consiguiente, hacia una formación que durante largo tiempo ha tenido escasa difusión en nuestro país.

  18. Estudio de la satisfacción laboral de los yeseros

    OpenAIRE

    FERRERO BERLANGA, JAVIER

    2011-01-01

    ¿Por qué el estudio de la satisfacción laboral? porque es uno de los factores más importantes que influye directamente en el rendimiento de los trabajadores, de ella deriva que las organizaciones junto con los integrantes de la misma vayan creciendo. Por eso, uno de los problemas principales a los que se enfrentan es encontrar la manera de motivar al personal para que pongan más empeño en sus labores e intensificar el interés en el trabajo en la medida de lo posible.¿Qué puede aportar este es...

  19. Un segmento del turismo internacional en auge: el turismo de caza

    OpenAIRE

    Juan Ignacio Rengifo Gallego

    2008-01-01

    El número de turistas internacionales viene creciendo de forma continuada desde que existen fuentes estadísticas. Este crecimiento, que no sólo ha sido cuantitativo, sino espacial, ha ido acompañado de una segmentación del mercado en función de las motivaciones. Entre estos segmentos se halla el turismo cinegético, modalidad que ha experimentado un importante crecimiento en los últimos años por diversos motivos. Este incremento ha ido asociado a la movilidad de un porcentaje importante de caz...

  20. PROPUESTAS PARA EL DESARROLLO Y COMERCIALIZACIÓN DEL TURISMO ORNITOLÓGICO EN EXTREMADURA

    OpenAIRE

    José Manuel Hernández Mogollón; Ana María Campón Cerro; José María García Durán

    2011-01-01

    El turismo ornitológico es una de las grandes apuestas en el desarrollo turístico de Extremadura dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO) en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia de Extremad...

  1. Anatomía Artística: Bases Anatómicas del Retrato Escultórico Realista

    OpenAIRE

    Jiménez Mateos, Miguel Ángel

    1999-01-01

    El saber sobre la estructura del organismo humano ha ido creciendo siguiendo las bases de cualquier otra ciencia. La curiosidad de los propios humanos los condujo a observar los organismos y a intentar indagar en ellos más allá de los límites de la observación superficial, penetrando en su interior dividiendo sus partes. “Anatomía: cortar repetidas veces”. La Anatomía analiza las relaciones causales que tanto la estructura como la función guardan entre sí, así como las modificaciones de índol...

  2. El Proceso de Investigación, Camino a la Publicación

    OpenAIRE

    Elias Carvajal-Gómez

    2014-01-01

    La revista Conexión agropecuaria sigue creciendo y entregando información de interés para estudiantes, docentes, investigadores y productores del sector agropecuario, que logra transferir el conocimiento producido en las diversas universidades de Colombia y diferentes partes del mundo, para llevarlo y hacerlo útil a la sociedad, aplicándolo al sector productivo y para el uso frecuente de todos nuestros lectores; para ello propendemos por presentar en cada número una serie de artículos selecci...

  3. Modelización del estado estacionario de las condiciones de flujo de un reactor TRIGA mediante el código de dinámica de fluidos computacional ANSYS CFX

    OpenAIRE

    Martínez Lianes, Mónica; Miró Herrero, Rafael; Verdú Martín, Gumersindo Jesús; Pereira, C; CHIVA VICENT, SERGIO; Mesquita, Amir Zacarías

    2011-01-01

    El uso de los códigos de Dinámica de Fluidos Computacional (CFD) 3D para predecir el flujo estacionario y transitorio en los reactores nucleares está creciendo rápidamente y constituye una nueva tendencia en su estudio. En este trabajo se presenta un modelo de un reactor de entrenamiento TRIGA (Training Research Isotopes General Atomic) tipo IPR-R1 desarrollado con el código de CFD ANSYS-CFX. El reactor nuclear TRIGA IPR-R1 está ubicado en el Centro de Desarrollo de Tecnología ...

  4. Selection for bulb maturity in onion Seleção para maturidade de bulbos em cebola

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    2003-02-01

    Full Text Available It is possible to produce onions (Allium cepa all over the year in Brazil, but most of the Brazilian cultivars have poor quality bulbs, a fact that favours onion imports from Argentina, a producer of Valenciana type cultivars that does not bulb in Brazil, but please Brazilian consumers. To study the effect of selection for bulb maturity, seventeen half sib progenies selected for early maturity and twenty five for late maturity, from the intervarietal triple cross [Crioula x (Pira Ouro x Valenciana Sintetica 14] were grown, along with the triple cross itself and the cultivars Pira Ouro (short-day, Crioula (intermediate-day and Armada (long-day. A total of forty six treatments were tested in a randomized block design with three replications of 32 plants per plot. The progenies selected for earliness had cycles from 67 to 83 days, whereas those selected for lateness had cycles of 85 to 103 days. This difference was evident when comparisons were made for the percent thick neck bulbs, which varied from 0 to 6.2% and from 8.1 to 59.8% for the early and late progenies, respectively. High heritability estimates were obtained for all characters and they varied from 0.65 (thick neck percentage, in the late selection to 0.80 (average bulb weight, in the early selection. Progenies of higher bulb weight and maturity similar to the standard cultivars were obtained. Selection for maturity was highly efficient and the population selected for early maturity has potential to originate adapted cultivars, with bulb yield and quality superior to the available cultivars.Embora seja possível produzir cebola (Allium cepa o ano inteiro no Brasil, a maioria dos cultivares nacionais apresentam bulbos com baixa qualidade, o que proporcionou grande importação de cebola da Argentina, do tipo Valenciana, que não bulbifica no Brasil, mas que agradou os consumidores brasileiros. Para estudar o efeito da seleção para maturidade de bulbos baseada em progênies de meios irm

  5. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Mier Barona Carmen Elena

    2009-06-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  6. Monogenoidea en Serrasalmus rhombeus (Linnaeus, 1766 de la Cuenca Amazónica Boliviana

    Directory of Open Access Journals (Sweden)

    Leslie Córdova

    2013-04-01

    Full Text Available El presente trabajo analiza la diversidad de parásitos monogenoideos como un carácter indepen- diente, esperando que por su alta especifi cidad, éstos parásitos puedan caracterizar las poblaciones de sus hospederos, la piraña blanca, Serrasalmus rhombeus . El estudio se llevó acabo en cuatro sub-cuencas de la Cuenca Amazónica Boliviana (Iténez, Beni, Madre de Dios e Ichilo; se obtuvie- ron 1135 parásitos, los cuales fueron agrupados en seis géneros y once especies: Anacanthorus jegui, A. amazonicus , A. rondonensis, A. gravihamulatus, A. sciponophallus, Anacanthorus sp.1 , Anacanthorus sp.2 , Anacanthorus sp.3 ; Notothecium deleastum, N. deleastoideum, Notozothecium teinodendrum; Mymarothecium galeolum; Anphithecium diclonophallum y Enallothecium aegidatum. La elevada diversidad de parásitos encontrada puede deberse a que existe o existió un complejo de especies o poblaciones diferenciadas de Serrasalmus rhombeus.

  7. Remoção mecânica de plantas aquáticas: análise econômica e operacional Mechanical removal of aquatic weeds: operational and economic analysis

    OpenAIRE

    U.R. Antuniassi; E.D. Velini; Martins, D.

    2002-01-01

    A remoção de plantas aquáticas tem sido utilizada como opção ao controle químico e biológico, em razão de restrições ambientais em algumas regiões brasileiras. O objetivo deste trabalho foi desenvolver um modelo para análise econômica e operacional da remoção mecânica de plantas aquáticas, visando realizar estudo econômico comparativo com o controle químico. A operação foi estudada num reservatório de uma usina de bombeamento em Barra do Piraí-RJ. O sistema consiste de retroescavadeiras insta...

  8. Evidence of spotted fever group rickettsiae in state of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    ROZENTAL Tatiana

    2002-01-01

    Full Text Available Ticks were obtained from dogs from February to September of 1999 at weekly intervals, in the County of Piraí, State of Rio de Janeiro. Four hundred seventy four ixodids were taxonomically identified, 103 Amblyomma cajennense, seven Amblyomma ovale, 209 Rhipicephalus sanguineus, and 155 Amblyomma sp. An hemolymph test associated with Giemsa's stain revealed two specimens in 163 ticks tested (R. sanguineus and Amblyomma sp, containing rickettsia-like organisms. Direct immunofluorescence verified the presence of spotted fever group rickettsia in one specimen of R. sanguineus. Considering the limited information on rickettsiosis in Brazil, principally in relation to the vectors involved in perpetuating it in foci, these preliminary results give us an idea on the importance of infection in ticks, allowing to expand our knowledge on this zoonosis.

  9. Edge stability and pedestal profile sensitivity of snowflake diverted equilibria in the TCV Tokamak

    International Nuclear Information System (INIS)

    A second order null divertor (snowflake) has been successfully created and controlled in the TCV tokamak[1] (F. Piras et al., Plasma Phys. Control. Fusion, 2009). The results of ideal MHD edge stability computations show an enhancement of the edge stability properties of the snowflake equilibria compared to standard x-point configurations[2] (S. Yu. Medvedev et al., 36th EPS Conference on Plasma Physics, 2009). However, a sensitivity study of the stability limits to variations of the pedestal profiles is essential for making conclusions about possibilities of ELM control in snowflake plasmas. Variations of the edge stability and beta limits for several types of snowflake equilibria, different values of triangularity and various pedestal profiles are investigated (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  10. Photorhabdus insect-related (Pir) toxin-like genes in a plasmid of Vibrio parahaemolyticus, the causative agent of acute hepatopancreatic necrosis disease (AHPND) of shrimp.

    Science.gov (United States)

    Han, Jee Eun; Tang, Kathy F J; Tran, Loc H; Lightner, Donald V

    2015-02-10

    The 69 kb plasmid pVPA3-1 was identified in Vibrio parahaemolyticus strain 13‑028/A3 that can cause acute hepatopancreatic necrosis disease (AHPND). This disease is responsible for mass mortalities in farmed penaeid shrimp and is referred to as early mortality syndrome (EMS). The plasmid has a GC content of 45.9% with a copy number of 37 per bacterial cell as determined by comparative quantitative PCR analyses. It consists of 92 open reading frames that encode mobilization proteins, replication enzymes, transposases, virulence-associated proteins, and proteins similar to Photorhabdus insect-related (Pir) toxins. In V. parahaemolyticus, these Pir toxin-like proteins are encoded by 2 genes (pirA- and pirB-like) located within a 3.5 kb fragment flanked with inverted repeats of a transposase-coding sequence (1 kb). The GC content of these 2 genes is only 38.2%, substantially lower than that of the rest of the plasmid, which suggests that these genes were recently acquired. Based on a proteomic analysis, the pirA-like (336 bp) and pirB-like (1317 bp) genes encode for 13 and 50 kDa proteins, respectively. In laboratory cultures of V. parahaemolyticus 13-028/A3, both proteins were secreted into the culture medium. We developed a duplex PCR diagnostic method, with a detection limit of 10(5) CFU ml(-1) and targeting pirA- and pirB-like genes in this strain of V. parahaemolyticus. This PCR protocol can reliably detect AHPND-causing strains of V. parahaemolyticus and does not cross react with non-pathogenic strains or with other species of Vibrio isolated from shrimp ponds. PMID:25667334

  11. Investigación epidemiológica sobre pacientes nonagenarios no traumáticos intervenidos de urgencia

    OpenAIRE

    Pelavski Atlas, Andrés

    2012-01-01

    La población de pacientes mayores de 89 años está creciendo y consecuentemente está aumentando su utilización de los servicios de urgencia. Sin embargo, excepto para patología traumática de cadera, hay muy poca bibliografía que se ocupe de los nonagenarios que requieren cirugía urgente, y por consiguiente, la mayoría de ellos son tratados sobre la base de estudios realizados en poblaciones más jóvenes y más sanas. Si bien es sabido que la cirugía de urgencia es un factor de riesgo independ...

  12. Análisis y evaluación ecosistémicos de la piscicultura marina con "Ecopath with Ecosim" (EwE)

    OpenAIRE

    Bayle-Sempere, Just T.; Arreguín Sánchez, Francisco; Sanchez-Jerez, Pablo; Fernandez-Jover, Damian; Arechavala-Lopez, Pablo; Izquierdo-Gomez, David

    2013-01-01

    El cultivo de peces en mar abierto. La piscicultura en mar abierto en la actividad económica que más ha crecido durante los últimos años entre las industrias marítimas y con perspectivas de seguir creciendo al mismo ritmo durante los próximos 10 años, hasta suplir las 23 millones de toneladas de pescado necesarias para mantener el nivel de consumo actual de pescado durante los próximos 20 años (FAO, 2012). España produjo en 2011 algo más de 42.000 toneladas de peces de crianza, con un valor t...

  13. REDES SOCIALES PARA LA ENSEÑANZA DE IDIOMAS: EL CASO DE LOS PROFESORES

    Directory of Open Access Journals (Sweden)

    César Augusto Borromeo García

    2016-01-01

    Full Text Available El artículo explora teóricamente el uso de redes sociales en la enseñanza y aprendizaje de idiomas. El objetivo es conocer su presencia en la disciplina. La literatura permitió observar las redes sociales existentes y motivos que evitan que sean integradas al plan de estudios. Inicio definiendo redes sociales y explorándolas en tres niveles: educación, enseñanza y aprendizaje de idiomas, y aquellas especializadas en la disciplina. Después se exploran factores de su limitada implementación: institucionales (planeación y decisiones colegiadas, personales (contar con acceso a dispositivos e Internet y pedagógicas (poseer habilidades y destrezas para usarlas. Las conclusiones mencionan que la implementación está creciendo, mejorando planeación y encontrando áreas de oportunidad.

  14. Algoritmo CHC aplicado a la optimización de coberturas de señales de radio frecuencia en comunicaciones inalámbricas en locaciones petroleras

    OpenAIRE

    Molina, Daniel; Villagra, Andrea; Villagra, Silvia; Valdéz, Jorge; Rasjido, Jose; Mercado, Viviana; Pandolfi, Daniel; Leguizamón, Guillermo

    2016-01-01

    La difusión de los servicios de comunicación inalámbricos (teléfono, internet, etc.) está creciendo continuamente en estos días. Desafortunadamente, el costo de los equipos para proporcionar el servicio con la calidad adecuada es alta. Por lo tanto, la selección de un conjunto de puntos geográficos que permiten la cobertura óptima de una señal de radiofrecuencia, reduciendo al mínimo el uso de los recursos es esencial. A esta tarea se la denomina diseño de red de radio (siglas RND del inglés ...

  15. Métodos de reducción de la carga computacional de clasificadores multiclase basados en máquinas de vectores soporte

    OpenAIRE

    Gonell Sánchez-Seco, Sara

    2010-01-01

    En los últimos años se ha experimentado un incremento exponencial de la información que se espera que continúe creciendo en el futuro. Por este motivo es necesaria la organización por medios automáticos de toda esta información para facilitar el acceso, la búsqueda y el análisis de la misma. El aprendizaje automático se encarga de diseñar y desarrollar algoritmos que permitan a los ordenadores ser más eficientes y realizar tareas sin apenas supervisión humana. Este tipo de aprendizaje tratará...

  16. La “defensa social”. Pugnas y competencias en torno a la mano de obra en el Oriente Boliviano, 1890-1910.

    Directory of Open Access Journals (Sweden)

    Ana María Lema Garrett

    2010-01-01

    la región amazónica boliviana, al norte del país, suscitó profundos cambios en otros departamentos y, entre otras cuestiones, en el mercado laboral. Los departamentos de Beni y de Santa Cruz se constituyeron entonces en reservorios de mano de obra y el flujo migratorio hacia las regiones gomeras del norte fue creciendo proporcionalmente a las necesidades de los empresarios gomeros. Sin embargo, las regiones de origen, y específicamente Santa Cruz, reaccionaron en contra de este “vaciamiento”, desarrollando estrategias para controlar las migraciones o, eventualmente, frenarlas. Este proceso fue acompañado por el despliegue de varias normas novedosas en el ámbito laboral, producto de un debate parlamentario en torno al tema de las migraciones.

  17. Calidad de vida de las personas mayores en el África Subsahariana : el caso de Angola

    OpenAIRE

    Sancho Requena, Patricia

    2013-01-01

    El proceso de envejecimiento de la población mundial es un hecho incuestionable. Según las estadísticas de la Organización Mundial de la Salud (OMS, 2012a) en prácticamente todos los países la proporción de personas mayores está creciendo más rápido que cualquier otro grupo de edad. La población mayor del mundo (personas de 60 años de edad y mayores) se estima en 650 millones, y se prevé llegar a 2000 millones en 2050 (OMS, 2011). Son muchos los países que se encuentran actualmente en esta de...

  18. El emprendimiento social: una comparativa entre España y países sudamericanos

    Directory of Open Access Journals (Sweden)

    Catalina Nicolás Martínez

    2014-07-01

    Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.

  19. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    OpenAIRE

    Carlos OLIVA MARAÑÓN

    2012-01-01

    En español: En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca “Universidad”. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institu...

  20. Turismo gastronómico : dinamización del territorio y desarrollo local de la provincia de Castellón.

    OpenAIRE

    Lozar Muñoz, Javier

    2014-01-01

    La gastronomía asociada al turismo puede ser valorada como uno de los productos inseparables que conforman el producto integral turístico, el que le aporta quizás mayor valor añadido, o valorada como parte del patrimonio cultural de una ciudad, región o país. En una u otra línea, su demanda está creciendo aceleradamente dando lugar a un nuevo segmento turístico.2 Algo más del 10% de los turistas que visitaron España en 2009, unos 5,5 millones, mencionaron la gastronomía...

  1. Microempresa: Informe de avances: Volumen 8: Nº 1: Junio, 2005 Title: Microenterprise Development Review: Volume 8: No. 1: June, 2005

    OpenAIRE

    Banco Interamericano de Desenvolvimento (BID); Inter-American Development Bank (IDB)

    2005-01-01

    En esta edición de Microempresa se incluyen dos artículos principales. El primero aborda la problemática de la calificación de riesgo de las instituciones de microfinanzas (IMF). Hace una década, la calificación especializada de IMFs era poco más que una idea. Pero el concepto fue creciendo, y en los cinco últimos años ha ganado cada vez más atención de parte de una amplia variedad de participantes en el mercado. ¿Por qué surgió la calificación especializada para microfinanzas? ¿Cómo se ha de...

  2. La imagen de los destinos turísticos. La técnica Repertory Grid y revisión de trabajos entre 1980-2012 (Tourism destination image.The use of Repertory Grid technique and review of papers from 1980 to 2012)

    OpenAIRE

    Melo Rego Souto, Christiane de; Ortega Martínez, Enrique

    2012-01-01

    La imagen de los destinos turísticos es un tópico importante en la investigación turística actual. La investigación empírica en éste área es predominantemente cuantitativa, aunque la investigación cualitativa está creciendo rápidamente en la investigación de la imagen de los destinos. El objetivo de este estudio es revisar 336 trabajos sobre la imagen de los destinos turísticos publicados entre 1980 y el primer trimestre de 2012. La técnica Repertory Grid está especialmente tratada en e...

  3. La reciente narrative Espaňola en el context postmoderno

    Directory of Open Access Journals (Sweden)

    Yvonna Vaňková

    2001-12-01

    Full Text Available Año tras año está creciendo la cantidad de biografia, escrita desde diversas fuentes, per­ spectivas y ramas del saber sobre lo que, en estas últimas décadas del siglo XX, se ha denominado posmodernidad/posmodernismo. Este fenómeno es tratado y debatido en numerosos articulos y volúmenes monográficos, en congresos, seminarios y reuniones científicas, abordado desde puntos de vista especializados o de forma interdisciplinar. Los teóricos más destacados y tan diferentes entre si como Habermas, Sontag, Lyotard, Vattimo, Foucault, Derrida o Jameson, desde posiciones distintas y utilizando diferentes planteamientos, intentan proporcionarnos las claves de comprensión y un sistema mas o menos adecuado para orientarnos mejor en el mundo contemporaneo.

  4. Hifenaciones instrumentales entre la cromatografía líquida, diferentes sistemas detectores y nuevos métodos de pretratamiento de muestra para la determinación de vitaminas en alimentos

    OpenAIRE

    Bravo Bravo, María de los Ángeles

    2013-01-01

    El Objetivo Principal de esta Tesis Doctoral es desarrollar nuevos métodos analíticos para la determinación de vitaminas, constituyentes esenciales en la dieta humana. La Cromatografía Líquida (LC) combinada en línea con Espectrometría de Masas (MS) es una de las metodologías analíticas más sensibles y selectivas, y la aplicación de esta técnica está creciendo rápidamente en análisis de alimentos. Dependiendo de las estructuras químicas y características analíticas de los grupos de vitamin...

  5. Las pruebas ponderadas: una estrategia de evaluación en las ciencias morfológicas

    OpenAIRE

    González, Norma Viviana; Restelli, Mario A.

    2004-01-01

    La Cátedra de Histología y Embriología Animal de la Facultad de Ciencias Naturales y Museo de la Universidad Nacional de La Plata, hasta el año 1989 evaluó en forma integral a sus alumnos mediante exámenes parciales orales. El número de alumnos que recibía nuestra Cátedra por esos años fue creciendo paulatinamente en tanto que el plantel docente se mantuvo estable. Así, la elevada matrícula junto al limitado equipo docente y la dispersión horaria y edilicia de nuestras actividades prácticas y...

  6. Aplicación Android para el reconocimiento automático de actividades físicas en tiempo real

    OpenAIRE

    Martín de Castro, David

    2012-01-01

    El nacimiento de la telefonía móvil hace varias décadas, generó un mercado que ha ido creciendo día a día, haciendo que se invierta cada vez más tiempo y dinero en la tecnología unida a este concepto. Actualmente, no se usan teléfonos móviles simples, sino que se han convertido en smartphones: verdaderas obras de ingeniería capaces de incluir sensores de movimiento o posición, conectividades Wi-Fi o bluetooth, cámaras de foto y vídeo, y todo un sinfín de posibilidades y herramientas. Este des...

  7. a la generación internet

    Directory of Open Access Journals (Sweden)

    T. Millán Paredes

    2006-01-01

    Full Text Available Las generaciones de jóvenes que están creciendo en la era de Internet son personas acostumbradas a interaccionar no sólo cuando buscan información, también en sus actividades de ocio. El ordenador «ha redefinido la función y la esencia del hombre» (Yehya, 2001:11, se ha convertido en un elemento de socialización que compite con la familia, la escuela y la propia televisión. La filosofía imperante es la interactividad y la virtualidad. Si la televisión impuso la cultura de la imagen, las nuevas pantallas interactivas desarrollan el aprendizaje a través del juego y la participación dentro de entornos simbólicos.

  8. Mors omnia aequat: historia del cementerio de Guadalupe de la ciudad de León

    OpenAIRE

    Strasser, Monika

    2013-01-01

    Este artículo describe la evolución histórica del Cementerio de Guadalupe desde sus orígenes en los años 1830, cuando en toda la nación surgieron los primeros cementerios fuera de las poblaciones. A través de las fechas en las tumbas y la revisión de fuentes documentales se llega a la conclusión que el cementerio fue creciendo desde el sur hacia el oeste, norte y este. En una última fase a finales del siglo XX se compró lo que se conoce como “anexo” del Cementerio de Guadalupe. Aparte de la e...

  9. Reflexiones acerca de las familias transfronterizas y las familias transnacionales entre México y Estados Unidos

    Directory of Open Access Journals (Sweden)

    Norma Ojeda

    2009-01-01

    diferentes pero que no se excluyen entre sí, ya que algunas familias pueden comprender ambos tipos. Las familias transfronterizas forman parte de un fenómeno regional propio del espacio de la frontera geográfica entre los dos países, y que data de la creación de la misma. Las familias transnacionales, en cambio, se integran a una situación social más amplia ligada con los flujos de migrantes entre dichos países y con el fenómeno de la globalización. Ambos tipos de familia forman parte de los actuales sistemas de familias de México y Estados Unidos, y se espera que sigan creciendo en número y en complejidad social en cada uno de estos dos países. México-Estados Unidos.

  10. Women and research in educational technology. Analysis of its presence in the author of scientific papers

    OpenAIRE

    Julio CABERO ALMENARA; Marín Díaz, Verónica; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previamen...

  11. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos

    OpenAIRE

    Julio CABERO ALMENARA; Marín Díaz, Verónica; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previame...

  12. CARACTERÍSTICAS FOLIARES Y TASAS VITALES DE ÁRBOLES SUCESIONALES TARDÍOS DE UN BOSQUE TROPICAL PERENNIFOLIO

    Directory of Open Access Journals (Sweden)

    CRISTINA MARTÍNEZ-GARZA

    2010-01-01

    Full Text Available Para acelerar la sucesión vegetal y restaurar la vegetación en áreas degradadas (e.g., pastizales abandonados se ha sugerido utilizar especies sucesionales tardías. Para determinar cómo la dinámica foliar está relacionada con altas tasas de crecimiento y supervivencia en sitios sucesionales tempranos, evaluamos la hipótesis de que la plasticidad en la demografía foliar está positivamente correlacionada con el establecimiento de árboles de siete especies sucesionales tardías creciendo en ambientes soleados (pastizal y borde y obscuros (bosque secundario en Los Tuxtlas, Veracruz, México. Se monitorearon cohortes de hojas de 517 individuos de siete especies arbóreas creciendo en los tres hábitats durante un año. Los individuos que crecieron en bosque secundario y borde tuvieron mayor supervivencia foliar y menor producción de hojas que aquellos que crecieron en pastizal. Los individuos con mayor crecimiento y supervivencia en pastizal tuvieron una plasticidad alta en su supervivencia foliar y plasticidad baja en su producción de hojas (estabilidad, mientras que los individuos en el borde y el bosque con tasas altas de supervivencia fueron aquello que tuvieron estabilidad alta en su producción foliar. Nuestros resultados indican que Nectandra ambigens, Licaria velutina y Pouteria rhynchocarpa pueden ser sembradas en pastizales ya que muestran tasas altas de crecimiento y supervivencia en esos hábitats, además alcanzan diferentes estaturas a la edad adulta por lo que proveerían de diversidad estructural al bosque resultante. Especies con supervivencia baja en pastizales como Calophyllum brasiliense, Pimenta dioica, Amphitecna tuxtlensis y Eugenia inirebensis podrían sembrarse en grandes cantidades o hasta que un dosel de pioneras se haya formado.

  13. Disponibilidade hídrica e germinação de sementes de cebola (Allium cepa L. Water availability and germination of onion seeds (Allium cepa L.

    Directory of Open Access Journals (Sweden)

    Z. Piana

    1994-12-01

    Full Text Available Objetivando verificar a influência do teor de água do substrato na germinação de sementes de cebola (Allium cepa L., conduziu-se um ensaio sob condições de ambiente de laboratório. Os efeitos de cinco níveis de água no substrato solo x areia (3:1, 20, 40, 60, 80 e 100% da capacidade de retenção foram avaliados através da porcentagem de emergência no 14° dia da semeadura e pesos da matéria verde e seca das plântulas normais. Para tanto, 200 sementes do cultivar Pira Ouro por tratamento, em quatro repetições de 50, foram semeadas a 1,5 cm de profundidade, mantendo-se constantes os níveis de água no substrato. Os resultados possibilitaram concluir que os níveis de umidade do solo indicados para germinação de sementes de cebola são de 40% e 60% da capacidade de retenção do substrato, por possibilitarem uma melhor emergência, peso da matéria verde e seca das plântulas.One essay was conducted under laboratory conditions, in order to verify the influence of substrate water content on the germination of onion (Allium cepa L. seeds. The effect of five water levels in the medium soil x sand (3:1 - 20, 40, 60, 80 and 100% retention capacity-were evaluated through the emergence percentage 14 days after seedling and the weight of fresh and dry matters of normal seedlings. For that purpose, 200 treated seeds of Pira Ouro cultivar were sown 1.5 cm deep in four replicátions of 50, with a constant water content in the medium. The best results showed that the soil moisture levels suggested for the germination of onion seeds were 40% to 60% of the substrate retention capacity, once they provide better emergence, weight of the fresh and dry matters of seedlings.

  14. PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato

    Directory of Open Access Journals (Sweden)

    Dash Aditya P

    2009-07-01

    Full Text Available Abstract Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR, an Amplification Refractory Mutation System (ARMS and Primer Introduced Restriction Analysis-PCR (PIRA-PCR were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method

  15. Desempenho de cultivares de alface crespa em dois ambientes de cultivo em sistema hidropônico Performance of lettuce cultivars grown in two environments, in the NFT hydroponic system

    Directory of Open Access Journals (Sweden)

    SF Blat

    2011-03-01

    Full Text Available Este trabalho foi desenvolvido em Ribeirão Preto-SP, de 06/02 a 07/04 de 2006. O objetivo foi avaliar o desempenho de cinco cultivares de alface (Pira Roxa, Belíssima, Locarno, Crespona Gigante e Verônica em dois ambientes de cultivo (casa de vegetação climatizada e não climatizada em sistema hidropônico NFT. O delineamento experimental foi em blocos casualizados para cada ambiente com três repetições sendo cinco cultivares. Os ambientes foram comparados por meio de análise conjunta. Avaliaram-se a massa fresca e seca da parte aérea, massas fresca e seca do caule, massa fresca e seca da raiz, número de folhas maiores que 10 cm e número total de folhas. Não houve efeito significativo da interação cultivares e ambientes, demonstrando que as cultivares tiveram comportamento similar em ambos os ambientes.This research was carried out in Ribeirão Preto, São Paulo State, Brazil, from February to April, 2006. The performance of five lettuce cultivars (Pira Roxa, Belíssima, Locarno, Crespona Gigante and Verônica was evaluated, growing the plants in two environments (conventional and acclimatized greenhouse in hydroponic system NFT. A randomized-block experimental design was used for each environment, with three replications and five cultivars. The environments were compared through joint analysis. Evaluations were done for fresh and dry mater of the aboveground part, stem, and roots; number of leaves larger than 10 cm and total number of leaves. The cultivars Crespona Gigante and Verônica were prominent with regard to green and dry mass of the aboveground part, leaves, and roots, as well as to the number of leaves larger than 10 cm. The interaction cultivar x environment was not significant, demonstrating that the cultivars had similar behavior in both environments.

  16. Esputos de papel. La historieta ‘underground’ española

    Directory of Open Access Journals (Sweden)

    Dopico, Pablo

    2011-09-01

    Full Text Available To know the origin and development of contemporary Spanish comic, we get into the suburbs of visual culture to discover the history of Spanish underground comics. A comic with which, thanks to the relative freedom of expression offered, the counterculture found a versatile vehicle that could express themselves without problems, becoming a new form of social protest and claim it offers an invaluable testimony to the Spanish reality, superior to that afforded other contemporary arts. The text examines the main features, aesthetic aspects and new language of Spanish comix, discovering the main authors (Ceesepe, Gallardo, Mariscal, Max and Nazario, series (Makoki, The Garriris, Gustavo, Anarcoma,... and magazines (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, and showing its connection with other arts, as painting, cinema and photography, not to mention its relationship to the world of drugs and rock music.

    Para conocer el origen y desarrollo de la historieta española contemporánea, debemos adentrarnos en los suburbios de la cultura visual. Así descubriremos la historia del cómic underground español. Un cómic donde, gracias a la relativa libertad de expresión que ofrecía, la contracultura encontró un vehículo versátil con el que podía expresarse sin trabas, convirtiéndose en una nueva forma de protesta y reivindicación social que ofreció un impagable testimonio de la realidad española, superior al que ofrecen otras artes coetáneas. El artículo analiza las principales características, aspectos estéticos y novedades lingüísticas del comix español, descubriendo sus principales autores (Ceesepe, Gallardo, Mariscal, Max y Nazario, series (Makoki, Los Garriris, Gustavo, Anarcoma,… y revistas (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, y mostrando su

  17. Capitalismo y organización de los espacios ganaderos en España. El caso de la Cooperativa Agropecuaria de Guissona

    Directory of Open Access Journals (Sweden)

    José Antonio Segrelles Serrano

    1999-01-01

    Full Text Available El proceso de intensificación productiva de la ganadería espaflola se relaciona directamente con la penetración del sistema capitalista en el sector agropecuario. Las necesidades y exigencias de este modo de producción tienen una dimensión espacial que se refleja en la forma en que se produce la apropiación, gestión y organización del territorio por parte de las empresas más poderosas del sector, cuyos centros de trabajo y producción se diseminan en el espacio para realizar complejos procesos productivos que generan plusvaiias y una posterior acumulación del capital en sus sedes metropolitanas. Cataluña ha sido la región espaflola pionera en la adopción de métodos intensivos y capitalistas en la ganadería. lo que permitió una acumulación de capital más antigua y eficaz. Desde el área metrooolitana de Barcelona v sectores próximos. muchas empresas. autóctonas y extranjeras. timan las decisiones inversoras que serán determinantes pira la creación, transformación y control de los espacios agropecuarios. tanto catalanes como del resto del Estado.

  18. Conceptual Morphologic Consideration for Long-term Hydrodynamics Simulation in the Pirai River in Santa Cruz-Bolivia

    Science.gov (United States)

    Villazon, M. F.

    2014-12-01

    Santa Cruz city is built along the Piraí River, part of the Amazonas basin, which has tremendous discharge variability from10 to almost 2000 m3/s. The width goes from 50 to 500 metres. Inflows were calculated and calibrated using a conceptual rainfall-runoff model in hourly time step for 14 years. A hydrodynamic model (Mike11) of the river is implemented and calibrated with two stations. It was found that the roughness coefficient decreases with increasing water level; therefore bed resistance equation in function of the velocity were calibrated for different historical events. The last part of the river has important morphological process during flood events, conceptual modification of the wet area and the hydraulic radio (in different cross sections) is proposed in order to estimate in a better way the water level changes. Even when the model (Mike11) is running with fixed bed, the water levels are well represented. The shape and the time of occurrence of the peak flow in outlet station were well represented with EF greater than 0,7.

  19. UTILIZAÇÃO DE RECURSOS ERGOGÊNICOS NUTRICIONAIS E/OU FARMACOLÓGICOS EM UMA ACADEMIA DA CIDADE DE BARRA DO PIRAÍ, RJ

    Directory of Open Access Journals (Sweden)

    Luana Palmeira Pereira

    2014-02-01

    Full Text Available The habit of doing workouts combined with use of nutritional ergogenic or pharmacological has grown considerably in the last years. Whether for esthetic reasons or in order to improve some performance aspects, athletes consume a large amount of these products. In this sense, the purpose of this study is: survey the consumers profile of a nutritional ergogenic resources in Barra do Piraí gyms (RJ state, enumerate the products used by users of both sexes and verify the prescription source of these products to researched participants, ascertain if the participants achieved the expected results with use of these products and if they caused any side effects. This is an observational study, which evaluated 101 athletes of both genders and social classes. It was found that the majority of participants 75% (n = 76 reported the use of nutritional ergogenic or pharmacological, with the highest prevalence among men. Two products were the most consumed: whey protein 56.57% (n = 34 and creatine 42.10% (n = 25. The majority 45% (n = 34 reported consuming ergogenic without an expert guidance. Therefore, that the study shows the importance of each time more the professional in the field of nutrition be inserted in the sports ground for possible explanations about the effects of this product type is found between sportsman.

  20. Reliability analysis of 2 types of auxiliary feedwater system for PWR

    International Nuclear Information System (INIS)

    This paper will explain the application of Fault Three Method for analyzing the system reliability of Auxiliary Feedwater System with 2 different configurations taken from PWR type nuclear power plant (NPP) in the USA. The first configuration of Braidwood NPP (design A) basically consists of 1 motor driven pump and 1 diesel driven pump. The second configuration of Haddam Neck NPP (Design B) consists of 2 turbine driven pumps. Based on the P and ID and success criteria the fault trees are constructed to estimate the system failure probabilities quantified from software code PIRAS 1.0. The result shows the second configuration (Design B) with 2 turbine driven pumps have the higher failure probability of 1,06 x 10 -2 compared with design A of 1,09 x 10-3. The modification of both systems are also tried to analyze its effect to the end result. Qualitatively, the common cause failures of 2 turbine driven pumps contribute to the highest risk of system failure probability. Combination with 1 turbine driven pump and 1 motor driven pump or 1 diesel driven pump will increase the system reliability about 80% and 50% without considering if this configuration is possible to realize in a real plant

  1. Draft genome sequence of pathogenic bacteria Vibrio parahaemolyticus strain Ba94C2, associated with acute hepatopancreatic necrosis disease isolate from South America.

    Science.gov (United States)

    Restrepo, Leda; Bayot, Bonny; Betancourt, Irma; Pinzón, Andres

    2016-09-01

    Vibrio parahaemolyticus is a pathogenic bacteria which has been associated to the early mortality syndrome (EMS) also known as hepatopancreatic necrosis disease (AHPND) causing high mortality in shrimp farms. Pathogenic strains contain two homologous genes related to insecticidal toxin genes, PirA and PirB, these toxin genes are located on a plasmid contained within the bacteria. Genomic sequences have allowed the finding of two strains with a divergent structure related to the geographic region from where they were found. The isolates from the geographic collection of Southeast Asia and Mexico show variable regions on the plasmid genome, indicating that even though they are not alike they still conserve the toxin genes. In this paper, we report for the first time, a pathogenic V. parahaemolyticus strain in shrimp from South America that showed symptoms of AHPND. The genomic analysis revealed that this strain of V. parahaemolyticus found in South America appears to be more related to the Southeast Asia as compared to the Mexican strains. This finding is of major importance for the shrimp industry, especially in regards to the urgent need for disease control strategies to avoid large EMS outbreaks and economic loss, and to determine its dispersion in South America. The whole-genome shotgun project of V. parahaemolyticus strain Ba94C2 have been deposited at DDBJ/EMBL/GenBank under the accession PRJNA335761. PMID:27570736

  2. Genetic diversity of tropical-adapted onion germplasm assessed by RAPD markers Diversidade genética em germoplasma tropical de cebola estimada via marcadores RAPD

    Directory of Open Access Journals (Sweden)

    Maria do Desterro M dos Santos

    2012-03-01

    Full Text Available Onion is a crop of significant socioeconomic importance to Brazil. Onion germplasm with adaptation to tropical and sub-tropical conditions has played an important role in the development of this crop in the country. In this context, we studied the genetic diversity in a germplasm collection potentially useful for the development of cultivars for tropical and subtropical regions. The genetic variability of 21 accessions/cultivars that have been used as germplasm and/or were developed by onion breeding programs in Brazil was evaluated via RAPD markers. The following accessions were included in the study :'Red Creole', 'Roxa IPA-3', 'Valenciana 14', 'Beta Cristal', 'Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Alfa Tropical', 'Pêra IPA-4', 'Primavera', 'Belém IPA-9', 'Crioula Alto Vale', 'Conquista', 'Pira-Ouro', 'Vale-Ouro IPA-11', 'Franciscana IPA-10', 'Serrana', 'CNPH 6400', 'Petroline', and 'Baia Periforme'. From the 520 primers used in the initial screening only 38 displayed stable polymorphisms. They produced 624 amplicons, of which 522 (83.7% were monomorphic and 102 (16.3% were polymorphic. An average similarity coefficient of 0.72 was calculated among accessions based upon this subgroup of polymorphic amplicons. This allowed the discrimination of this germplasm collection into six groups with only one of them comprising more than one accession. The main group was formed by 16 accessions ('Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Conquista', 'Pira-Ouro', 'Serrana', 'Vale-Ouro IPA-11', 'Baia Periforme', 'Primavera', 'Franciscana IPA-10', 'Belém IPA-9', 'Crioula Alto Vale', 'Petroline', 'Pêra IPA-4' and 'Alfa Tropical', for which the genetic origin (with few exceptions can be traced back to the variety 'Baia Periforme'. The populations 'Red Creole', 'Roxa IPA-3', 'Beta Cristal', 'CNPH 6400', and 'Valenciana 14' comprised a set of five isolated groups, showing genetic divergence among them and in

  3. International conference centre, Geneva, Switzerland

    CERN Multimedia

    PH Department

    2009-01-01

    On 16-17 March 2009 the Energy Pact Foundation will be holding the Energy Pact Conference in Geneva. The Conference is organised with the support of the Republic and Canton of Geneva and has the Financial Times as its media partner. It will address for the first time in a comprehensive and integrated manner the key issues of energy needs and environmental and developmental challenges. Some 800 stakeholders and experts on these issues are expected. These will include high-level government officials, opinion leaders and representatives from the United Nations, NGOs, industry, civil society and the academic world. Gerhard Schröder, former Chancellor of Germany, will chair the Conference. Speakers with different backgrounds and expertise will include Dr. Carlo Rubia, Nobel Prize Winner, Ali Al-Naimi, Minister of Petroleum and Mineral Resources of Saudi Arabia, Gholam Hossein Nozari, Oil Minister of Iran, Gary Ross, CEO of PIRA Energy, a world-renowned energy market specialist, Ashok Khosla, President of the In...

  4. Identidade, riqueza e abundãncia de pequenos mamíferos (Rodentia e Didelphimorphia de área de Floresta com Araucária no estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Grazzini

    2015-01-01

    Full Text Available Roedores e Marsupiais são componentes importantes da fauna na região Neotropical. Estudos sobre a riqueza e abundância destes animais são raros na Floresta Ombrófila Mista (FOM e aqui apresentamos um inventário conduzido na Floresta Nacional de Piraí do Sul. Esta área possui uma área aproximada de 150 ha, cercada por pastos e plantações de Pinus. A amostragem foi feita através de armadilhas de queda, Sherman e Tomahawk, dispostas nos principais tipos de vegetação encontrados. Pelo menos um casal de cada espécie foi coletado. Como resultado, durante 5.892 armadilhas.noite nós obtivemos um total de 1.049 capturas, representando 17 espécies: Akodon montensis, Bibimys labiosus, Brucepattersonius iheringi, Cryptonanus sp., Didelphis albiventris, D. aurita, Gracilinanus microtarsus, Monodelphis americana, M. scalops, Myocastor coypus, Nectomys squamipes, Oligoryzomys nigripes, Oxymycterus judex, O. nasutus, Sooretamys angouya e Thaptomys nigrita. Capturas por armadilhas de queda representaram 67% do total, e oito espécies foram registradas exclusivamente por este método. Akodon montensis, O. nigripes e T. nigrita foram as espécies mais abundantes.

  5. A Green Approach to the Production of 2-pyridone Derivatives Promoted by Infrared Irradiation

    Directory of Open Access Journals (Sweden)

    Fernando Hernández

    2014-01-01

    Full Text Available Se reporta el uso de la irradiación infrarroja como un método de activación alternativa para obtener diferentes derivados 4-aril-3-cia - no-5-etoxicarbonil-6-metil-2-piridonas 9a-k con buenos rendimientos. El proceso se lleva a cabo con un enfoque verde a partir de los 4 H -pira - nos correspondientes, empleando condiciones de reacción suaves y la irradiación infrarroja como el promotor de la reacción, para producir, en una primera etapa, los derivados 1,2,3,4-tetrahidropiridin-2-onas 8a-k , seguido por un paso de oxidación, para generar las moléculas objetivo. La estructura de los productos 9a-k se confirmó por las técnicas espec - troscópicas de FT-IR, RMN 1 H, RMN 13 C y difracción de rayos X. Se encontró que la eficiencia de la reacción depende del catalizador, del disolvente, así como de los sustituyentes del aldehído.

  6. Specific PCR Assay for Rapid and Direct Detection of Neisseria meningitidis in Cerebrospinal Fluid Specimens

    Directory of Open Access Journals (Sweden)

    M Qurbanalizadegan

    2010-12-01

    Full Text Available Background: Neisseria meninigitidis is one of the most frequently encountered microorganisms associated with central nervous system infections. The aim of this study was to evaluate a PCR-based assay for specific and rapid detection of N. meninigitidis in CSF specimens.  Methods: Since April 2002 to July 2006, 130 CSF specimens were collected from patients suspected of having bacterial meningitis. Bacterial isolation and identification was carried out according to the standard bacteriological methods.  The PCR was used to amplify a 101bp fragment of capsular transport gene A (ctrA of N. meningitidis. Results: PCR yielded an amplified product with the expected size of 101 base pair fragment. Sensitivity test proved 500 ng of N. meningitidis DNA as the final detection limit and specificity test revealed no cross-reaction for a wide range of res­pira­tory pathogenic organisms. Conclusion: The PCR assay was more sensitive than the bacterial culturing. It might be possible to apply this procedure for rapid diagnosis of meningococci in clinical samples.

  7. Systems Biology Strategy Reveals PKC-delta is Key for Sensitizing TRAIL-Resistant Human Fibrosarcoma

    Directory of Open Access Journals (Sweden)

    Kentaro eHayashi

    2015-01-01

    Full Text Available Cancer cells are highly variable and resistant to therapeutic intervention. Recently, the use of the tumor necrosis factor related apoptosis-inducing ligand (TRAIL induced treatment is gaining momentum, due to TRAIL’s ability to specifically target cancers with limited effect on normal cells. However, several malignant cancer types still remain non-sensitive to TRAIL. Previously, we developed a dynamic computational model, based on perturbation-response approach, and predicted protein kinase C (PKC as the most effective target, with over 95% capacity to kill human fibrosarcoma (HT1080 in TRAIL stimulation (Piras, V. et al. 2011, Scientific Reports. Here, to validate the model prediction, which has significant implications for cancer treatment, we conducted experiments on two TRAIL-resistant cancer cell lines (HT1080 and HT29. Using PKC inhibitor Bisindolylmaleimide I, we first demonstrate, as predicted by our previous model, cell viability is significantly impaired with over 95% death of both cancer types. Next, to identify crucial PKC isoform from 10 known members, we analyzed their mRNA expressions in HT1080 cells and shortlisted 4 isoforms for siRNA knock-down (KD experiments. From these KDs, PKC-delta produced the most cancer cell death in conjunction with TRAIL. Overall, systems biology approach, combining model prediction with experimental validation, holds promise for TRAIL-based cancer therapy.

  8. Registro Preliminar de Macrohongos (Ascomycetes y Basidiomycetes en el Bosque Húmedo Montano del Alto El Romeral (Municipio de Angelópolis, Departamento de Antioquia - Colombia Preliminar Report of Macrofungi (Ascomycetes and Basidiomycetes in the Romeral's Montain Humid Forest (Angelopolis, Antioquia - Colombia

    Directory of Open Access Journals (Sweden)

    José David Sierra Toro

    2011-12-01

    Full Text Available Los macrohongos desempeñan un papel importante en el ciclado de nutrientes, en especial en el del carbono, al participar activamente en los procesos de descomposición de la materia orgánica dentro de los bosques tropicales. El conocimiento de la diversidad de este grupo en Colombia está aún incompleto. Como contribución a este tema, se desarrolló durante cinco meses en cuatro hectáreas de un bosque húmedo montano del Departamento de Antioquia, el trabajo que reporta y describe un total de 40 especies de macrohongos (dos de ellas posiblemente nuevas para la ciencia pertenecientes a 34 géneros y 18 familias, creciendo sobre diferentes tipos de sustrato. La familia Marasmiaceae fue la más diversa con cinco especies, seguida por Boletaceae, Polyporacea y Russulaceae con cuatro especies cada una. Hypholoma, Lactarius y Marasmius fueron los géneros más importantes con tres especies cada uno. Las especies de mayor ocurrencia fueron Auricularia delicata (Fr. Henn., Xylaria polymorpha (Pers. Grev. y Ganoderma applanatum (Pers. Pat. La mayor cantidad de especies se registró creciendo sobre troncos caídos (19 especies y la menor sobre hojarasca (seis especies.Macrofungi play an important role in nutrient cycling. Especially, they are important drivers in the carbon cycling and in the organic matter decomposition process in tropical forests. In Colombia the knowledge on diversity of this group is still very poor. Through this work we intend to contribute to this knowledge. The macrofungi diversity was assessed on three different substrates on a 4 ha wet montane forest in the Antioquia province during five months. Forty species of macrofungi (two of them possible new species to science belonging to 34 genera and 18 families were recorded. Marasmiaceae was the most diverse family with five species followed by Boletaceae, Polyporacea and Russulaceae with four species each one. Hypholoma, Lactarius and Marasmius were the most important genera

  9. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas Evaluation of cuban hemp, nut sedge, johnson grass and herb of grace extracts in weed control

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.The objective of this work was to evaluate the effect of the extracts of the species Macrophylla furcraea Baker (cuban hemp, Cyperus rotundus L (nut sedge, Sorghum bicolor L (johnson grass and Ruta graveolens L (herb of grace on seed germination of two weeds and one crop. The extracts were obtained by the Soxhlet method, using water, ethanol and chloroform as solvents. Each extract was evaluated in three dilutions (0, 5 and 10 % v/v and was applied to Bidens pilosa L (spanish needle, Amaranthus dubius Mart (spleen amaranth and Coriandrum sativum L (coriander seeds. Three replications of 50 seeds each one were used and the control was watered only with destilled water. The results

  10. Carcinoma verrugoso

    Directory of Open Access Journals (Sweden)

    Esteban Quesada Jiménez

    2004-09-01

    Full Text Available Se presenta el caso de un paciente masculino de 76 años, vecino de Turrialba, agricultor, que consultó por una lesión de 3 años de evolución, localizada en la palma de la mano derecha a nivel palmar y compromiso de los dedos de la misma mano, caracterizada como una neoformación exofítica verrugosa de 5 por 11 cm. aproximadamente, con material caseoso entre sus crestas. La lesión ha estado creciendo de forma acelerada en los últimos 3 meses, causándole dolor y que le imposibilita ellaborar. Se le realizaron exámenes y se descartaron varias causas infecciosas, y concluyendo luego de varias biopsias con el diagnóstico de un carcinoma verrugoso. El paciente fue tratado mediante una amputación parcial de la mano. Este tumor es una variante del carcinoma epidermoide y presentamos su clasificación, patogénesis, histopatología, manifestaciones clínicas más frecuentes y diagnóstico diferencial.

  11. EL SISTEMA EUROPEO DE DERECHOS FUNDAMENTALES TRAS LA ENTRADA EN VIGOR DEL TRATADO DE LISBOA

    Directory of Open Access Journals (Sweden)

    Lorenzo Martín-Retortillo Baquer

    2011-07-01

    Full Text Available Resumen: En 1947 se pusieron las bases de lo que llegaría a ser la Unión Europea, a modo de organización comercial para sectores concretos, complejo que iría creciendo, ampliándose los fines y la organización, a la par que se fraguaba un complejo ordenamiento jurídico. Se hizo necesario alcanzar una declaración de derechos que incluyera los modernos derechos sociales. En el trabajo se estudia la compleja historia de la obtención de la declaración, la “Carta de Derechos Fundamentales de la Unión Europea”, que, al fin, entraría en vigor el 1.XII.2009, a la par que el último de los Tratados de la Unión, el Tratado de Lisboa.Abstract: The European Union was founded in 1947 as a concrete trade organization but it started to grown. The aims and the organization had increased and in the meantime a complex law system was set up. It was convenient to get a solid bill of rights including the modern social rights. The paper studies the complicate story of how to obtain the bill of rights –the “Carta of Fundamentals Rights of the European Union”- which formally came into effect the 1.XII.2099 at the same time that the last Treaty of the Union, the Treaty of Lison.

  12. Insuficiencia cardíaca y diabetes

    Directory of Open Access Journals (Sweden)

    Jorge Thierer

    2006-01-01

    Full Text Available La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la enzima convertidora ejercen una influencia favorable, en tanto que el uso de glitazonas todavía es controversial. La insuficiencia cardíaca puede a su vez generar diabetes, debido a la activación del sistema nervioso simpático y al efecto del tratamiento. La comprensión adecuada de estos hechos es fundamental para tomar decisiones correctas y mejorar la suerte de los pacientes.

  13. COMERCIALIZAÇÃO DE MATERIAIS RECICLÁVEIS EM AQUIDAUANA-MS

    Directory of Open Access Journals (Sweden)

    Maria do Socorro Ferreira da Silva

    2010-01-01

    Full Text Available La crisis social en el país significa que miles de personas están en la comercialización de materiales reciclables, un medio de supervivencia. El mercado de los materiales reciclables está creciendo rápidamente en Brasil. Este artículo pretende analizar la estructura del comercio de materiales reciclables en Aquidauana-MS. El ciclo de comercialización de esa ciudad se compone de colectores asociados con la Asociación de los separadores de reciclables, por cuenta propia, la recolección de materiales reciclables en el hogar y en el centro de la ciudad, los mineros recolectores, que recogen materiales sobre la descarga, por los comerciantes de chatarra locales y otras ciudades Mato Grosso do Sul El mercado de productos reciclables es dinámico y se está expandiendo rápidamente, principalmente debido a el número de colectores, el número de vendedores de chatarra y la producción de reciclables que aún no se comercializan.

  14. Redes sociales, políticas públicas y capital social

    Directory of Open Access Journals (Sweden)

    Lluís Ballester

    2014-04-01

    Full Text Available La comunidad, o en un espacio más amplio la propia sociedad, en cualquiera de sus dimensiones, no es un espacio cerrado sin conexiones e interconexiones; más bien puede concebirse como una red de relaciones. En este sentido, desde las Ciencias Sociales ha ido creciendo el interés por el estudio de las redes sociales; esto ha permitido comprender mejor como se construyen y mantienen las relaciones sociales entre la población. Junto al concepto de redes sociales aparece también el de capital social; un recurso creado por los propios individuos que representa un poder a la hora de ocupar espacios sociales, acceder a recursos, cubrir necesidades, resolver problemas sociales, etc. La existencia de redes sociales fuertes favorece los vínculos democráticos, el nexo entre los diversos agentes e instituciones del territorio, la coordinación de las acciones colectivas y, consecuentemente, la construcción de capital social.

  15. Vigilar y castigar: crisis y disciplinamiento en la Iglesia argentina en los años setenta

    Directory of Open Access Journals (Sweden)

    Obregón, Martín

    2006-06-01

    Full Text Available Since the middle of the 60’s, Catholicism experimented in Argentina a deep internal crisis: vast secular and ecclesiastic groups radicalized and their criticisms were growing in the following years. By the second middle of the 70’s the ecclesiastical hierarchy fixed on to reorganize the Church on Conservative grounds and to discipline the more radical groups inside the Catholic ground. I attempt to analyze the theological, liturgical, and pastoral characteristics of this process during the first years of the latter Military Dictatorship.

    Desde mediados de la década de 1960, el catolicismo argentino sufrió una aguda crisis interna, caracterizada por la radicalización de vastos sectores, tanto clericales como laicos, cuyos cuestionamientos fueron creciendo con el correr de los años. Desde los años setenta, la jerarquía eclesiástica estableció como objetivo central la reorganización de la Iglesia sobre bases conservadoras, lo que implicaba disciplinar a los sectores más radicalizados del campo católico. En este trabajo se analizan las características que adoptó dicho proceso en la teología, la liturgia y la pastoral durante los primeros años de la última dictadura militar.

  16. ONTOACTION: HERRAMIENTA GRÁFICA Y TEXTUAL PARA LA ESPECIFICACIÓN DE ONTOLOGÍAS ACTIVAS

    Directory of Open Access Journals (Sweden)

    Tovar, Elsa Liliana

    2014-01-01

    Full Text Available Actualmente las ontologías son consideradas uno de los pilares de la web semántica por todas las ventajas que ellas pueden ofrecer en la representación formal del conocimiento. Paralelamente a esto, a medida que el campo de las ontologías se va desarrollando, la cantidad de usuarios no expertos en lenguajes de etiquetado va creciendo. Surge entonces la necesidad de contar con herramientas automatizadas que permitan una sencilla interacción con el usuario a fin de facilitar la creación y diseño de ontologías de propósito específico. En este trabajo se presenta OntoACTION, una herramienta de software que permita al usuario definir ontologías activas mediante grafos o mediante lenguajes de etiquetado, traduciéndolas al conjunto de axiomas procesables por una máquina razonadora de ontologías ACTION. Para probar la herramienta se especificó de forma gráfica y textual el dominio de los fenómenos climatológicos dado por el Servicio de Meteorología de la Aviación Militar Bolivariana de Venezuela.

  17. El TLCAN una forma de integración económica dualista: comercio externo e inversión extranjera directa

    Directory of Open Access Journals (Sweden)

    Cuauhtémoc Calderón Villarreal

    2011-01-01

    a través del movimiento de capitales y el comercio exterior. El TLCAN por su naturaleza "dual" favoreció en su interior la especialización de los flujos de comercio y de Inversión Extranjera Directa (IED entre los tres países; fortaleció entre México y los Estados Unidos la IED vertical, complementaria del comercio exterior que busca bajos salarios Y favoreció los flujos de IED de alta tecnología entre los Estados Unidos y Canadá con altos salarios. Además, desde la vigencia del tratado, los tres países mantuvieron tasas de crecimiento diferenciadas, siendo México el que mantuvo la tasa de crecimiento más baja. La brecha económica y tecnológica entre México y sus socios, los Estados Unidos y Canadá, fue creciendo desde la firma del TLCAN. En este trabajo se estudian los límites del TLCAN, analizando la interacción de los flujos de comercio intra-regional y la inversión extranjera directa en la región, durante el periodo de 1994 al 2008. Periodo en el cual la recesión norteamericana del 2001- 2002 constituyó un punto de infleción que modificó el comportamiento del flujo de IED en la región.

  18. Clínica y salud (1998-2008. Análisis de Diez Años de Publicaciones

    Directory of Open Access Journals (Sweden)

    Francisco Pérez Fernández

    2010-01-01

    Full Text Available Clínica y salud no sólo se ha convertido con el paso de los años en una publicación de referencia en el entorno de la psicología española sino que, a la vista de los datos que hemos podido recabar, y cuyo análisis se ofrece en este trabajo, es también una revista científica saludable y con un prometedor futuro. Ya parecía encontrarse en esta línea ascendente hace una década, momento en el que se realizó el primer estudio bibliométrico de la publicación que recogía la andadura de los siete primeros años de su existencia. En consecuencia, parecía pertinente comprobar ahora si aquellos primeros éxitos fueron un espejismo o el principio de la consolidación. Es precisamente al estudio y verificación de este hecho que dedicamos el presente trabajo de análisis bibliométrico esperando, asimismo, que sea útil para extraer conclusiones que permitan a Clínica y salud, a su equipo editorial y a sus afines, continuar creciendo en el futuro.

  19. La deuda pública y sus implicaciones. Un modelo The implications of public debt. a model

    Directory of Open Access Journals (Sweden)

    Salas Gustavo

    1997-06-01

    Full Text Available La crisis de la deuda pública es generalmente un reflejo de una crisis fiscal, como lo muestra el modelo que se propone este artículo en el que el endeudamiento externo ha sido suscrito por el gobierno. Al interrumpirse el financiamiento externo, los gobiernos no pudieron reducir los déficits con tanta rapidez y tuvieron que recurrir a fuentes internas. El modelo muestra que si la economía no está creciendo, la financiación con deuda constituye un factor adicional de perturbación a la estabilidad macroeconómica.The crisis of the public debt generally is the reflect of a fiscal
    crisis. As in the model, where the external debt belongs to the
    government. when the external financing stops, the governments can not reduce its deficits at the same speed so they have to look out for internal financing. The model shows that if the economy is not growing, the financing with debt constítutes and additional factor of perturbation to the macroeconomic stability

  20. APLICACIONES DE LA CITOMETRÍA DE FLUJO EN MICROBIOLOGÍA, VETERINARIA Y AGRICULTURA

    Directory of Open Access Journals (Sweden)

    José Laguado

    2007-12-01

    Full Text Available La citometría de flujo es un método automatizado, multiparamétrico y cuantitativo que analiza las señales dispersadas y fluorescentes producidas por una célula al pasar por un haz de luz. El potencial de los nuevos métodos de análisis en el laboratorio en el campo de la microbiología viene creciendo de manera enorme en los últimos años donde la citometría de flujo se ha consolidando como una herramienta rápida, sencilla, suficientemente sensible, económica, de fácil automatización para las crecientes necesidades de desarrollo de Colombia. La citometría permite obtener información sobre la fisiología, morfología, genética y diversidad de microorganismos, animales y plantas. Las variadas aplicaciones de la citometría en la microbiología de alimentos, la microbiología ambiental, la medicina veterinaria y la agricultura busca ahora complementar o reemplazar técnicas ya existentes adaptándonos a la continua evolución de las necesidades de los mercados globales de la ciencia y la economía.

  1. Análisis químico del extracto peciolar para evaluar el estado nutricional en la vid

    Directory of Open Access Journals (Sweden)

    Paulina Pino

    2012-01-01

    Full Text Available El objetivo de este trabajo fue evaluar la relación existente entre la concentración de N, P y K del extracto peciolar, la lámina y la raíz, para determinar el estado nutricional de la vid. El ensayo se desarrolló entre diciembre de 2006 y febrero de 2007. Se validó la metodología de extracto peciolar para Vitis vinifera 'Red Globe', en plantas de un año de edad autoenraizadas, creciendo en macetas, a partir de tres ensayos de fertilización utilizando N, P2O5 y K2O. En el extracto peciolar, se evaluó nitrato, fosfato y potasio, y en láminas y raíces, nitrógeno, fósforo y potasio. El análisis del extracto peciolar fue más sensible que el de la lámina y la raíz para determinar el estatus de nitrato y nitrógeno. Mientras que el análisis de la lámina representa mejor la respuesta de la planta a la fertilización con fósforo y potasio. El extracto peciolar puede detectar antagonismos entre elementos en altas dosis de fertilización.

  2. Manifestaciones de piritas framboidales en fumarolas de la Isla Decepción (Antártida: Implicancias genéticas Framboidal pyrite in fumaroles on Deception Island (Antarctica: Genetic implications

    Directory of Open Access Journals (Sweden)

    Mariano R. Agusto

    2004-03-01

    Full Text Available Se da a conocer el hallazgo y la posible génesis de piritas framboidales en las bocas de las fumarolas de la isla Decepción, Antártida. Los sulfuros se han depositado en las tefras, alrededor de los fragmentos tamaño lapilli. El proceso de formación de las piritas framboidales comienza con una reacción entre el vidrio de los piroclastos y el sulfuro de hidrógeno, nucleándose y creciendo inicialmente microcristales de monosulfuro de hierro. Luego, los microcristales reaccionan a greigita y se forma un agregado de microcristales de greigita (crecimiento de framboides. Finalmente, la greigita es reemplazada por pirita. En el presente estudio se observó que las piritas se formaban a 100ºC en menos de una hora.Pyrite framboids have been recognized in fumaroles on Deception Island, Antarctica. The sulphide was deposited around reworked pyroclastic tephra (lapilli. The formation process starts as a reaction between glass and hydrogen sulphide, giving rise to nucleation and growth of iron monosulfide microcrystals. The microcrystals then convert to greigite, and form aggregates of uniformly sized microcrystals (development of framboids. Finally, greigite is replaced by pyrite. In this study pyrite was observed forming at 100ºCin less than one hour.

  3. Asociaciones de pacientes alérgicos y asmáticos en Europa Associations of allergic and asthmatic patients in Europe

    Directory of Open Access Journals (Sweden)

    A. Parra

    2003-01-01

    Full Text Available Las asociaciones de pacientes son ONG que surgen como consecuencia de las necesidades de los pacientes con enfermedades crónicas que no pueden ser solucionadas en la consulta del médico. En su inicio, el papel del personal sanitario en la tutela y colaboración con las mismas es fundamental, y sus objetivos e intereses son coincidentes en gran parte. Su buen funcionamiento favorece tanto a los pacientes como, indirectamente, a los profesionales sanitarios relacionados con ellos. No obstante, debemos tener en cuenta que estos intereses no son los mismos y, en ocasiones, pueden ser netamente divergentes, por lo que la independencia de estas asociaciones es algo irrenunciable, y se va gestando conforme la asociación va creciendo de tamaño y, por lo tanto, de influencia social.Patients’ associations are NGOs that emerge as a result of the needs of patients with chronic diseases that cannot be solved in the doctor’s surgery. At the start, the role of the health personnel, in guiding and collaborating with them, was fundamental, and their aims and interests coincided to a high degree. Their healthy operation favored both the patients and, indirectly, the health professionals related to them. However, we must bear in mind that those interests are not identical and, on occasion, can be clearly divergent. This is why the independence of these associations cannot be renounced upon, and they are managed according to the growth in their size and social influence.

  4. El escenario actual de la alimentación en México = The actual scene of the feeding in Mexico

    Directory of Open Access Journals (Sweden)

    Soria Sánchez, Graciela

    2014-01-01

    Full Text Available La soberanía alimentaria y la seguridad alimentaria en México son afectadas por múltiples factores, principalmente el mercado mundial. La población está creciendo y las tierras de cultivo están siendo utilizadas cada vez más para producir biocombustible, e n lugar de producir alimentos para consumo humano. Por otro lado, los acuerdos de libre comercio no han mejorado las condiciones de vida de los campesinos. Por el contrario, se ha generado mayor desigualdad económica y exclusión de la participación en el m ercado. Además, los programas de política pública diseñados para contrarrestar los problemas de abastecimiento de alimentos causados por el mercado, no han incluido estrategias de participación social. El presente trabajo analiza la situación actual de la alimentación en México y su precaria situación asociada principalmente al actual sistema económico neoliberal en donde la alimentación hoy en día representa únicamente un gran negocio.

  5. Estudios culturales y cine en España Cultural Studies and film in Spain

    Directory of Open Access Journals (Sweden)

    Manuel Palacio Arranz

    2007-10-01

    Full Text Available Este trabajo presenta el uso de las metodologías de los estudios culturales por los docentes e investigadores españoles. Estas metodologías de trabajo todavía resultan periféricas en los estudios de cine en España; sin embargo, está creciendo el número de publicaciones genéricamente adscritas a planteamientos culturalistas; en especial,y lo han hecho los estudios sobre el público del cine y los de género, y en menor medida los de recepción fílmica, la representación de los estereotipos y recientemente los estudios transnacionales. This paper presents the use of the different methodologies in cultural studies by Spanish researchers and academics. These working methodologies are still peripheral in film studies in Spain, although the number of publications generically adhering to cultural studies viewpoints are increasing, above all those studies concerning film audience or gender and, to a lesser extent, those dealing with film reception, stereotype representation and more recently transnational studies.

  6. ¿Cómo planear financiera y tributariamente una pyme?

    Directory of Open Access Journals (Sweden)

    Dilia Castillo

    2008-10-01

    Full Text Available Las Pyme son las unidades económicas más pequeñas, yen ellas germinan las grandes ideas empresariales. Nacen en el núcleo familiar y van creciendo a medida que el mercado demanda sus productos o servicios. En este nivel, su capital de trabajo es igual a los aportes del dueño o dueños junto con la escasa inversión en tecnología, investigación y desarrollo, y capital intelectual entre otras. En este trabajo se han recopilado algunas de las prácticas para la implementación de la cadena valor que permita el crecimientode las Pyme. La planeación financiera y tributaria se presenta dividida en tres etapas teniendo en cuenta: el tamaño, el valor del activo y el número de empleados. De igual manera, es subdividido en los siguientes subtemas de proyección: aporte social, constitución de la empresa, objetivo de creación, estructura de capital, los ingresos, los costos y gastos, los impuestos como gasto, los impuestos como beneficio fiscal, herramientas financieras para la permanente evaluación, la toma de decisiones y continuidad de la empresa, evitando así el cierre definitivo.

  7. Control de brazo electrónico usando señales electromiográficas

    Directory of Open Access Journals (Sweden)

    Jorge Andrés García-Pinzón

    2015-05-01

    Full Text Available Los trabajos enfocados en la extracción de patrones en señales electromiográficas (SEMG han venido creciendo debido a sus múltiples aplicaciones. En este artículo se presenta una aplicación en la cual se implementa un sistema electrónico para el registro de las SEMG de la extremidad superior en un sujeto, con el fin de controlar de forma remota un brazo electrónico. Se realizó una etapa de preprocesamiento de las señales registradas, para eliminar información poco relevante, y reconocimiento de zonas de interés; enseguida se extraen los patrones y se clasifican. Las técnicas utilizadas fueron: análisis wavelet (AW, análisis de componentes principales (ACP, transformada de fourier (TF, transformada del coseno discreta (TDC, energía, máquinas de soporte vectorial (MSV o SVM y redes neuronales (RNA. En este artículo se demuestra que la metodología planteada permite realizar un proceso de clasificación con un rendimiento superior al 95%. Se registraron más de 4000 señales.

  8. Panamá: paraíso imperfecto Panama: Imperfect Paradise

    Directory of Open Access Journals (Sweden)

    CLARA INÉS LUNA

    2009-01-01

    Full Text Available El 2008 estuvo marcado por la continuación de un proceso electoral interno en los partidos políticos, que se prolongó largamente y que se libró sin cuartel, presagiando el tono de los comicios generales de mayo de 2009. También ha sido un año especial por la inusual inflación que movilizó a importantes sectores para exigir mejoras salariales, más subsidios e, incluso, control de precios. No obstante, el país siguió creciendo a tasas muy por encima del promedio latinoamericano y registró una importante caída en la pobreza y la indigencia. Desde afuera Panamá puede parecer un paraíso, pero su evidente imperfección corre el riesgo de profundizarse.2008 was marked by the continuation of an internal election process within political parties, which lasted long and was fought without quarter, presaging the tone of the general elections of May 2009. It has also been a special year because an unusual inflation that mobilized union members, medical associations, carriers, educators and retirees, demanding better incomes, more benefits and even price controls, to the central government. However, the country continued to grow at rates well above the average for Latin America and recorded a significant decline in poverty and indigence. Panama from the outside may seem like a paradise, but its obvious imperfection risk further.

  9. ESTUDIOS EMBRIOLOGICOS Y CITOLOGICOS EN LA YERBA MATE ILEX PARAGUARIENSIS (AQUIFOLIACEAE

    Directory of Open Access Journals (Sweden)

    Cesar Otto Niklas

    2010-11-01

    Full Text Available

    La cuenta cmomosome de flex paraguariensis Saint Hil. confirmó el número 211 = 40 para todo el material estudiado. En el análisis de la meiosis se comprobó que tiene un comportamiento normal, presentando 20 II. En el polen analizado cerca de 100% de la fertilidad, se encontró. Se estableció que el saco embrionario es del tipo Polygonum. Cuando la fruta está madura, los embriones se encuentran en diferentes etapas: globulares 2,6%, 70,24% del corazón, el corazón puesto 23,3%; torpedo 2,62% y 0,96% maduros. Estos embriones seguir creciendo cuando la semilla está en condiciones para germinar, esta es la razón del lento desarrollo observado en la germinación.

  10. Bogotá: metrópoli de conflictos

    Directory of Open Access Journals (Sweden)

    Adriana Patricia López Velázquez

    2009-01-01

    Full Text Available En este ensayo se presentan dos aspectos de Bogotá. Por un lado, la metrópoli que está creciendo y que reporta cifras positivas en la tendencia del periodo analizado, en referencia a indicadores como el de las necesidades básicas insatisfechas (NBI, el índice de desarrollo humano (IDH, y la inversión extranjera directa. Es la Bogotá que disfruta de la exigencia y el acceso a los mercados más dinámicos y en general a la globalización. Por otro lado, la Bogotá de los que no tienen empleo, cuya capacidad de pago es bastante limitada, y viven en el sobresalto de la inseguridad. Este trabajo pretende mostrar –desde una perspectiva holística– que en el mismo espacio existen dos comunidades mutuamente complementarias y funcionales que, dentro del articulado teórico general del proyecto de investigación de Sanabria y López (2008, se conjugan para organizar los elementos comprensivos de la calidad de la vida.

  11. Las mujeres y el tabaco: características ligadas al género

    Directory of Open Access Journals (Sweden)

    Becoña Elisardo

    2000-01-01

    Full Text Available El porcentaje de mujeres fumadoras está todavía aumentando en España. Si persisten los patrones actuales de fumar entre las mujeres, el número de muertes continuará creciendo de modo acusado en el próximo siglo. Es posible que en un futuro cercano fumen más mujeres que hombres entre la población adulta española. En esta revisión se actualiza lo que se conoce sobre el impacto que tiene fumar cigarrillos en la salud de las mujeres, los patrones de consumo actuales entre las mismas, los factores especiales que influyen en que fumen y las dificultades que tienen cuando consideran e intentan dejar de fumar. También sugerimos formas en las cuales el consejo mínimo, la terapia de conducta y los productos sustitutivos de la nicotina se pueden incorporar como estrategias de tratamiento adaptadas a las necesidades especiales de las mujeres que fuman.

  12. La importancia de los activos intangibles en la sociedad del conocimiento

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-11-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  13. Avaliação perceptiva da imagem corporal: história, reconceituação e perspectivas para o Brasil Evaluación de la percepción de la imagen del cuerpo: historia, reconceptualization y perspectivas para el Brasil Perceptive evaluation of body image: history, reconceptualization and perspectives for Brazil

    Directory of Open Access Journals (Sweden)

    Maria da Consolação Gomes Cunha Fernandes Tavares

    2010-09-01

    Full Text Available As pesquisas em Imagem corporal têm crescido em número no Brasil, porém a avaliação da dimensão perceptiva da imagem corporal é um tema pouco explorado. O objetivo deste artigo é rever criticamente a história, as características, os fatores intervenientes da avaliação perceptiva e apresentar perspectivas para o Brasil.La investigación en imagen del cuerpo ha estado creciendo en gran número en el Brasil. Sin embargo, la evaluación de la dimensión de la percepción de la imagen corporal es área poco explorada. La finalidad de este artículo es repasar críticamente la historia, las características, los factores de intervención de evaluación de la percepción y presentar perspectivas para el Brasil.The research in Body image has been growing in number in Brazil. However, the evaluation of the perceptual dimension of Body Image is little explored area. The aim of this article is to critically review the history, the characteristics, the intervening factors of perceptual evaluation and to present perspectives for Brazil.

  14. Mixed methods en la investigación de la actividad física y el deporte

    Directory of Open Access Journals (Sweden)

    M. Teresa Anguera

    2014-01-01

    Full Text Available La lógica del procedimiento científico se ha desarrollado tradicionalmente desde planteamientos dicotómicos, y uno de los más influyentesfue la radical oposición entre paradigma cuantitativo vs. paradigma cualitativo. A finales del siglo XX irrumpe con fuerza la corriente de mixed methods,que ya no podemos considerar emergente, a pesar de que sigue creciendo con fuerza, porque está ya estabilizada. Su avance ha sido desigual en función de los ámbitos de conocimiento, y en el de actividad física y deporte ha sido relativamente tardía, pero últimamenteestá dando magníficos frutos. En este articulo se presenta la panorámica actual relativa a las etapas del proceso de investigación, relativa a diseños,como planificación empírica estratégica del problema de estudio, recogida de datos, que abarca un arco de diferentes posibilidades que hasta hace pocose hallaban en liza, y de análisis de datos, que nos conducte a planteamientos no esperables hace pocos años. Nos hallamos en un momento de especialpotencial de desarrollo metodológico en el marco de los mixed methods, y este articulo trata de impulsar las iniciativas en este sentido.

  15. Variabilidade genética e sensibilidade de acessos de Pistia stratiotes ao herbicida glyphosate Genetic variability and sensitivity of Pistia stratiotes accesses to glyphosate

    Directory of Open Access Journals (Sweden)

    E.A.S. Cícero

    2007-09-01

    Full Text Available A alface-d'água (Pistia stratiotes é uma das principais entre as macrófitas aquáticas que causam problemas em corpos hídricos no Brasil e são consideradas como plantas daninhas. O presente trabalho foi realizado com os objetivos de conhecer melhor a variabilidade genética dessa macrófita e relacionar essa variabilidade com a resposta à aplicação do herbicida glyphosate. Para isso, foram coletados indivíduos em 12 corpos hídricos em diferentes cidades do território nacional (Americana, Cambaratiba, Curitiba, Itapura, Jaboticabal, Lagoa Santa, Piraí, Rio Grande, Rubinéia, Salto Grande, Santa Gertrudes e Três Lagoas. Os acessos foram caracterizados pelo uso de marcadores RAPD (DNA Polimórfico Amplificado ao Acaso, que permitiram, com o auxílio de iniciadores aleatórios, a caracterização dos locos polimórficos identificados por uma matriz de ausência e presença de bandas. Utilizando essa matriz, a análise de agrupamento permitiu nítida classificação dos acessos em três grupos com diferenças genéticas entre eles. Um ensaio de controle químico, com plantas mantidas em vasos plásticos (5 L e pulverizadas com o herbicida glyphosate nas concentrações de 0,0, 0,6, 1,2, 1,8 e 2,4 kg ha-1, identificou, utilizando avaliações aos 7, 14 e 21 dias após aplicação, que as duas maiores doses promoveram melhor efeito herbicida. Foi verificado também que os acessos de Curitiba e Cambaratiba apresentaram menor suscetibilidade ao herbicida glyphosate. Não houve correspondência entre a estrutura de grupos dos acessos pela análise multivariada de agrupamento com a técnica RAPD e a suscetibilidade da alface-d'água ao glyphosate.Water lettuce (Pistia stratiotes is one the most important macrophytes, classified as weed and causing serious problems in watercourses in Brazil. The aim of this research was to evaluate the genetic variability of water lettuce and its relationship with this plant's susceptibility to glyphosate

  16. Desempenho de cultivares de cebola em cultivo orgânico e tipos de solo no Vale do São Francisco Evaluation of onion cultivars under organic cultivation in two soil types in the São Francisco Valley, Brazil

    Directory of Open Access Journals (Sweden)

    Nivaldo D Costa

    2008-12-01

    Full Text Available Com o objetivo de avaliar a produtividade de cultivares de cebola em cultivo orgânico no Vale do São Francisco, conduziram-se dois experimentos, de maio a outubro de 2005, nos Campos Experimentais de Bebedouro, Petrolina-PE, e Mandacaru, Juazeiro-BA, em ARGISSOLO e VERTISSOLO respectivamente. O delineamento experimental utilizado foi em blocos ao acaso, utilizando-se dezoito e quatorze cultivares de cebola, respectivamente e quatro repetições. Em ARGISSOLO a produtividade total de bulbos variou de 13,52 a 39,52 t/ha. A produtividade comercial oscilou de 7,45 a 38,32 t/ha, sobressaindo-se como mais produtivas as cultivares Brisa IPA-12 (38,32 t/ha e São Paulo (35,86 t/ha que não evidenciaram diferenças significativas entre si, assim como as cultivares Botucatu-150 (26,41 t/ha e Pira Ouro (26,37 t/ha, e menos produtivas as cultivares Conquista (7,45 t/ha e Crioula Alto Vale (7,81 t/ha. Em VERTISSOLO a produtividade total de bulbos variou de 6,87 a 24,68 t/ha. Sobressairam-se com produtividade comercial as cultivares Texas Grano PRR (21,56 t/ha e IPA-10 (17,50 t/ha, que não diferiram entre si. As cultivares Crioula Alto Vale, CNPH-6348, CNPH- 6436 e CNPH-6206 não tiveram produção comercial de bulbos.In this research were evaluated the yield of onion cultivars under organic growth in the São Francisco Valley. Two field trials were evaluated, one at the Experimental Farm Station of Embrapa Tropical Semi-Arid, in Petrolina, in an ultisol type and the other at the Experimental Farm Station of Mandacaru, in Juazeiro, in a vertisol type, from February to October of 2005. The experimental design was of randomized complete blocks, with 18 and 14 cultivars, respectively, and four replications. In the ultisol, the total yield of bulbs ranged from 13.52 to 39.52 t/ha. The commercial yield ranged from 7.45 to 38.32 t/ha where the cultivars Brisa (38.32 t/ha and São Paulo (35.86 t/ha showed the highest yield without statistical difference

  17. Produção de bulbinhos de cebola em bandejas de isopor Production of onion bulb sets in styrofoam trays

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    1999-10-01

    Full Text Available Com o objetivo de estudar a viabilidade de produção de bulbinhos de cebola sob ambiente protegido em diferentes tipos de bandejas de poliestireno expandido foram instalados dois experimentos. No primeiro, trabalhando com a cultivar Serrana, foram avaliadas três tipos de bandejas com diferentes números de plantas por célula: uma planta/célula na bandeja de 288 células, três a cinco plantas/célula na de 128 e cinco a nove plantas/célula na de 72 células. No outro experimento, testaram-se nove cultivares, semeadas somente em bandejas de 128 células com três plantas por célula. Utilizou-se o delineamento em blocos ao acaso com quatro repetições no primeiro ensaio e cinco no segundo, sendo cada parcela constituída por uma bandeja. Observou-se que quanto maior a densidade de plantio menor o tamanho do bulbinho (diâmetro e peso. O manejo adequado de adubações em cobertura pode viabilizar, tecnicamente, a produção de cinco bulbinhos com 1,3 cm de diâmetro (2 g por célula, na bandeja de 128 células. Quanto ao ensaio de cultivares, ‘Crioula’ da Agroflora, ‘Crioula’ da Granja Lotário e ‘Houston’ apresentaram 83%, 67% e 81% de plantas bulbificadas, enquanto que nas demais (‘Aurora’, ‘Baia Periforme’, ‘Brownsville’, ‘Petroline’, ‘Pira Ouro’, ‘Pirana’ e ‘Serrana’ obteve-se 100% de bulbificação. As principais vantagens na produção de bulbinhos em bandeja foram: uniformidade, ausência de plantas daninhas e de patógenos. É um sistema que pode ser útil aos viveiristas que tem entressafra de mudas nos meses de agosto a novembro, período de produção dos bulbinhos. Poderá, também, ser uma alternativa na produção de bulbinhos para conserva, no controle de qualidade de lotes de sementes e em programas de melhoramento de cebola.One objective was to study the production of onion Allium cepa L.. bulb sets in a protected environment in a seedling system with trays with different number of

  18. Controle pós-emergente de plantas daninhas em cenoura Post-emergence weed control in carrot crop

    Directory of Open Access Journals (Sweden)

    Jeferson Zagonel

    1999-03-01

    Full Text Available O experimento foi conduzido em Piraí do Sul-PR no ano de 1995 em solo de textura argilo arenosa, tendo como objetivo avaliar a eficiência e a seletividade do herbicida propaquizafop no controle pós-emergente de plantas daninhas na cultura da cenoura. O delineamento experimental utilizado foi de blocos ao acaso com seis tratamentos e quatro repetições, quais sejam: propaquizafop (100, 125 e 150 g i.a./ha; fluazifop-p-butil (188 g i.a./ha; testemunha capinada e testemunha sem capina. A cultivar de cenoura utilizada foi Nantes Tim Tom semeada em 15 de junho, com espaçamento de 0,25 x 0,05 m, em parcelas com área útil de 5,00 x 1,00 m. As plantas daninhas predominantes foram Brachiaria plantaginea (capim-papuã, Digitaria horizontalis (capim-milhã e Eleusine indica (capim pé-de-galinha. As avaliações foram efetuadas aos 15, 30 e 45 dias após a aplicação dos tratamentos. Observou-se que o herbicida propaquizafop, nas doses de 100, 125 e 150 g i.a./ha foi eficiente no controle sobre capim-papuã, capim-milhã e capim pé-de-galinha. O controle de plantas daninhas realizado através de herbicidas proporcionou a mesma produção obtida com o controle manual. A perda na produção ocasionada pela presença de plantas daninhas foi da ordem de 76,4%. Não foram observados efeitos fitotóxicos nas plantas de cenoura que pudessem ser atribuídos aos produtos utilizados.The presented field trial was conducted in 1995 in Piraí do Sul, Paraná State, Brazil, on a sand-clay texture soil, to evaluate the efficiency and selectivity of propaquizafop on carrot crop weed control. The experiment was laid out in a randomized block design with six treatments and four replications, and 5.00 x 1.00 m plots. The treatmens were: propaquizafop (100, 125 and 150 g a.i/ha; fluazifop-p-butil (188 g a.i/ha; control with weeding and control without weeding. The carrot cultivar Nantes Tim Tom was sown on June 15 with plants spaced 0.25 x 0.05 m. The prevalent weeds

  19. Ocorrência de Commelina villosa como planta daninha em áreas agrícolas no estado do Paraná-PR, Brasil Occurence of Commelina villosa as weed in Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Dalva C. Rocha

    2000-01-01

    Full Text Available As trapoerabas pertencem à família Commelinaceae e são plantas daninhas de difícil controle em diferentes regiões do país. No Brasil, a espécie Commelina benghalensis destaca-se como a principal trapoeraba infestante nas culturas de soja, milho, café e citros. Outras duas espécies desse gênero, Commelina diffusa e Commelina erecta, também são conhecidas como infestantes de ocorrência freqüente no território nacional. Commelina villosa está registrada, até o momento, apenas para os Estados da Bahia e Goiás além do Distrito Federal. O presente trabalho teve como objetivos caracterizar e registrar a ocorrência de C. villosa no Estado do Paraná, onde pode estar sendo confundida com outras trapoerabas, principalmente C. benghalensis. Exemplares de C. villosa e C. benghalensis foram coletados, de forma aleatória, em lavouras de soja, feijão e milho, nos municípios de Ponta Grossa, Tibagi, Piraí do Sul, Guarapuava, Pato Branco, Francisco Beltrão, Cascavel, Campo Mourão e Londrina. Parte desse material foi herborizado para a confecção de exsicatas e outra parte foi mantida in vivo, cultivada no Departamento de Botânica, do Instituto de Biociências de Botucatu-UNESP. Caracteres morfológicos descritivos e quantitativos foram avaliados e as espécies comparadas entre si. C. villosa distinguiu-se de C. benghalensis por apresentar folhas maiores (9,76 x 3,26 cm, elíptica a elípticaestreita, sésseis, de coloração verde escura com manchas violáceas na face inferior, filetes translúcidos, entre outras características. A ocorrência de C. villosa no Paraná foi constatada em todos os municípios amostrados, com exceção de Campo Mourão e Londrina.Commelinaceae are weeds with unsatisfactory control in different parts of the country. Commelina benghalensis is the main Commelinaceae weed in soybean, corn, coffee and orange crops in Brazil. Commelina diffusa and Commelina erecta are also known as common weeds in national

  20. Utilização de análise multivariada e redes neurais artificiais na determinação do comportamento de colonização de populações de macrófitas aquáticas no reservatório de Santana Using multivariate statistics and artificial neural networks to determe the colonization behavior of aquatic macrophyte populations in Santana reservoir

    Directory of Open Access Journals (Sweden)

    R.L.C.M. Pitelli

    2009-01-01

    Full Text Available As análises de agrupamento e de componentes principais e as redes neurais artificiais foram utilizadas na determinação de padrões de comportamento das populações de macrófitas aquáticas que colonizaram o reservatório de Santana, Piraí-RJ, durante o ano de 2004. As análises de agrupamento dividiram o comportamento das populações durante o ano em dois grupos distintos, apresentando um padrão no primeiro semestre que difere daquele observado no segundo semestre do ano. A análise de componentes principais demonstrou que esse comportamento da comunidade (grupo de populações é influenciado principalmente pelas espécies S. montevidensis, Heteranthera reniformis, Ludwigia sp., Rhynchospora aurea, C. iria, C. ferax e Aeschynomene denticulata no primeiro grupo e por Echinochloa polystachya, Polygonum lapathifolium, Alternanthera phyloxeroides, Pistia stratiotes, Eichhornia azurea, Brachiaria arrecta e Oxyscarium cubense no segundo grupo. As redes neurais artificiais agruparam as populações de macrófitas aquáticas em nove grupos, conforme sua densidade nos diferentes meses do ano. A aplicação da análise de componentes principais (ACP nos valores de frequência das populações presentes nos primeiros três grupos de Kohonen permitiu discriminar três grupos de meses, cujas populações apresentaram características diferentes de colonização. A aplicação das redes neurais artificiais permitiu melhor discriminação dos meses e das espécies que compõem as comunidades correspondentes, quando utilizada a análise de componentes principais.Cluster analysis, principal components analysis and Kohonen artificial neural networks were tested to determine the behavior patterns of aquatic macrophyte colonization on Santana reservoir, Piraí-RJ, 2004. The colonization behavior of the populations was divided into two groups, representing the two year semesters. The principal components analysis showed that the behavior of the first group

  1. Feeding ecology of a stream fish assemblage in an Atlantic Forest remnant (Serra do Japi, SP, Brazil

    Directory of Open Access Journals (Sweden)

    Ana Paula Pozzo Rios Rolla

    2009-03-01

    Full Text Available This study aimed to characterize the trophic structure of the fish assemblage in streams of the Serra Japi, an ecotonal area between the Atlantic Forest and inland forests of São Paulo State, Southeastern Brazil. Fish were collected with electrofishing equipment in 15 sites covering different regions, substrate types and riparian vegetation, distributed throughout the Caguaçú River, Caxambú, Piraí and Guapeva River micro-basins, during the rainy (January/February and dry season (June of 2007. The 589 specimens analyzed from 22 species, were assigned to different trophic groups, discriminated through a matrix of similarity, based on the food index (IAi. The results show the formation of seven groups with a predominance of insectivorous and omnivorous species, followed by detritivores, piscivores, omnivore-carnivores and herbivores, which consumed mostly items of autochthonous origin, where algae and young insects were dominant. Canonical correspondence analysis (CCA, correlating the biomass of trophic groups to environmental variables, showed that omnivores, insectivores and omnivore-carnivores displayed a wide distribution, while detritivores, herbivores and piscivores were restricted to specific locations, related to different physical and chemical variables as total nitrogen, conductivity and temperature. Despite the increase in total biomass at the most urbanized sites, the results indicate that the streams maintain a diverse community, suggesting that most of them are in preserved conditions.O presente trabalho teve por objetivo caracterizar a estrutura trófica da comunidade de peixes de riachos da Serra do Japi, uma área de transição entre a Mata Atlântica e o interior paulista, no sudeste brasileiro. Os peixes foram coletados com equipamento de pesca elétrica em 15 pontos localizados em regiões com diferentes tipos de substrato e vegetação ripária, distribuídos pelas microbacias do Ribeirão Caguaçú, Caxambú, Piraí e

  2. A influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros: o caso dos Direitos Humanos na cidade Volta Redonda * La influencia de la Acción Catolica...

    Directory of Open Access Journals (Sweden)

    LUIZ FERNANDO MANGEA DA SILVA

    2014-09-01

    Full Text Available Resumo: O presente artigo faz uma análise da influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros de Novaes na Diocese de Barra do Piraí/Volta Redonda, tendo como base o contexto sociopolítico nacional e local do início da década de 1950 até 1968. Essa atuação se inicia a partir do episódio referente à violação dos direitos humanos, em que operários da Companhia Siderúrgica Nacional e intelectuais volta-redondenses foram presos após uma comemoração pelos 20 anos da Declaração Universal dos Direitos do Homem. No evento, também foram comemorados os dois anos da chegada e posse do bispo à diocese. Houve, por parte da organização do evento, a iniciativa de incluir dramatizações que simbolizavam o universo dos trabalhadores. Não podemos esquecer que Volta Redonda era uma cidade militarizada, por causa da instalação do 1º Batalhão de Infantaria Blindada em Barra Mansa, cidade vizinha. O serviço de espionagem do regime militar identificou as lideranças operárias e intelectuais, o que resultou nas prisões dos organizadores do evento. Foi nesse episódio que o bispo se declarou preso no batalhão, em protesto contra a detenção dessas lideranças.Palavras-chave: Waldyr Calheiros de Novaes – Ação Católica – Ditadura Militar e Direitos Humanos. Resumen: Este artículo analiza la influencia de la Acción Católica en el trabajo social y pastoral D. Waldyr Calheiros de Novaes en la Diócesis de Barra do Piraí/Volta Redonda, en función del contexto socio-político nacional y local de la década de 1950 hasta 1968 . Dicha acción se inicia desde el episodio relativo a la violación de los derechos humanos, en el que los trabajadores nacionales Steel Company y los intelectuales era redondenses fueron arrestados después de una celebración para el 20 aniversario de la Declaración universal de los derechos humanos. En el evento, también se celebraron dos años de la llegada e

  3. Flutuação sazonal de Dermatobia hominis em peles bovinas oriundas de matadouro

    Directory of Open Access Journals (Sweden)

    Brito Luciana Gatto

    2000-01-01

    Full Text Available Realizou-se o estudo do efeito da temperatura, precipitação pluviométrica e da umidade relativa sobre a flutuação sazonal de larvas de Dermatobia hominis em 5.142 peles de bovinos. As peles foram obtidas junto a um matadouro localizado no município de Piraí, estado do Rio de Janeiro, Brasil, durante o período de novembro de 1995 a outubro de 1997. Os maiores picos de peles parasitadas por berne foram observados em novembro de 1995 e dezembro de 1996. Picos menores de infestação foram observados nos meses de março e maio de 1996 e março de 1997, quando também foram observadas altas porcentagens de peles infestadas. O aumento na porcentagem de peles parasitadas acompanhou o aumento da temperatura média mensal, sendo que temperaturas iguais ou maiores que 25ºC se mostraram benéficas ao aumento na porcentagem de peles parasitadas, assim como a precipitação pluviométrica, onde observou-se que períodos de chuvas mensais acima de 200 mm³ favoreceram ao aumento da porcentagem de peles parasitadas. As menores porcentagens de peles parasitadas por berne foram observadas durante o período de junho a outubro de 1996 e de 1997, quando verificou-se temperaturas médias mensais variando entre 21ºC e 22,5ºC, sendo que estas não se mostraram favoráveis ao aumento na porcentagem de peles parasitadas, assim como, precipitações pluviométricas mensais menores que 50 mm³. Das 5.142 peles examinadas, 2.710 (52,7% encontravam-se parasitadas pelo berne.

  4. West Coast U.S. : demand and prices

    International Nuclear Information System (INIS)

    The outlook for Canadian natural gas in Western U.S. markets through the winter of 1997 and 1998 was discussed. The effect of El Nino on West Coast gas pricing was noted, while also admitting that the best scientific minds are unable to determine what these effects actually are. Both the Cambridge Energy Research Associates (CERA) and PIRA predicted that Topock (the border pricing point) prices will track the NYMEX Henry Hub prices. The three points that were emphasized for the winter of 1997-1998 were: (1) Western U.S. pricing is higher than last year, (2) there is a surplus of gas in Canada relative to export capacity, and (3) differentials are anticipated to remain in excess of full transportation costs. The 1997 gas accord rates were also noted and its significance discussed. Increased electric load growth is likely to result in higher electricity prices which may drag gas prices along with them. Any new power generation facility is likely to be gas-fired, a fact which should also help to maintain natural gas prices. Transmission pricing is the major unknown variable. It is well known that from a capital cost perspective it is about four times more expensive to build a high -Kv transmission line than to build a gas pipeline to deliver the equivalent amount of energy. Therefore, to the degree that transmission pricing favours building new generation near load centres, gas should do well. If on the other hand, transmission pricing favours building generation plants near the fuel source, gas probably would not do nearly as well. The effects will not be known until the relevant decisions have been made. 6 figs

  5. ECOLOGICAL FACTORS ASSOCIATED WITH THE ESTABLISHMENT OF RUSTIC SPECIES IN DISTURBED ECOSYSTEMS IN THE ATLANTIC FOREST, PIRAÍ, RIO DE JANEIRO STATE – BRAZIL

    Directory of Open Access Journals (Sweden)

    Hiram Feijó Baylão Junior

    2013-08-01

    Full Text Available http://dx.doi.org/10.5902/1980509810542 Disturbed ecosystems do not present original floristic composition. Their soils are depleted, shallow, stony, with low infiltration and present erosion with different levels of Geodynamics. The region has areas of pasture with sparse herbaceous vegetation which is weakened in every rain and fire, covering less ground. The individuals that colonized and settled in these environments were considered rustic species. This study raised and identified by census, the rustic species and their structure in the most degraded part (lower third of the watershed of Cacaria’s river at the base of the Serra do Mar, Piraí, Rio de Janeiro state, and evaluated the influence of ecological exposure, slope, elevation, topography and rock outcrops in the establishment and growth of these species. For the vegetation survey it was conducted census in an area of 22 hectares, where it was measured, geo-referenced and identified all spontaneous tree species that were isolated in a pasture area. Ecological factors exposure, elevation and slope were determined with a compass, altimeter and clinometer, respectively. We identified 131 individuals, representing 14 species, grouped into nine families. Tabernaemontana laeta Mart., Sparattosperma leucanthum (Vell. Schum., Machaerium hirtum (Vell. Stellfeld, Tabebuia chrysotricha (Mart. ex DC. Stan., Cecropia pachystachya Trec., Peltophorum dubium (Spreng. Taub., Guarea guidonia (L. Sleumer, Acacia polyphylla DC. and Psidium guajava L.were present in portions of the slope with exposure to the north, with altitudes from 60m to 80m and with slope strongly corrugated (20-45%, indicating a preference of these species for microhabitats with those characteristics. 

  6. FATORES DO MEIO FÍSICO ASSOCIADOS AO ESTABELECIMENTO DE ESPÉCIES RÚSTICAS EM ECOSSISTEMAS PERTURBADOS NA MATA ATLÂNTICA, PIRAÍ, RJ - BRASIL

    Directory of Open Access Journals (Sweden)

    Hiram Feijó Baylão Junior

    2013-01-01

    Full Text Available Disturbed ecosystems do not present original floristic composition. Their soils are depleted, shallow, stony, with low infiltration and present erosion with different levels of geodynamics. The study region has areas of pasture with sparse herbaceous vegetation which is weakened in every rain and fire, covering less ground. The individuals that colonized and settled in these environments were considered rustic species. This study raised and identified by census, the rustic species and their structure in the most degraded part (lower third of the watershed of Cacaria’s river at the base of the Serra do Mar, Piraí, Rio de Janeiro state, and evaluated the influence of ecological exposure, slope, elevation, topography and rock outcrops in the establishment and growth of these species. For the vegetation survey it was conducted census in an area of 22 hectares, where it was measured, geo-referenced and identified all spontaneous tree species that were isolated in a pasture area. Ecological factors exposure, elevation and slope were determined with a compass, altimeter and clinometer, respectively. There were identified 131 individuals, representing 14 species, grouped into nine families. Tabernaemontana laeta Mart., Sparattosperma leucanthum (Vell. Schum., Machaerium hirtum (Vell. Stellfeld, Tabebuia chrysotricha (Mart. ex DC. Stan., Cecropia pachystachya Trec., Peltophorum dubium (Spreng. Taub., Guarea guidonia (L. Sleumer, Acacia polyphylla DC. and Psidium guajava L.were present in portions of the slope with exposure to the north, with altitudes from 60 to 80m and with slope strongly corrugated (20-45%, indicating a preference of these species for microhabitats with those characteristics.

  7. The BATENUS process for recycling mixed battery waste

    Science.gov (United States)

    Fröhlich, Siegmund; Sewing, Dirk

    The first large-scale battery recycling facility implementing the hydrometallurgical BATENUS technology is expected to go into operation by 1996. The plant will be situated in Schönebeck/Sachsen-Anhalt, and has a projected maximum capacity of 7500 tons of spent batteries per year. The engineering is being carried out by Keramchemie GmbH and the plant will be operated by Batterierecycling Schönebeck GmbH. The BATENUS process was developed by Pira GmbH, a research institute in Stühlingen, Germany, during a period of five years. This new process combines hydrometallurgical operations in a nearly closed reagent cycle that involves electrochemical and membrane techniques. Effluent emissions are minimized to the greatest possible extent. Process validity has been proven in a series of pilot plant testings. After mechanical separation of the casing materials like ferrous and nonferrous metals, paper and plastics, the subsequent hydrometallurgical recovery yields zinc, copper, nickel and cadmium. The other products are manganese carbonate and a mixture of manganese oxide with carbon black. Mercury is immobilized by absorption on a selective ion-exchange resin. The BATENUS process is a master process for the hydrometallurgical reclamation of metals from secondary raw materials. It has found its first application in the treatment of spent consumer batteries (i.e., mixtures of zinc-carbon, alkaline manganese, lithium, nickel-cadmium cells, etc.). As a result of its modular process design, the individual steps can be modified easily and adapted to accommodate variations in the contents of the secondary raw materials. Further applications of this highly flexible technology are planned for the future.

  8. A non-digging zoobenthivorous fish attracts two opportunistic predatory fish associates

    Directory of Open Access Journals (Sweden)

    Cristina Sazima

    2005-09-01

    Full Text Available Following behaviour among reef fishes involves mostly a digging nuclear species while foraging, which attracts opportunistic followers preying on the exposed organisms. The flying gurnard Dactylopterus volitans preys on benthic animals, mostly crustaceans and small fishes, scratching and probing the bottom with the inner rays of its pectoral fins. We recorded the flying gurnard being followed by two opportunistic predators, the yellow jack Caranx bartholomaei and the coney Cephalopholis fulva at Fernando de Noronha, off northeast Brazil. Albeit not actually digging the substrate, the flying gurnard acts as a nuclear species by exploring algae tufts and by its wandering near the boulders and ledges, disturbing and flushing out hidden animals which thus become available to predation.Entre os peixes recifais, uma espécie fossadora nuclear em atividade de forrageamento pode atrair seguidores oportunistas que se alimentam de organismos expostos pela atividade do nuclear. O coió-voador Dactylopterus volitans alimenta-se de animais bentônicos, principalmente crustáceos e pequenos peixes, explorando o substrato com os primeiros raios externos de suas nadadeiras peitorais. Registramos o coió sendo seguido por dois predadores oportunistas, a guarajuba Caranx bartholomaei e a piraúna Cephalopholis fulva, em Fernando de Noronha, ao largo da costa Nordeste do Brasil. Apesar de não agir como uma espécie fossadora do substrato, o coió atua como uma espécie nuclear por explorar os tufos de algas e também pela sua passagem próxima às rochas e lajes, espantando e desentocando animais escondidos que, assim, tornam-se vulneráveis aos predadores.

  9. Selected Abstracts of the 11th International Workshop on Neonatology; Cagliari (Italy; October 26-31, 2015

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2015-10-01

    . Piras, A. Ravarino, R. Ambu • Cagliari and Pisa (Italy ABS 18. Pulmonary atresia: the importance of prenatal diagnosis • A.L. Costa, H. Soares, A.L. Neves, C. Moura, J.C. Areias, A.C. Fragoso, J. Estevão-Costa, H. Guimarães • Porto (Portugal ABS 19. The use of hypothermia in preterm asphyxiated neonate: new results from a metabolomics point of view • E. d’Aloja, A. Noto, E. Locci, C. Dalmazzo, G. Pomero, A. Dessì, V. Fanos, P. Gancia • Cagliari and Cuneo (Italy ABS 20. Alopecia areata in a child: case report, management and therapy • F. Farnetani, V.D. Mandel, G. Pellacani • Modena (Italy ABS 21. Physiological and therapeutic roles of mesenchymal stem cells. Is there a gap? • U. Galderisi, F. Pentimalli, A. Giordano • Philadelphia (PA, USA, Naples and Siena (Italy, Kayseri (Turkey ABS 22. Esophageal impedance baseline is correlated with exposure to reflux in newborns with GERD symptoms • F. Cresi, E. Locatelli, E. Maggiora, A. Pirra, C. Peila, E. Bertino • Turin (Italy ABS 23. Analytical pitfalls and future perspectives in the measurement of bone metabolism biomarkers • A. Fortunato • Vicenza (Italy ABS 24. Genetic analysis of surfactant proteins genes in premature newborn infants with severe respiratory distress syndrome • M. Somaschini, S. Presi, M. Ferrari P. Carrera • Milan (Italy ABS 25. Child abuse and neglect: an increasing childhood’s condition • S. Cherubini • Busto Arsizio (Italy ABS 26. When a newborn dies: European approaches to responsibility • F. Tregnaghi, R. Carter, J. Ferguson, K. Nijs • Verona (Italy, Devon (UK, and Leuven (Belgium ABS 27. NMR-based screening possibilities in the neonate and comparison to mass spectral methods • M. Spraul, C. Cannet, H. Schäfer • Rheinstetten (Germany ABS 28. Our team project: learning from mistakes • M. Susi, E.M. Padovani, A. Bertolini, M. Lavarini, S. Tardivo • Verona (Italy ABS 29. Peripheral intravenous catheters in neonates • M. Zicchi, A. Farbo • Sassari

  10. Ocupación urbana de espacios litorales: gestión del riesgo e iniciativas de manejo en una comunidad patagónica automotivada (Playa Magagna, Chubut, Argentina

    Directory of Open Access Journals (Sweden)

    Alejandro Monti

    2008-01-01

    Full Text Available Playa Magagna es un pequeño asentamiento urbano para recreación estival y de fin de semana, instalado en una típica planicie de acumulación marina de la costa patagónica, sujeta a fuerte influencia de la erosión marina y remoción en masa. Este artículo describe el modo en que los habitantes han procurado mitigar el efecto de ambas funciones forzantes sobre sus casas y otros bienes del entorno doméstico, y muestra que las respuestas individuales han tenido que ser progresivamente complementadas por acciones colectivas y gestiones intersectoriales, a medida que el uso local y regional del espacio fue creciendo. Nuestro trabajo reconstruye la historia socio ambiental a lo largo de 40-50 años, y la interpreta en términos de gestión del riesgo, y del manejo costero, mostrando que la vulnerabilidad física de los contextos expuestos al peligro fue reducida mediante medidas estructurales, y que la vulnerabilidad social, política e institucional fue disminuida incrementando la cohesión interna y el liderazgo. Esta secuencia de eventos es esperable únicamente bajo dos condiciones específicas: espacios habitables con limitada capacidad portante, y una comunidad local automotivada. De no existir una comunidad local con capacidad de autoajuste, deberán esperarse resultados muy diferentes, aun con similares restricciones del medio físico.

  11. Manifestaciones muco cutáneas en anorexia nerviosa: Mucous and cutaneous manifestations of the anorexia nervosa

    Directory of Open Access Journals (Sweden)

    MB Leroux

    Full Text Available La anorexia nerviosa es una enfermedad psiquiátrica, cuya incidencia está creciendo en las últimas décadas. Afecta sobre todo a las adolescentes y mujeres jóvenes. Los signos clínicos son consecuencia de las carencias nutricionales y de los mecanismos de compensación, que el organismo implementa para conservar la vida. Las manifestaciones cutáneas y bucales son consecuencia de la desnutrición: vómitos autoprovocados, consumo de drogas o medicamentos no recetados y de la enfermedad psiquiátrica en sí misma. Se presentan diez pacientes, ocho mujeres y dos varones con signos cutáneos compatibles con anorexia nerviosa. El rango de edad es de 17 a 32 años. En orden de frecuencia se hallaron: acrocianosis, alopecia, acné, xerosis, palidez, hirsutismo, cambios en las membranas bucales y lesiones autoprovocadas. Creemos que el reconocimiento de estos signos cutáneos acompañado de un exhaustivo interrogatorio, puede colaborar en el diagnóstico de este trastorno alimentario.Anorexia nervosa is a psychiatric disease with an increasing incidence in the last decade, which affects principally adolescents and young women. Clinical signs are a consequence of malnutrition and the compensating mechanisms implemented to preserve life. Skin and oral lesions are caused by malnutrition, self-provoked vomiting, illegal drug consumption or therapeutic drugs utilization, and the psychiatric disease so far. Case reports: ten patients (eight females and two males with possible skin alterations due to anorexia nervosa, aged 17 to 32 yr. The most frequent signs, in order of priority were: acrocyanosis, alopecia, acne, xerodermia, pallor, hirsutism, oral injuries and self provoked injuries. We propose that the finding of these skin lesions plus an exhaustive questionnaire could aid to diagnose this eating disorder.

  12. Bioinfo_eXtrema : un enfoque bioinformático para integrar información ambiental, bioquímica y genómica, enfocado en bioprospección y selección de consorcios de microorganismos con aplicaciones en biorremediación

    Directory of Open Access Journals (Sweden)

    Fabián Capdevielle

    2011-05-01

    Full Text Available La identificación de componentes funcionales clave para diversos bioprocesos de interés industrial ha permitido seleccionar aislamientosadaptados a condiciones ambientales extremas en tres especies de hongos del género Penicillium. Dichos aislamientos fueron evaluados in vitro para caracterizar su potencial como componentes de un consorcio microbiano aplicable en biorremediación de efluentes industriales que contienen residuos lignocelulósicos. Los resultados de la anotación de secuencias genómicas disponibles para una de las especies identificadas apuntan a la existencia de genes con alta similaridad respecto a los existentes en diversos hongos considerados como referencia en materia dedegradación de lignina en ambientes naturales. Las anotaciones funcionales propuestas a partir de secuencias accesibles –identificadasa través de la base de datos Fungal Oxidative Lignin Enzymes– podrían contrastarse con los resultados experimentales para cepas creciendo en diferentes medios con lignina, representando ambientes industriales extremos. Mediante este trabajo se propone el ensamblado de Bioinfo_eXtrema como parte de un enfoque bioinformático centrado en la selección de consorcios de extremófilos para aplicaciones en biotecnología industrial, combinando diversas técnicas de minería de datos –integradas a través del Waikato Environment for Knowledge Analysis– para facilitar la integración de información molecular disponible e indicadores funcionales relevantes para aplicaciones en biorremediación.

  13. Atuação da enfermagem no tratamento com oxigenoterapia hiperbárica Actuación de la enfermería en el tratamiento con oxigenoterapia hiperbárica Nursing activities in hyperbaric oxygen therapy

    Directory of Open Access Journals (Sweden)

    Elias Pereira de Lacerda

    2006-02-01

    Full Text Available Através de relato de experiência desenvolvida na Clínica de Medicina Hiperbárica do Hospital Naval Marcílio Dias os autores discorrem sobre a atuação da enfermagem no tratamento com oxigenoterapia hiperbárica. Breve histórico do procedimento, efeitos terapêuticos, indicações, efeitos colaterais e complicações são apresentados. Entendem os autores que esforços devem ser envidados para que a atuação da enfermagem nesse novo papel seja conscientizada como alternativa de mercado de trabalho nesta especialidade que vem crescendo a cada dia.A través de un relato de experiencia desarrollada en la Clínica de Medicina Hiperbárica del Hospital Naval Marcílio Dias, los actores discurren sobre la actuación de la enfermería en el tratamiento con oxigenoterapia hiperbárica. Se presenta un breve histórico del procedimiento, efectos terapéuticos, indicaciones, efectos colaterales y complicaciones. Los autores consideran que son necesarios esfuerzos para que la actuación de la enfermería en ese nuevo papel sea concienciada como alternativa de mercado de trabajo en esta especialidad que viene creciendo a cada día.The authors discuss nursing activities in hyperbaric oxygen therapy through an experience report developed at the Medical Clinical of the Naval Hospital Marcílio Dias. This article presents a brief history of the procedure, its therapeutic effects, indications, collateral effects and complications. The authors believe that efforts are needed to create awareness about nursing activities in this new role as a labor market alternative in this growing specialty area.

  14. A casual alien plant new to Mediterranean Europe: Ceiba speciosa (Malvaceae in the suburban area of Palermo (NW Sicily, Italy

    Directory of Open Access Journals (Sweden)

    Pasta, Salvatore

    2014-12-01

    Full Text Available The abiotic and biotic characteristics of the first sites where floss silk tree behaves as a casual alien plant in the Mediterranean Europe are described. The species was probably first planted in botanical gardens of southern France few decades before mid XIX century. It was introduced in Palermo in 1896, a city which appears to match very well its climatic requirements. According to the available information on its biology and ecology in both its original and secondary range, the floss silk tree should not become an invasive alien plant in the Mediterranean. Nevertheless, several gaps need to be filled in order to increase our understanding of future trends of Ceiba speciosa in southern Europe, in particular, the eventual role of pollinators and seed dispersers outside the species’ natural range.Se describen las caracteristicas abióticas y bióticas de los primeros sitios del mediterráneo europeo donde el árbol palo borracho se encuentra creciendo como especie alóctona casual. Con respecto a la historia de su introducción, esta especie fue probablemente plantada en los jardines botánicos del sur de Francia unos pocos decenios antes de la mitad del siglo XIX. En 1896, sin embargo, fue introducida en Palermo, ciudad que parece satisfacer muy bien sus requerimientos climáticos. De acuerdo con la información disponible, tanto dentro como fuera de su área de distribución natural, el palo borracho no debería convertirse en planta invasora en el mediterráneo. Sin embargo, algunos vacíos de información deben ser completados antes de establecer su potencial invasor de una manera definitiva, particularmente, el posible papel de agentes polinizadores y dispersores fuera del área de distribución natural de la especie.

  15. Microprocesadores AMD: pasado, presente y futuro

    Directory of Open Access Journals (Sweden)

    Reynaldo Hernández Perdomo

    2005-01-01

    Full Text Available La evolución de la humanidad y en particular de la electrónica de los últimos años ha estado basada en los constantes avances en la fabricación de chips. Los circuitos integrados se han ido incorporando a todo los que nos rodea hasta el punto de que la vida sin ellos parece imposible. El microprocesador es uno de los logros más sobresalientes del siglo XX. Esas son palabras atrevidas, y hace un cuarto de siglo tal afirmación habría parecido absurda. Pero cada año, el microprocesador se acerca más al centro de nuestras vidas, forjándose un sitio en el núcleo de una máquina tras otra. Su presencia ha comenzado a cambiar la forma en que percibimos el mundo e incluso a nosotros mismos. Cada vez se hace más difícil pasar por alto el microprocesador como otro simple producto en una larga línea de innovaciones tecnológicas. No obstante que reconocemos la penetración del microprocesador en nuestras vidas, ya estamos creciendo indiferentes a la presencia de esos miles de máquinas diminutas que nos encontramos sin saberlo todos los días. Así que, antes de que se integre de manera demasiado imperceptible en nuestra diaria existencia, es el momento de celebrar al microprocesador y la revolución que ha originado, para apreciar el milagro que es en realidad cada uno de esos chips de silicio diminutos y meditar acerca de su significado para nuestras vidas y las de nuestros descendientes.

  16. DIVERSIDAD DE ABEJAS SIN AGUIJÓN (HYMENOPTERA:MELIPONINI UTILIZADAS EN MELIPONICULTURA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Guiomar Nates Parra

    2013-07-01

    Full Text Available En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura, es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 departamentos de Colombia, que cultivan 25 especies de abejas sin aguijón, agrupadas en 12 géneros. Se encontraron al menos nueve especies más sin identificación completa, se reportan cuatro nuevos registros para el país y se amplía la distribución para 21 taxones. Se presenta información sobre la distribución regional y altitudinal, el cultivo urbano y las denominaciones locales para las abejas. Se revisan algunas características de los géneros cultivados más comunes (Tetragonisca, Melipona, Paratrigona, Scaptotrigona, y Nannotrigona y se discute la importancia del vínculo entre diversidad biológica y cultural que se manifiesta en los nombres locales reportados. Ante un escenario mundial de expansión de la meliponicultura, se resaltan necesidades de investigación y riesgos para la conservación y manejo de la diversidad de abejas sin aguijón y los conocimientos asociados.

  17. Análisis del sector manufacturero en las regiones españolas

    Directory of Open Access Journals (Sweden)

    Delgado Rodríguez, M. Jesús

    2007-01-01

    Full Text Available La industria manufacturera interviene de manera fundamental en la evolución económica. El modelo general de crecimiento experimentado por las economías desarrolladas ha ido acompañado, inicialmente, de determinados cambios en sus estructuras productivas: El aumento continuado de la participación de los servicios en los agregados económicos producción y empleo junto a la consolidación del incremento de la importancia de la industria en la economía; apoyados en la reducción del peso de la agricultura . En etapas posteriores la industria se ha estabilizado, mientras los servicios han continuado creciendo hasta llegar a un punto en que este crecimiento se produce a expensas de la industria. El fortalecimiento de la industria manufacturera es decisivo en todo este proceso de transformación y modernización de las estructuras productivas de las economías Por su influencia en la mejora de la competitividad de la economía y por favorecer los cambios para el progreso técnico, tiene un papel central en los procesos de crecimiento. En este trabajo se analiza trayectoria y situación de la industria manufacturera en las regiones españolas de 1995 a 2002, en relación con su grado de desarrollo económico, a través de su especialización productiva y de su eficiencia.

  18. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.

  19. Los efectos de la política de liberalización del comercio exterior en el Perú durante el período 1990–1994

    Directory of Open Access Journals (Sweden)

    Jorge Vega

    2007-12-01

    Full Text Available El primer lustro de la década de 1990 fue una etapa de profundos cambios de política económica en el Perú. En este artículo se analizan las principales medidas adoptadas en materia de comercio exterior entre 1990 y 1994, y se miden sus impactos. Endicho período se abolieron los controles de precios y el control de cambios, se alentó la inversión privada nacional y extranjera, se liquidaron los monopoliosestatales de comercio exterior, se decretó la libertad de comercio interno y externo, se suprimieron las prohibiciones de importación, se redujeron los aranceles, se uniformizó la estructura arancelaria y se eliminaron los subsidios a las exportaciones.Las actividades de sustitución de importaciones, anteriormente protegidas, se vieron obligadas a adecuarse al nuevo contexto de protecciones efectivas reducidas.Varias sucumbieron, pero otras lograron estabilizarse y continuaron creciendo, aunque tuvieron que invertir en equipos nuevos y debieron reducir sus precios deventa en el mercado interno, lo cual benefició a los consumidores. En el agregado, crecieron tanto el PBI total como el del sector industrial. No se produjo el colapso industrial que muchos analistas pronosticaban. El empleo industrial se contrajo,pero fue compensado por aumentos en la productividad laboral. Las importaciones crecieron más rápidamente que las exportaciones, lo cual generó déficits comerciales, financiados por el ingreso de capitales. La apertura comercial si bien no eliminó el sesgo antiexportador pre-existente, lo redujo y sentó las bases para un posterior crecimiento del sector exportador. La reducción de aranceles ocasionó pérdidas fiscales iniciales que luego fueron compensadas por el crecimiento de las importaciones y por las mejoras en la administración tributaria.

  20. GRAVITATIONAL WAVE DETECTION: WHAT IS NEW

    Directory of Open Access Journals (Sweden)

    O. D. Aguiar

    2011-01-01

    Full Text Available La búsqueda de la detección de ondas gravitacionales ha sido uno de los desafíos tecnológicos más difíciles a los que se han enfrentado jamás los físicos experimentales y los ingenieros. A pesar de los resultados nulos obtenidos hasta la fecha después de cuatro años de búsqueda, la comunidad involucrada en ésta área ha ido creciendo. Una de las principales razones de esto es que la primera detección de ondas gravitacionales y la observación regular de ellas son de las metas más importantes para el comienzo de este milenio. Ellas probarán uno de los fundamentos de la física, la teoría de la relatividad general de Einstein y abrirá una nueva ventana para la observación del universo, lo cual, seguramente causará una revolución en nuestra comprensión de la física y la astrofísica. En esta charla daré un reporte actualizado acerca de todos los detectores relevantes (interferómetros, barras, esferas, radio telescopios y satélites CMB en operación, ó actualización y los que están en construcción o en proyecto. En particular hablaré con más detalle acerca del detector brasileiro Schenberg.

  1. Museos regionales en el Sudeste de la Provincia de Buenos Aires: Una aproximación a la problemática del patrimonio arqueológico Regional museums in southeast Buenos Aires province: an approach to the archaeological heritage issue

    Directory of Open Access Journals (Sweden)

    Irene Elena Brichetti

    2009-06-01

    Full Text Available Los museos nacionales en Argentina surgen conforme al influjo ejercido por la moderna idea de progreso y el imperialismo inscripto en el discurso museológico a través de la justificación de la superioridad occidental. El mundo postcolonial ha abierto otras perspectivas y nuevas voces pugnan por ser incluidas en la historia a través de su incorporación en el debate patrimonial. En este contexto mundial y desde hace tres décadas están creciendo los localismos justamente cuando una incipiente cultura común o global parece elevarse por sobre las singularidades. Es en este marco donde han surgido pequeños museos captados por el ámbito municipal en localidades bonaerenses. Aquí analizaremos cómo esos museos regionales del sudeste de la provincia de Buenos Aires (Miramar, Santa Clara del Mar, Balcarce se inscriben en la problemática del patrimonio arqueológico a partir de la relación entre lo local y lo global, la multivocalidad y el turismo.National museums in Argentina emerged with the influence of the idea of progress and imperialism inscribed in a museological discourse that served to justify western superiority. The postcolonial world has introduced other perspectives and new voices which struggle to be included in history through inclusion in the debate around patrimony. In this worldwide context for the past three decades localism has been growing at the same time that a global and common culture has been rising out of the singularities. Consequently, small museums were opened by local governments in Buenos Aires Province. Our objective is to analyze how the regional museums in southeast Buenos Aires Province (Miramar, Santa Clara del Mar, Balcarce are included in the current heritage debate on the basis of the relationship between the local and the global contexts, multivocality and tourism.

  2. La producción de leche orgánica en la región Puno: una alternativa de desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Saúl Olarte Calsina

    2013-06-01

    Full Text Available El consumo de productos orgánicos viene creciendo en todo el mundo y la leche orgánica no es la excepción. En Puno, por sus características geográficas, culturales e históricas, la producción agropecuaria aún mantiene tecnologías de producción ancestrales, buscando el equilibrio con el medio ambiente, con un uso mínimo de fertilizantes y pesticidas, con lo que se muestra un enfoque en la sostenibilidad y una tendencia a producir orgánicamente. El objetivo de este trabajo fue determinar mediante una simulación la viabilidad económica y el riesgo de producir leche orgánica como una alternativa de desarrollo sostenible. Se consideró la producción por encima de los 3.000 metros de altura, área de 6,5 has, una vaca (criolla por hectárea produciendo 10 litros de leche/día. Los indicadores económicos resultaron positivos: el VAN fue S/. 2.916,38, TIR 24%, VAE S/. 866,33, ratio B/C S/. 1,48 (se aclaro en la metodología y el período de recuperación de la inversión resultó de 5,88 años, evidenciando que la producción de leche orgánica es económicamente viable pero con riesgo elevado: la simulación de Monte Carlo mostró que existe 71,43% de probabilidad de no resultar viable.

  3. Orientaciones de Meta y Clima Motivacional Según Sexo y Edad en Educación Física

    Directory of Open Access Journals (Sweden)

    Antonio Baena - Extremera

    2014-01-01

    Full Text Available Esta investigación analizó las diferencias en función del sexo y la edad en el clima motivacional percibido y las orientaciones de meta de estudiantes en sus clases de Educación Física. Para ello, se administró un cuestionario compuesto por el Cuestionario de Percepción de Éxito en el Deporte adaptado a la Educación Física y por el Cuestionario de Orientación al Aprendizaje y al Rendimiento en las Clases de Educación Física. La muestra estuvo compuesta por un total de 846 estudiantes de secundaria de 12 a 19 años. Se realizó análisis de correlación y de varianza multivariado (MANOVA 2x3. Los resultados mostraron que existe una relación positiva y significativa entre las orientaciones de meta y el clima motivacional percibido por el alumnado. Las chicas presentan valores mayores de orientación al ego y de percepción de un clima implicante al rendimiento que los chicos. Y las únicas diferencias por edad se dan en el clima motivacional implicante al rendimiento. Como principal conclusión señalar que el docente debe prestar mucha más atención al clima motivacional creado en clase conforme el alumnado va creciendo, fomentando un clima implicante al aprendizaje. Asimismo tendrá que buscar estrategias que alejen a las chicas de estereotipos tradicionales y las refuercen socialmente.

  4. The Woodlands: Una forma diferente de gobernar

    Directory of Open Access Journals (Sweden)

    Raquel Insa-Ciriza

    2010-06-01

    Full Text Available The Woodlands (Texas es uno de los mejores ejemplos de éxito de los partenariados público-privados entre el Departamento de Urbanismo y Vivienda Americano (Department of Housing and Urban Development, US - HUD y la empresa privada. The Woodlands, que fue creada como una «Nueva Ciudad» por la compañía Mitchell Energy & Development Corporation, ha ido creciendo y creando una masa crítica de residentes, trabajadores, su propio sentido de comunidad y lo más importante, su propia forma de gobierno. Es el único caso en Estados Unidos de ciudad gobernada por asociaciones privadas. Estas asociaciones, representadas por un Consejo de Administración, proveen la mayoría de los servicios públicos a los ciudadanos. En este artículo se muestra lo que llamo «complicidad ciudadana» basada en lo que el Nuevo Servicio Público define como gobierno basado en la comunidad. Ellos no están reinventando ninguna clase de gobierno, lo que están haciendo es crear una nueva forma de gobierno en la que los ciudadanos prefieren tomar el mando que servir. El estudio del caso que muestro nos ayuda a entender cómo una mayor participación de los ciudadanos en las tareas de la administración local puede hacer disminuir visiblemente el poder del promotor en el desarrollo de una Nueva Ciudad. Esta complicidad ciudadana se traduce en términos de implicación de los miembros de la comunidad en el crecimiento y en el Gobierno de la ciudad

  5. Monográfico Análisis del Discurso Digital · Presentación

    Directory of Open Access Journals (Sweden)

    Cristina Vela Delfa

    2016-04-01

    Full Text Available El interés por el estudio de los discursos digitales ha ido creciendo, hasta convertirse en un área de trabajo en completa ebullición. Desde distintas disciplinas, como la sociología, la semiología, la filosofía de la ciencia, la psicología, las ciencias de la información y de la comunicación, y la lingüística, han proliferado las investigaciones destinadas a entender este fenómeno comunicativo y discursivo. Los trabajos sobre estos entornos de interacción se multiplican en el ámbito internacional. De ello dan cuenta revistas como Journal of Computer-Mediated Communication, editado por S. Shyam Sundar (The Pennsylvania State University o Language@Internet!, editada por Susan C. Herring (Indiana University, Bloomington. Pensamos, no obstante, que todavía hay ciertas carencias en la investigación sobre el discurso digital en lengua española, a pesar de ser una de las más usadas en la red, entre la tercera y la cuarta posición, según datos recientes. Ello fue lo que nos movió a dedicar un número de la Revista Aposta al estudio del discurso digital en español, a fin de abordar la complejidad que entraña la trama de dispositivos, interfaces y plataformas que sirven de soporte a la comunicación digital.

  6. Estrategias de salud electrónica en la región de Las Américas: Situación actual y perspectivas

    Directory of Open Access Journals (Sweden)

    Marcelo D’ Agostino

    2015-06-01

    Full Text Available El objetivo principal de la Estrategia y Plan de Acción Sobre eSalud (2012-2017 es contribuir al desarrollo sostenible de los sistemas de salud de los estados miembros. Con su adopción se busca mejorar el acceso a los servicios de salud y su calidad a través de la utilización de las tecnologías de la información y de las comunicaciones (TIC, la implementación de programas de alfabetización digital y el acceso a información de calidad que permita avanzar hacia sociedades más informadas, equitativas, competitivas y democráticas. La OPS/OMS considera que sociedades con acceso libre y equitativo a la información sobre salud debe ser un derecho fundamental de las personas. El acceso a información, intercambio de conocimientos y uso de las tecnologías de la información y la comunicación en el sector de la salud sigue creciendo y está impulsando cambios significativos en la manera en que la población interactúa con los servicios de salud y entre sí misma en las redes sociales y mediante el uso de dispositivos móviles (mSalud. Esta sociedad hiperconectada, o sociedad de la información, nos trae nuevos desafíos y oportunidades relacionadas con el uso de datos masivos (Big data que nos obliga a repensar nuestra relaciones con la realidad y la forma tradicional de manejo de información en salud

  7. Estrategias de salud electrónica en la región de Las Américas: Situación actual y perspectivas

    Directory of Open Access Journals (Sweden)

    Marcelo D’ Agostino

    2015-04-01

    Full Text Available El objetivo principal de la Estrategia y Plan de Acción Sobre eSalud (2012-2017 es contribuir al desarrollo sostenible de los sistemas de salud de los estados miembros. Con su adopción se busca mejorar el acceso a los servicios de salud y su calidad a través de la utilización de las tecnologías de la información y de las comunicaciones (TIC, la implementación de programas de alfabetización digital y el acceso a información de calidad que permita avanzar hacia sociedades más informadas, equitativas, competitivas y democráticas. La OPS/OMS considera que sociedades con acceso libre y equitativo a la información sobre salud debe ser un derecho fundamental de las personas. El acceso a información, intercambio de conocimientos y uso de las tecnologías de la información y la comunicación en el sector de la salud sigue creciendo y está impulsando cambios significativos en la manera en que la población interactúa con los servicios de salud y entre sí misma en las redes sociales y mediante el uso de dispositivos móviles (mSalud. Esta sociedad hiperconectada, o sociedad de la información, nos trae nuevos desafíos y oportunidades relacionadas con el uso de datos masivos (Big data que nos obliga a repensar nuestra relaciones con la realidad y la forma tradicional de manejo de información en salud

  8. Nurse effect in seedling establishment: facilitation and tolerance to damage in the Andes of central Chile Efecto nodriza en el establecimiento de plántulas: facilitación y tolerancia al daño en los Andes de Chile central

    Directory of Open Access Journals (Sweden)

    IAN S ACUÑA-RODRÍGUEZ

    2006-09-01

    ás relevante en ambientes estresantes. Este efecto sería particularmente importante durante el periodo de establecimiento de las plántulas debido a su alta vulnerabilidad a factores bióticos y abióticos como herbivoría y desecación. La tolerancia a la herbivoría evidencia la capacidad de las plantas de recrecer y reproducirse después del daño, pero esta capacidad es recurso-dependiente. En los Andes de Chile central, la planta en cojín Laretia acaulis (Apiaceae atenúa el efecto del estrés ambiental, aumentando la supervivencia de diversas especies de plantas asociadas. Proponemos que las plántulas que se encuentren creciendo dentro de los cojines de L. acaulis deberían evidenciar niveles mayores de tolerancia en relación a aquellas plántulas creciendo fuera de los cojines. Para probar esta hipótesis se llevó a cabo un experimento de campo con dos especies nativas perennes: Hordeum comosum (Poaceae y Haplopappus anthylloides (Asteraceae. Plántulas de ambas especies fueron sembradas dentro y fuera de los cojines de L. acaulis, y la mitad de ellas recibieron daño manual (50 % tejido foliar removido. En general, las plántulas que se encontraron creciendo dentro del cojín evidenciaron una mayor supervivencia independientemente del tratamiento de daño. A pesar de que la ubicación de las plántulas no afectó la respuesta en tolerancia por parte de H. anthylloides, sí afectó significativamente la tolerancia de H. comosum. Por lo tanto, encontramos valores similares para la supervivencia de plántulas de H. comosum dentro de los cojines, pero la supervivencia de plántulas dañadas fuera de los cojines fue significativamente menor que la de plántulas control. Se pudo evidenciar la ocurrencia de efecto nodriza por parte de L. acaulis sobre el establecimiento de ambas especies y conjuntamente un aumento en la tolerancia al daño para H. comosum en este hábitat estresante

  9. Presencia de Diferentes Virus de Pimiento (Capsicum annuum L. en Especies de Malezas Asociadas al Cultivo Presence of Different Sweet Pepper (Capsicum annuum L. Viruses on Associated Weed Species

    Directory of Open Access Journals (Sweden)

    Juan Ormeño N

    2005-12-01

    Full Text Available En prospecciones de malezas realizadas durante dos temporadas agrícolas, 30 especies anuales y 13 perennes fueron determinadas en cultivos de pimientos (Capsicum annuum L. de los Valles de Elqui y Limarí, Región de Coquimbo (29° a 30º lat. Sur. Los muestreos fueron aleatorios dentro y fuera de los potreros, con y sin cultivo presente, en invierno y primavera. Se recolectaron 676 plantas de malezas, analizándose un total de 379 muestras. Utilizando la prueba DAS-ELISA se determinó Virus del mosaico del pepino (CMV, Virus del bronceado del tomate (TSWV, Virus del mosaico de la alfalfa (AMV, Virus Y de la papa (PVY y Virus INSV (Impatients necrotic spot virus. Un 17% (64 de las muestras fueron positivas al menos a un virus, de las cuales 7,4% (28 provinieron de plantas con síntomas y 9,4% (36 fueron hospederos asintomáticos. Chamico (Datura spp. hospedó a CMV y PVY; nicandra (Nicandra physalodes a AMV, CMV y PVY; tomatillo (Solanum nigrum a CMV y PVY; ñilhue (Sonchus spp. a AMV y TSWV; pacoyuyo (Galinsoga parviflora a AMV, CMV, TSWV y INSV; quingüilla (Chenopodium spp. a AMV, CMV, TSWV, PVY e INSV, entre las principales. Usando un índice potencial de infección relativa (IPIR, los mayores valores se obtuvieron con pacoyuyo (74,7, nicandra (11,2, tomatillo (6,3 y quingüilla (6,0. Especies como ñilhue, chamico, pila-pila (Modiola caroliniana, quilloi-quilloi (Stellaria media y bledo (Amaranthus spp., tuvieron índices inferiores a 1,0. Nicandra y pacoyuyo portaron más de un virus y estas infecciones múltiples prevalecieron sobre las simples. Controlar malezas portadoras tanto dentro como en las inmediaciones de los potreros, resulta imperioso para poder minimizar la incidencia y dispersión de las enfermedades virales en pimientos.In a two growth-cycle survey, 30 annual and 13 perennial weed species were determined in different sweet pepper (Capsicum annuum L. growing areas of the Limari and Elqui valleys of Coquimbo Region of Chile

  10. Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010

    Energy Technology Data Exchange (ETDEWEB)

    Scheinost, Andreas C.; Baehtz, Carsten (eds.)

    2011-07-01

    be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.

  11. Association of programmed cell death 1 polymorphisms with systemic lupus erythematosus in Fujian Han population%福建汉族人群PDCD1基因多态性与系统性红斑狼疮相关性研究

    Institute of Scientific and Technical Information of China (English)

    陈凌; 陈志哲; 薛士杰; 郑祥雄; 赵亮; 朱进伟; 唐阳

    2008-01-01

    目的 探讨程序性细胞死亡基因(PDCD1)SNP-7809(rs11568821)、SNP-7872,SNP-8162(rs6705653)单核苷酸多态性(SNP)在中国福建汉族人群中与系统性红斑狼疮(SLE)的遗传相关性,并尝试DNA池技术(DNA-pooling)在遗传相关分析方面研究的实用性.方法 采用病例-对照研究分析方法,募集240例SLE患者和210名正常对照者作为研究对象,应用限制性片段长度多态性-聚合酶链反应(RFLP-PCR)方法和引物引入限制性内切酶分析(PIRA-PCR)方法对PDCD1基因SNP-7809、SNP-7872和SNP-8162进行分型测定.通过标准曲线法定量测定患者和正常对照DNA池混合样本等位基因的比值比(OR),对比验证能否通过DNA池技术快速判定SNP的遗传相关性.结果 PDCDI SNP-7872和SNP-8162基因型频率在SLE组和对照组基因型分布差异无统计学意义(P=0.81,0.86;OR=1.02,0.99),经Logistic回归分析,控制性别、年龄的混杂作用后,PDCD1 SNP-7872和SNP-8162基因型频率在SLE组和对照组基因型分布差异仍无统计学意义(P=0.75,0.81),单一样本测定结果与混合样本的测定结果基本一致.结论 在中国福建汉族人群中,PDCD1基因的SNP-7809无多态性,SNP-7872和SNP-8162基因多态性与SLE的发病没有相关性.研究表明DNA池技术对于某些SNP的相关性的研究是一种便捷可行的方法.

  12. Sinopsis del mundo Piro: Ética y estética en el arte Piro. Modificaciones en las estructuras de parentesco Piro durante el auge del caucho (1885-1915. Los asentamientos Piros y la persistencia de su identidad

    Directory of Open Access Journals (Sweden)

    Luis Román Villanueva

    1985-12-01

    Full Text Available Los tres artículos que a continuación presentamos tienen como objeto detallar tres aspectos fundamentales de la cultura Piro. Este grupo etno-linguistico, pertenece a la familia Arahuaca, al igual que los Campa, Machiguenga y Amuesha, se ubica principalmente en las riberas del río Urubamba perteneciente al distrito de Echarate, Provincia de la Convención, Departamento del Cusco y el Distrito de Sepahua, Provincia de Atalaya, Departamento de Ucayali. La población estimada para este grupo es de 1600 habitantes (Wise, M.R. 1972 que se distribuye en 12 comunidades nativas, de las cuales la mitad están tituladas por el Estado peruano. Sobre este grupo existe regular bibliografía principalmente en lo referido a lingüística, relatos de viajeros y misioneros de diversas órdenes y en menor escala trabajos etnográficos y etno-históricos. En esta serie de artículos los autores pretenden una aproximación en detalle para profundizar el conocimiento que de esta etnia se tiene. Para ello utilizaremos los trabajos anteriores a los cuales sumaremos nuestras notas y apreciaciones recogidas durante cuatro años de trabajo en la zona. El primer artículo de L. Komán pretende explicar la relación entre lo ideológico y lo estético para lo cual se remite a la mitología y las manifestaciones estéticas del grupo piro. En el segundo artículo el mismo autor señala una transformación estructural en el sistema de parentesco piro durante el auge de la explotación del caucho, dando lugar a una variación del modelo original, que garantiza la reproducción biológica y cultural del grupo. El artículo final de V. de Szyzslo describe la forma cómo cada una de las familias de la comunidad pira de Miaría, en el Urubamba, dispone del espacio para la construcción de sus viviendas y locales comunales. Los tres artículos, por lo tanto son complementarios para obtener una visión en detalle de los aspectos ideológicos, socio-políticos y tecnológicos q u

  13. Ocorrência de plantas aquáticas nos reservatórios da Light-RJ Ocurrence of aquatic plants in the Light-RJ reservoirs

    Directory of Open Access Journals (Sweden)

    D. Martins

    2003-01-01

    Full Text Available O objetivo do presente trabalho foi caracterizar as comunidades infestantes de plantas aquáticas presentes nos reservatórios da Light-Sistema de Eletricidade S.A., localizada no município de Piraí-RJ. Os levantamentos foram realizados no período de julho a setembro de 1998. Os reservatórios analisados foram: Vigário, Pereira Passos e Lajes, sendo as quantidades de pontos amostrados de 19, 9 e 15, respectivamente. Em cada ponto amostrado fez-se a marcação das coordenadas geográficas e avaliou-se a porcentagem de ocupação do corpo d'água pelas espécies de plantas aquáticas presentes. Depois da identificação das plantas, pôde-se verificar quais eram as espécies mais freqüentes e a sua distribuição dentro do sistema de geração de energia. As espécies encontradas nos reservatórios foram: Brachiaria arrecta (Hack. Stent.; Egeria densa Planch.; Eichhornia azurea (Sw. Kunth.; Eichhornia crassipes (Mart. Solms.; Hymenachne amplexicaulis (Rudge Nees.; Panicum rivulare Trin.; Pistia stratiotis L.; Polygonum spp.; Sagitaria montevidensis Cham. & Schlecht; Salvinia auriculata (Micheli Adans; e Thypha dominguensis L.This study aimed to describe the aquatic weeds infesting the Light-Electric System S.A. reservoirs, located in Pirai-RJ, Brazil. The survey was carried out from July to September 1998. The reservoirs analyzed were: Vigario, Pereira Passos and Lajes, with 19, 9 and 15 points being sampled, respectively. Sampled geographic coordinates were marked in each point and a visual estimate was made of the percentage of river water occupied by the aquatic plants. After plant identification, the most frequent species and their distribution were determined as follows: Brachiaria arrecta (Hack. Stent.; Egeria densa Planch.; Eichhornia azurea (Sw. Kunth.; Eichhornia crassipes (Mart. Solms.; Hymenachne amplexicaulis (Rudge Nees.; Panicum rivulare Trin.; Pistia stratiotis L.; Polygonum spp.; Sagitaria montevidensis Cham.& Schlecht

  14. Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010

    International Nuclear Information System (INIS)

    be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.

  15. Diverse Early Life-History Strategies in Migratory Amazonian Catfish: Implications for Conservation and Management.

    Directory of Open Access Journals (Sweden)

    Jens C Hegg

    Full Text Available Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii, Piramutaba (Brachyplatystoma vaillantii, and Piraíba (Brachyplatystoma filamentosum. We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87Sr/(86Sr recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87Sr/(86Sr isotope values using a regression-based approach that related

  16. Litoquímica, Geocronologia U-Pb e Geologia Isotópica (Sr-Nd-Pb das Rochas Graníticas dos Batólitos Cunhaporanga e Três Córregos na Porção Sul do Cinturão Ribeira, Estado do Paraná

    Directory of Open Access Journals (Sweden)

    Hélcio José dos Prazeres Filho

    2003-08-01

    Full Text Available Durante a evolução da porção sul do Cinturão Ribeira no Estado do Paraná, o Ciclo Brasiliano-Pan Africano foi responsávelpela geração de um grande volume de rochas graníticas com destaque para os batólitos Cunhaporanga (BCP e TrêsCórregos (BTC. Estudos litoquímicos e isotópicos revelaram a existência de tipos graníticos distintos entre dois batólitos einternamente aos mesmos, definidos por unidades graníticas. A principal diferença entre os dois batólitos está no comportamentodos álcalis com o BCP, a NW mais potássico e o BTC, a SE mais sódico. Os dados isotópicos mostram claramente aparticipação de fontes infracrustais distintas de longa residência crustal, evidenciadas pelos isótopos de Pb em K-feldspato,pelos valores negativos de eNd (–11 a –13 para o BCP e –17 a –19 para o BTC e pelas idades TDM (1,8 a 2,0 Ga para o BCPe 2,2 a 2,4 Ga para o BTC. Estas fontes estariam situadas em uma crosta continental paleoproterozóica com a participaçãode fontes mantélicas e supracrustais na gênese das rochas graníticas do BCP e BTC. A Unidade Ribeirão Butiá do BCP e asUnidades Arrieiros e Paina do BTC estão representadas predominantemente por monzogranitos e granodioritos e rarostonalitos, metaluminosos, cálcio-alcalinos de alto a médio K, formados entre 630 a 620 Ma em ambiente de margem continentalativa. As Unidades Piraí do Sul e Santa Rita do BCP são constituídas por monzogranitos fracamente peraluminosos, de altoK e as Unidades São Sebastião e Conceição do BTC são constituídas respectivamente por quartzo-monzonitos e monzo asienogranitos fracamente metaluminosos, de alto K. Estas unidades foram formadas em ambiente sin- a tardi-colisional entre620 e 590 Ma.

  17. Dinâmica da comunidade de macrófitas aquáticas no reservatório de Santana, RJ Dynamics of the aquatic macrophytecommunity in the Santana reservoir in Pirai-RJ

    Directory of Open Access Journals (Sweden)

    R.L.C.M. Pitelli

    2008-01-01

    Full Text Available Apesar da importância na dinâmica dos ecossistemas aquáticos, as macrófitas podem formar densas e extensas colonizações em corpos hídricos cujos equilíbrios ecológicos foram rompidos. Nessas condições, essas plantas promovem uma série de problemas que as tornam alvos de controle. Para elaboração de planos adequados de manejo dessa vegetação, é fundamental o conhecimento das dinâmicas relativas das populações que a compõem. O objetivo deste trabalho foi realizar levantamentos mensais da composição específica da comunidade de macrófitas que coloniza o reservatório de Santana, localizado no município de Piraí/RJ, monitorando 97 pontos georreferenciados, abrangendo toda a lâmina d'água. Foram identificadas 41 espécies, inseridas em 21 famílias botânicas. As famílias Poaceae, Pontederiaceae e Cyperacae foram as que apresentaram os maiores números de espécies ao longo do ano. Salvinia herzogii e Egeria densa apresentaram as maiores notas anuais de colonização do reservatório. As populações de Eichhornia azurea, Brachiaria arrecta e Paspalum repens completaram o grupo das espécies numericamente mais relevantes. As plantas de hábito flutuante tenderam a apresentar populações com padrão de distribuição geográfica casualizado, enquanto as espécies fixadas no sedimento e as submersas apresentaram populações com padrão agregado. Não houve expressivas variações mensais dos valores dos índices de diversidade (H' e de equitabilidade (E' das comunidades de macrófitas aquáticas ao longo do ano. O dendrograma construído com o coeficiente de Odum mostrou uma seqüência lógica dos meses, evidenciando uma definida sucessão de populações divididas em dois grupos de similaridade separados pelo mês de junho. Nessa época, o nível de água do reservatório foi reduzido e o sedimento ficou exposto, favorecendo as espécies de hábito emergente.Despite the importance of aquatic ecosystem dynamics, aquatic

  18. Consumo ilimitado, eficiencia y desigualdad urbana. Definición socioecológica del consumo urbano desde las perspectivas del marxismo y el metabolismo

    Directory of Open Access Journals (Sweden)

    Rubén Miguel Águeda

    2015-12-01

    Full Text Available Resumen Las mejoras en la eficiencia de los sistemas urbanos pueden resultar insuficientes en la búsqueda de una ciudad más respetuosa con el medio natural si el consumo en el interior de las ciudades sigue creciendo sin control y, especialmente, si este incremento no es consecuencia directa del comportamiento de los consumidores. Para explicar cómo la estructura de la ciudad interviene en el consumo se recurre a dos formas diferentes de entender el espacio urbano. Por un lado el estudio del metabolismo urbano cuantifica los componentes que intervienen en el consumo, por otro, las interpretaciones marxistas de la ciudad tratan de explicar las estructuras sociales, políticas y económicas que lo condicionan. El resultado es una teoría conjunta que permite interpretar todos los fenómenos y actividades que engloba el término consumo, aglutinando tanto la dimensión ecológica de éste como los aspectos sociales y políticos que intervienen en el mismo. Palabras clave Estructura urbana, sostenibilidad, flujos de circulación, escasez, desequilibrios sociales y ambientales Abstract Improving the efficiency of urban systems may prove insufficient in the pursuit of a friendlier city with the environment if consumption within cities continues growing out of control and, in particular, if this increase is not a direct consequence of consumers’ behavior. For explaining how the structure of the city intervenes in consumption we can use two different ways of understanding urban space. On one hand urban metabolism quantifies the components involved in consumption, on the other Marxist interpretations of the city try to explain the social, political and economic structures that condition it. The result is a joint theory that allow us to interpret every phenomenon and activity within the term consumption and that bring together both ecological, political and social dimensions involved. Keywords Urban structure, sustainability, circulation fluxes

  19. Desarrollo foliar y caulinar de las unidades de alargamiento de Nothofagus dombeyi (Nothofagaceae en condiciones de alta y baja luminosidad Leaf and stem development in extension units of Nothofagus dombeyi (Nothofagaceae under high and low light conditions

    Directory of Open Access Journals (Sweden)

    Cecilia Calabria

    2008-07-01

    Full Text Available Se analizaron el tamaño del tallo y las hojas que componen las unidades de alargamiento (UA del tronco, las ramas principales y las ramas cortas de ejemplares juveniles de Nothofagus dombeyi desarrollados en comunidades de áreas abiertas (bordes de camino y de sotobosque de Patagonia. Se evaluaron el área y la forma (ancho/longitud de las hojas a lo largo de las UA, el área foliar específica (AFE y las relaciones área foliar/volumen del tallo, longitud del tallo/peso del tallo y volumen del tallo/peso del tallo. Para igual posición en la UA, las hojas del tronco son mayores que las de las ramas principales y éstas mayores que las de las ramas cortas. En las UA del tronco el desarrollo caulinar es proporcionalmente mayor al de las hojas en comparación con las UA de las ramas principales y, en especial, de las ramas cortas. La restricción en el desarrollo caulinar y el aumento del AFE en ejemplares de N. dombeyi creciendo a la sombra permitiría su supervivencia pero con limitado desarrollo en altura y, en consecuencia, baja probabilidad de alcanzar el dosel.The size of stem and leaves was studied for trunk, main branch and short branch extension units (EU of young Nothofagus dombeyi trees growing in open areas (road verges and understory communities in Patagonia. The surface area and outline (width/length ratio of single leaves along EU, the specific leaf area, and the ratios leaf area/stem volume, stem length/stem mass and stem volume/stem mass were assessed. Trunk leaves were larger than main-branch leaves and main-branch leaves larger than short-branch leaves in similar positions on the EU. Stem developed proportionally more than leaves in trunk EU than in main-branch EU and, especially, short-branch EUs. Restrictions in stem development and increases in specific leaf area would allow N. dombeyi trees to survive under shaded conditions though limiting their height growth and, consequently, their chances to reach the canopy.

  20. Macroeconomíc aspects of the development plan Aspectos macroeconómicos del plan de desarrollo

    Directory of Open Access Journals (Sweden)

    Lorente Luis

    1999-06-01

    Full Text Available Shortly after the economic opening, the economy began a cycle of rapid growth and accumulation of deficits, followed by another stage of monetary correctives which brake growth, but don't eliminate the causes of the disequilibrium. The Development Plan reduces the fiscal deficit and it is probable that the next expansion phase will last three years, instead of the barely one year that the previous expansion lasted. But the current account deficit of the balance of payments persists, and willgrow when privatizations slow down toward the third year of the Plan. The country needs outside capital to sustain its growth and modernize its production; thus private debt and foreign investment will continue togrow, along with foreign debt servicing and the repatriation of the profits of capital. Reducing the trade deficit to almost zero by 2002 is not enough; a surplus must be generated, that is, in addition to increasing exports we must substitute imports, but without the simplistic protectionism of the pasto instead of high tariffs, sources of risk capital must be created which are willing to finance new firms, technological innovations, and production of goods with sufficient quality and pricesto substitute for a good part of what we now import.Poco despues de la apertura, la economia inicio un ciclo de crecimiento rapido y acumulacion de deficits, seguido por otra etapa de correctivos monetarios que frenan el crecimiento, pero que no eliminan las causas del desequilibrio. El plan de desarrollo reduce el deficit fiscal y es probable que la proxima fase de expansion dure tres años, en lugar del año escaso que duro el anterior. Pero subsiste el deficit de cuenta corriente de balanza de pagos, que crecera cuando bajen las privatizaciones hacia el tercer año del plan. El pais necesita del capital externo para sostener su crecimiento y modernizar su produccion, asi que seguiran creciendo la deuda privada y la inversion extranjera y, con ellas, el

  1. Crecimiento de una ciudad dispersa: análisis y reflexiones del caso de la ciudad de Comodoro Rivadavia

    Directory of Open Access Journals (Sweden)

    Natalia Usach

    2015-04-01

    Full Text Available En diferentes contextos numerosas ciudades alrededor del mundo han experimentado, desde mediados del siglo pasado, nuevos patrones de crecimiento urbano. Bautizados estos fenómenos bajo distintas denominaciones, contraurbanización, desurbanización, difusión o dispersión urbana, han dado cuenta de un proceso de difusión poblacional por fuera de las áreas centrales tradicionales. En muchas ocasiones, las pautas de crecimiento urbano no sólo han consistido en la pérdida de población del área central y de algunas áreas suburbanas tradicionales; sino que han comportado incluso la disolución de la ciudad compacta tradicional por la ocupación discontinua del territorio.Estos fenómenos de crecimiento disperso no resultan novedosos para el caso de ciudades que, como Comodoro Rivadavia en la Patagonia argentina, han crecido históricamente a partir de la localización y consolidación de los asentamientos de trabajadores en torno a las extensas áreas de explotación petrolera a importantes distancias del casco central. En efecto, en esta ciudad puede reconocerse un territorio urbano disperso y fragmentado, atravesado por numerosos conflictos urbanísticos, sociales, económicos y ambientales; cuya impronta ha venido marcada por el devenir de la actividad extractiva.El presente trabajo tiene por objetivo analizar y caracterizar la dinámica reciente del crecimiento urbano en Comodoro Rivadavia. Nos preguntamos hacia dónde está creciendo la ciudad, cuáles son las zonas que evidencian un mayor dinamismo poblacional y cuáles son las características de este crecimiento en función no sólo a los cambios morfológicos sino también a las particularidades de la población implicada en este crecimiento.

  2. Boko Haram: análisis del fenómeno terrorista en Nigeria

    Directory of Open Access Journals (Sweden)

    Francisco Javier Torregrosa López

    2016-04-01

    á creciendo y mejorando sus recursos y estrategias, gracias a su relación con Daesh, para finalmente ser fagocitado por este como parte de un proceso de expansión territorial.

  3. Apps y gestión de marca ¿es indispensable ser mobile?

    Directory of Open Access Journals (Sweden)

    Zahaira González Romo

    2011-05-01

    Full Text Available La gestión estratégica de la marca a través de los medios de comunicación digital ha cobrado especial relevancia en los últimos años, y prácticamente todas las empresas que se aprecien de llevar una comunicación acorde a sus públicos han desarrollado herramientas y adaptado su comunicación de marca a los diferentes soportes, medios y entornos que han ido emergiendo, hasta el punto de que este proceso ha sufrido una metamorfosis que no todas las empresas consiguen asumir y entender. No sólo hablamos de un replanteamiento y adaptación a las nuevas tecnologías, sino una “nueva forma” de pensar las marcas y su repercusión e imagen en la mente de los consumidores. Tal es el caso de las aplicaciones para los smartphones, que se han desarrollado con una virulencia impresionante, aproximadamente 200.000 actualmente, y el número continúa creciendo. Este estudio pretende ser una primera aproximación a la aparición de las marcas en las aplicaciones para móviles, específicamente en las aplicaciones destinadas a iPhone.Gracias esta investigación sabemos que es indispensable tener en cuenta tres criterios básicos en el desarrollo de aplicaciones; el primero y más importante es que los anunciantes deben centrarse en el análisis de las necesidades de los usuarios, determinar sus objetivos, elaborar planes de integración y sobre todo preparar los medios de comunicación multicanal y de apoyo a la comercialización. Si la aplicación es correcta pero no funciona adecuadamente, deteriora la imagen de la marca de cara al cliente. En segundo lugar, la experiencia del usuario en las aplicaciones móviles debe ser complementaria y coherente con su experiencia a través de otros canales, es decir, debe mantenerse fiel a la marca y a la identidad de la empresa. Y el tercer criterio, es importante para la marca ir adaptándose a las nuevas tecnologías, pues una incorporación precaria y mal desarrollada puede ser más perjudicial que no el

  4. El paciente geriátrico en urgencias The geriatric patient and emergency care

    Directory of Open Access Journals (Sweden)

    F.J. Martín-Sánchez

    2010-01-01

    Full Text Available La demanda en la atención urgente ha ido creciendo progresivamente en los últimos años y este incremento es más acusado en la población anciana. Teniendo en consideración que el paciente anciano requiere evaluaciones más complejas con una mayor realización de pruebas complementarias y consultas a otros especialistas, estancias más prolongadas en urgencias y mayor porcentaje de ingresos, el progresivo envejecimiento poblacional puede llegar a repercutir seriamente en la presión asistencial de los servicios de urgencias hospitalarios (SUH. El paciente anciano de alto riesgo es vital detectarlo antes de asignarle una ubicación definitiva. Para ello, es importante instaurar un cribado entre los pacientes ancianos que acuden a urgencias con el fin de seleccionar a los que se van a beneficiar de una valoración geriátrica integral y así poder diseñar un plan específico de cuidados. La intervención urgente en el paciente geriátrico no debe afrontarse exclusivamente como un problema médico sino que debe tenerse en cuenta aspectos funcionales, mentales o sociales. Representa un reto para los SUH. En el presente artículo vamos a desarrollar diversos aspectos como la detección y la valoración del paciente geriátrico así como a establecer ciertas recomendaciones para el entorno de urgencias.Demand in emergency care has been growing progressively in recent years and this increase is more pronounced in the elderly population. Taking into account that the elderly patient requires more complex evaluations with a greater requirement for complementary tests and consultations with other specialists, longer stays in the emergency ward and a greater percentage of admissions, the progressive ageing of the population might come to have a serious repercussion on hospital emergency departments. It is vital to detect high risk elderly patients before assigning them a definitive placement. For this purpose it is important to install a sieving

  5. Detección de la expresión génica in vivo de Mycobacterium tuberculosis durante la tuberculosis pulmonar activa Mycobacterium tuberculosis in vivo-expressed genes detection during active pulmonary tuberculosis

    Directory of Open Access Journals (Sweden)

    Alejandra Otazo M

    2012-12-01

    Full Text Available El estudio de la expresión génica de Mycobacterium tuberculosis ha involucrado la experimentación "in vitro ", "ex vivo " e "in vivo " (modelos animales, pero aún sin el éxito esperado. Proponemos que revelar los factores clave de la tuberculosis humana requiere investigar la expresión génica de M. tuberculosis dentro del ser humano ("in vivo ". Para ello, aislamos el mRNA total de M. tuberculosis, desde muestras clínicas respiratorias de pacientes con diagnóstico de tuberculosis pulmonar; posteriormente, sintetizamos el dscDNA y lo analizamos mediante RT-PCR cualitativo. Detectamos la expresión de la secuencia de inserción IS6110 y de los genes "housekeeping " 16SrRNA y sigA en M. tuberculosis creciendo in vivo (tuberculosis pulmonar así como cultivado in vitro. La expresión de los genes mprA y mprB, que codifican el sistema de transducción de señales MprAB, sólo se detectó en M. tuberculosis crecido in vitro. Con nuestros resultados damos el primer paso hacia la implementación de un método no invasivo para el estudio del transcriptoma de M. tuberculosis, dentro de su único hospedero natural, con el fin de analizar la regulación "in vivo" de los determinantes genéticos requeridos para su virulencia y patogénesis.Mycobacterium tuberculosis gene expression studies have involved "in vitro", "ex vivo" and "in vivo" experiments (animal models, but without the expected success. We propose that key features of human tuberculosis could be discovered by studying the M. tuberculosis gene expression within the human host. Therefore, we isolated totalM. tuberculosis mRNA from human clinical respiratory specimens of patients diagnosed with pulmonary tuberculosis; after this, we synthesized the dscDNA and tested it by qualitative RT-PCR assays. We detected the expression of IS6110 insertion sequence and of the "housekeeping" genes 16SrRNA andsigA in M. tuberculosis grown in vivo (pulmonary tuberculosis as well as grown in vitro M

  6. LA ACCIÓN Y EL ENFOQUE PSICOSOCIAL DE LA INTERVENCIÓN EN CONTEXTOS SOCIALES: ¿PODEMOS PASAR DE LA MODA A LA PRECISIÓN TEÓRICA, EPISTEMOLÓGICA Y METODOLÓGICA?. THE ACTION AND THE PSYCHOSOCIAL APPROACH OF THE INTERVENTION IN SOCIAL CONTEXTS: CAN WE MOVE FROM THE FASHION TO THE THEORETICAL, EPISTEMOLOGICAL, AND METHODOLOGICAL PRECISION?.

    Directory of Open Access Journals (Sweden)

    Juan David Villa Gómez

    2012-12-01

    Full Text Available El siguiente artículo derivado de investigación, se plantea la pregunta en torno a una realidad que viene creciendo en Colombia: el incremento de los proyectos de intervención psicosocial en diversos sectores sociales, especialmente con víctimas del conflicto armado, violencia social, violencia de género e intrafamiliar, entre otras; además de población en situación de pobreza extrema, desplazamiento forzado y víctimas de catástrofes naturales. En relación con esta lógica de intervención y de acción, la reflexión académica aún sigue siendo escasa, poco clara y repetitiva de concepciones y disquisiciones internas de las disciplinas sociales, especialmente de la psicología. Por lo tanto, desde la experiencia de trabajo, desde la propia investigación y desde los procesos de acompañamiento psicosocial desarrollados por cerca de 15 años, el autor presenta una propuesta de reflexión, que implica una mirada desde el pensamiento crítico social y una postura que permita darle un marco a la acción psicosocial en una perspectiva emancipatoria.The following article, derived from research, poses the question about a growing issue in Colombia: the increase in projects of psychosocial intervention in diverse social sectors, particularly with victims of the armed conflict, social violence, violence of gender and family, etc., as well as population in a situation of extreme poverty, forced displacement and victims of natural disasters. In relation to this logic of intervention and action, the academic reflection tends to be scarce, unclear and repetitive of concepts and internal disquisitions of the social disciplines, especially of psychology. Therefore, from the work experience, from the research itself and from the processes of psychosocial accompaniment for about 15 years, the author presents a reflective proposal, which implies a look from the social critical thought and a stance that allows to give a framework for the psychosocial

  7. Internet Use and the Political Knowledge Gap in Spain

    Directory of Open Access Journals (Sweden)

    Anduiza, Eva

    2012-04-01

    Full Text Available Media availability and fragmentation and the resulting possibilities of content selection have risen dramatically with the expansion of new digital media. Previous research has found that this may increase knowledge gaps among citizens with different resources and motivations. This article analyses how Internet use affects political knowledge gaps due to education and to political interest in Spain. As expected, frequent Internet users are more knowledgeable about politics than non-users. Furthermore, Internet use increases knowledge more for the highly educated than for citizens with lower levels of education. Thus, the political knowledge gap related to education seems to be growing with the introduction of new media. However, the knowledge gap between citizens with high and low levels of political interest is smaller for frequent Internet users than for non-users. These findings provide a complex picture and partially contradict the pessimistic theory about the impact of increasing media choice on political knowledge.

    La disponibilidad y fragmentación de medios de comunicación y las posibilidades de elegir contenidos han aumentado en gran medida a raíz de la expansión de los medios digitales. Éstos pueden, según investigaciones anteriores, incrementar las diferencias en los niveles de conocimiento entre ciudadanos con distintas características. En este artículo se analiza cómo el uso de Internet afecta a las diferencias en el conocimiento político según el nivel educativo y el interés por la política en España. Los usuarios frecuentes de Internet saben más sobre política que los no usuarios, como era de esperar. Además, el uso de Internet incrementa el conocimiento político de manera más intensa para los usuarios con niveles educativos más elevados. Por tanto, parece que las diferencias en los niveles de conocimiento pueden estar creciendo con la expansión de los medios digitales. Sin embargo, las diferencias

  8. Compression wood in Pinus radiata II: Density and chemical composition Madera de compresión en Pinus radiata II: Densidad y compuestos químicos

    Directory of Open Access Journals (Sweden)

    J. E Díaz-vaz

    2009-01-01

    Full Text Available Ten 22 year old radiata pine trees growing in two stands in Chile, one in clay and the other in humid sand soils showing some lean, were assessed for chemical composition and wood density of compression wood. Significant differences in type of wood in density (33 kg/m³, lignin (1.944 %, alpha-cellulose (-2.634 %, ethanol toluene extractives (0.567 % and pentose (0.742 % were found between matched sample of compression and opposite woods. Differences in juvenile and mature wood were significant for both density (-4 kg/m³ and pentose (1.628 %, and site differences were found for wood density (28 kg/m³, extractives (0.978 % and apparent for alpha cellulose (1.223%. In comparison with other studies, our results suggested that the compression wood formed from trees with light visible lean corresponded to a mild compression class.Se analizó la madera de compresión en diez árboles de 22 años de edad de Pinus radiata D Don creciendo en dos sitios en Chile, uno en suelo de arena húmeda y el otro en suelo arcilloso. Singularidades de la madera de compresión y madera opuesta se compararon en estos árboles con inclinaciones menores a 10º y excentricidades reducidas. Diferencias significativas se registraron entre madera de compresión y opuesta en los valores registrados para la densidad básica de 33 (kg/m³, en proporción de lignina de 1.944 (%, en alfa-celulosa de -2.634 (%, en pentosanos de 0.742 (% y en extraíbles en etanol-tolueno de 0.978 (% y aparentemente diferente en el caso de alfa celulosa en 1.223 (%. Las diferencias entre madera juvenil y madera madura fueron significativas en los casos de la densidad de -4 (kg/m³ y en pentosanos en 1.628 (%, y diferencias entre los dos sitios para los casos de la densidad con 28 (kg/m³, en extractivos con 0.978 (% y diferencias moderadas en alfa celulosa con 1.223 (%. Las diferencias y coincidencias de estos resultados con los de otros autores se han considerado para estimar que la madera de

  9. Arbuscular Mycorrhizae-Trichoderma harzianum (Moniliaceae Interaction and Effects on Brachiaria decumbens (Poaceae’s Growth Interacción micorrizas arbusculares-Trichoderma harzianum (Moniliaceae y efectos sobre el crecimiento de Brachiaria decumbens (Poaceae

    Directory of Open Access Journals (Sweden)

    Morales Gutiérrez Esperanza

    2006-06-01

    Full Text Available The laboratory trial was made using native's Arbuscular Mycorrhizal Fungi (AMF sampled in Pennisetum clandestinum's rhizospheric soil obtained from Universidad Nacional de Colombia (Bogotá. Brachiaria decumbens was used as the host plant, growing in draining pots of steamed sandy soil supplemented with a complete nutritive solution.Four different treatments were tested to determine the kind of interaction between Arbuscular Mycorrhizal Fungi and Trichoderma harzianum and the effect of AMF plus T. harzianum on B. decumbens growth: plants with AMF inoculum, plants with T. harzianum, plants with AMF plus T. harzianum and uninoculated controls. Root colonization was decreased by T. harzianum, although AMF spores/g dry soil quantity was unaffected by this fungi. On the other hand, T. harzianum's population level (CFU /g dry soil decreased in presence of AMF. These results shows an interaction between AMF and T. harzianum and this interaction affects as AMF development as population density of T. harzianum. Based in the values of the plant growth parameters studied, is possible to conclude the AMF-T. harzianum interaction has a neutral effect on B. decumbens's growth.Se efectuó un ensayo en condiciones controladas utilizando hongos formadores de micorrizas arbusculares (HFMA nativos, provenientes de un suelo rizosférico de Pennisetum clandestinum de la Universidad Nacional de Colombia (Bogotá, manteniéndolos en plantas de Brachiaria decumbens creciendo sobre sustrato arenoso suplementado con solución nutritiva. Se evaluaron diferentes tratamientos: plantas con inóculo de HFMA, plantas con Trichoderma harzianum, plantas con HFMA+T. harzianum y plantas control no inoculadas, con el fin de determinar las posibles interacciones entre dichos microorganismos, así como su efecto sobre el crecimiento de B. decumbens. La presencia de T. harzianum disminuyó la colonización radicular por HFMA, aunque no afectó la cantidad de esporas de HFMA/g suelo

  10. Effect of citric acid and the hemihydrate amount on the properties of a calcium sulphoaluminate cement

    Directory of Open Access Journals (Sweden)

    Velazco, G.

    2014-12-01

    Full Text Available The influence of citric acid on the hydration and strength development of a calcium sulphoaluminate cement was investigated. Cement pastes were prepared by mixing calcium sulphoaluminate (C4A3Ŝ with 15, 20 and 25wt% of hemihydrate (CŜH0.5. Citric acid was added as a retarder at 0 and 0.5wt%. The samples were cured at 20 °C for periods of time from 1 to 28 days to evaluate their compressive strength and to characterize the hydration products by scanning electron microscopy and X-ray diffraction. Calorimetric curves showed that the retarding agent considerably decreases the heat release rate and the quantity of total heat released. The main product after the curing was ettringite (C6AŜ3H32. The morphology of this phase consisted of long and thin needles growing radially on the cement grains. Samples with 15wt% of hemihydrate and 0.5wt% of citric acid developed the highest compressive strength (70 MPa at 28 days of curing.Se investigó el efecto del ácido cítrico sobre la hidratación y propiedades mecánicas de un cemento de sulfoaluminato de calcio. El C4A3Ŝ se mezcló con 15, 20 y 25% e.p. de hemihidrato (CŜH0.5. Se agregó ácido cítrico como retardante en 0 y 0.5% e.p. Las muestras fueron curadas a 20 °C por periodos de 1 a 28 días para realizar mediciones de resistencia a la compresión y caracterizar los productos de hidratación mediante microscopía electrónica de barrido y difracción de rayos X. Las curvas de calorimetría mostraron ue el ácido cítrico disminuye la velocidad de liberación de calor y la cantidad de calor liberado durante la hidratación. La resistencia a la compresión alcanzó un máximo de 70 MPa en muestras con 15% e.p. de hemihidrato y 0,5% e.p de ácido cítrico. Los resultados muestran a la etringita (C6AŜ3H32 como principal producto de hidratación. Se observa a esta fase con morfología acicular creciendo sobre las partículas de cemento.

  11. Comparación de algoritmos basados en la criptografía simétrica DES, AES y 3DES

    Directory of Open Access Journals (Sweden)

    Yuri Tatiana Medina Vargas

    2015-12-01

    Full Text Available RESUMEN La seguridad es uno los aspectos más desafiantes de la internet y las aplicaciones de red. Las cuales están creciendo muy rápido, por lo que la importancia y el valor de los datos intercambiados a través de Internet u otros tipos de medios están aumentando. De ahí la búsqueda de la mejor solución para ofrecer la protección necesaria contra ataques de intrusos a nuestros datos, junto con la prestación de estos servicios en el tiempo es uno de los temas más interesantes en las comunidades relacionadas con la seguridad. La criptografía es la una de las principales categorías de la seguridad informática que convierte la información de su forma normal en un formato ilegible. Las dos características principales que identifican y diferencian algoritmo de cifrado uno de otro son su capacidad para asegurar los datos protegidos contra ataques y su velocidad y eficiencia en hacerlo. Este artículo ofrece una comparación equitativa de tres algoritmos de criptografía de clave simétrica más comunes: DES, AES y 3DES. ABSTRACT Security is one of the most challenging aspects of the internet and network applications. Which are growing very quickly, so that the importance and value of the data exchanged via the Internet or other media types are increasing. Hence the search for the best solution to provide the necessary protection against attacks by intruders to our data, together with the provision of these services in the time it is one of the most interesting topics in the communities related to security. Cryptography is the one of the major categories of computer security that converts the information from its normal form in an unreadable format the two main characteristics that identify and differentiat encryption algorithm from one another are its ability to ensure the data protected against attacks and their speed and efficiency to do so. This article provides a fair comparison of three algorithms for symmetric key cryptography

  12. La Teoría Fundamentada: un estudio bibliométrico de la enfermería brasileña The Grounded Theory: a bibliometric study of Brasilian nursing

    Directory of Open Access Journals (Sweden)

    Gabriela Marcellino de Melo Lanzoni

    2011-09-01

    Full Text Available El objetivo fue identificar las disertaciones y tesis en enfermería brasileña que usaron el método Teoría Fundamentada en Dados (TFD. Estudio bibliométrico de tesis y disertaciones de enfermería defendidas hasta 2009, disponible en: Banco de las tesis de la Coordinación de Perfeccionamiento de la Educación Superior, Colección de la Asociación Brasileña de Enfermería, Biblioteca Digital Brasileña de Tesis y Disertaciones y sitios institucionales. Para la búsqueda de los datos se utilizaron las palabras clave: "Grounded Theory" y "Teoría fundamentada" de forma individual junto a la "Enfermería". Se encontraron 124 estudios, 63 de maestría y 61 de doctorado, provenientes principalmente del sur y sureste del Brasil. El referencial teórico utilizado predominantemente fue el Interaccionismo Simbólico (71,77%. El uso de la TFD en las tesis y disertaciones de enfermería está creciendo y se demuestra que se puede aplicar en el nivel stricto senso de la formación para la elaboración de constructos teóricos.The aim of this study was to identify brazilian nursing dissertations and theses who used the methodological Grounded Theory (GT. The metodology used was bibliometric study of nursing theses and dissertations defended until 2009, available on theses database of the Coordination of Improvement of Higher Education (CAPES, the achievements of the Brazilian Nursing Association (CEPEn, the Brazilian Digital Library of Theses and Dissertations (BDTD and institutional sites. For search of the data we used the keywords: "Grounded Theory" and "Grounded Theory" coupled individually to "Nursing". We found 124 studies, 63 (50,81% of masters and 61 (49,19% of doctors, coming mainly from South and Southeast of Brazil. The theoretical framework used was predominantly Symbolic Interaction (71,77%. The use of PDT in theses and dissertations in nursing is growing and it is shown that can be applied at both levels of training in the strict sense

  13. Convertirse en madre durante la adolescencia: activación del rol materno en el control prenatal

    Directory of Open Access Journals (Sweden)

    Claudia Maria Moreno Mojica

    2015-07-01

    Full Text Available Introducción: Las adolescentes gestantes constituyen un grupo poblacional vulnerable,  con limitación en la construcción de la identidad personal frente a la materna e  imposibilidad de constitución  de una familia estable  que  afectan su calidad de vida y la del hijo por nacer. El objetivo del artículo es dar a conocer el alcance que tiene la aplicación de una estrategia de cuidado de enfermería que promovió el cuidado integral de la adolescente gestante en  la activación del rol materno durante el control prenatal. Materiales y Métodos: Este artículo es el resultado de la aplicación de una estrategia de cuidado de enfermería: programa de atención integral a la adolescente gestante durante el control prenatal, con base en la teoría de Mercer, y estructurado desde el marco lógico; la estrategia contó con la participación de diez adolescentes en gestación y el equipo interdisciplinario. Resultados: Adopción e implementación de la estrategia y apertura Institucional del centro de apoyo y cuidado para adolescentes gestantes “Creciendo Juntos”, que promovió el cuidado integral y permitió la activación del rol materno  durante el control prenatal. Discusión: El convertirse en madre adolescente, no se activa sin la influencia del cuidado estructurado brindado por enfermería quien lidera el equipo de salud, quienes permiten  a las gestantes, disminuir sus miedos, conocer y vivir el proceso de gestación y aprender las tareas para trascender hacia la activación del rol materno. Conclusiones: La Estrategia valida la visibilidad del cuidado sustentado en una teoría de enfermería, al dar respuesta a las necesidades humanas.Cómo citar este artículo: Moreno CM, Mesa NP, Pérez Z, Vargas DP. Convertirse en madre durante la adolescencia: activación del rol materno en el control prenatal. Rev Cuid. 2015; 6(2: 1041-53. http://dx.doi.org/10.15649/cuidarte.v6i2.162 

  14. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    Directory of Open Access Journals (Sweden)

    Oliva Marañón, Carlos

    2012-12-01

    Full Text Available En español: En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca “Universidad”. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institucional Audiovisual de las Universidades Públicas de la Comunidad de Madrid y verificar la idoneidad de YouTube como medio de comunicación de estas Instituciones. Oferta académica adaptada al Espacio Europeo de Educación Superior (EEES e instalaciones de vanguardia configuran las señas de identidad de estos centros. Los resultados confirman la consolidación de YouTube como canal audiovisual para la transmisión de los mensajes corporativos de estas Universidades a su público objetivo.In english: In recent years, marketing in Higher Education has been growing interest not only for its economic and commercial value but for its strategic and promotion, training and strengthening the brand communication "University". The platform YouTube has positioned itself as an audiovisual medium of reference in which the user decides what content you want to see, where and when. The objectives of this research are to analyze the audiovisual institutional advertising of the Public Universities of Madrid and verify the adequacy of YouTube as a communication from these Universities. Degrees adapted to the European Higher Education Area (EHEA and modern installations make up the identity of these Universities. The results confirm the consolidation of YouTube as a channel for transmitting audiovisual corporate messages of these Universities to their target audience.

  15. Gestión del conocimiento: mayor producción y competitividad. Perspectivas para los sistemas de producción ovino-caprinos

    Directory of Open Access Journals (Sweden)

    Óscar Ospina

    2011-12-01

    Full Text Available Los ovinos se presentan hoy día en Colombia como una de las especies promisorias para el sector pecuario, con un despertar en la actividad que se manifiesta con un incremento del inventario, que según Faostat (datos debatibles, ha pasado de 2’400.000 cabezas en el año 2000 a 3’400.000 para el 2008; por su lado, las cabras han pasado de 1’200.000 a 1’300.000 cabezas en el mismo periodo, creciendo, aunque con un ritmo menor que el de las ovejas. Según esta base de datos, la misma tendencia se observa en el consumo per cápita de carne ovino-caprina que partiendo de 270 g/persona/año para el 2000 llega a 370 g/persona/año para el 2008. Este crecimiento en el inventario y el consumo per cápita del ovino-caprino impulsa la necesidad de aprovechar no solo las ventajas comparativas, sino también la generación de ventajas competitivas que lleven a la ovino-cultura y la caprino-cultura colombiana por el camino de la competitividad y la globalización, aprovechando las oportunidades en el mercado nacional y de exportación. El eficaz aprovechamiento de dichas ventajas implica la incorporación de los datos, la información y el conocimiento como factores de producción dentro de un proceso ordenado, bajo el marco de un sistema de “gestión de conocimiento”. El presente documento trata los fundamentos teóricos sobre los cuales se discute la manera como los datos, la información y el conocimiento se transforman en productividad y competitividad; se tratan los temas del “Big-Bang”, la entropía y neguentropía, la complejidad, la teoría de sistemas, la teoría del conocimiento, la epistemología, el management, la economía del conocimiento, la planeación estratégica, la espiral del conocimiento en las organizaciones, y la gestión del conocimiento, procurando algunas aproximaciones al sector agropecuario y la contextualización de la gestión del conocimiento en la ovino-cultura y caprino-cultura colombiana.

  16. Enfrentando la ausencia de los padres: recursos psicosociales y construcción de bienestar

    Directory of Open Access Journals (Sweden)

    Diana Marcela Montoya Zuluaga

    2016-01-01

    Full Text Available De acuerdo con los resultados de la encuesta de Profamilia (2010 y del Mapa Mundial de la Familia (Trends, 2013 los niños y jóvenes están creciendo con la ausencia física de alguno de los padres y algunos, a pesar de la presencia física de ellos, experimentan sentimientos de ausencia, pues al parecer han cambiado las formas de acompañamiento. Se hace necesario indagar por los recursos alternativos a la familia con los que están contando las nuevas generaciones, con el fin de ofrecer otras posibilidades desde lo social, institucional, personal, familiar, comunitario, que permita la construcción de bienestar en las personas. El objetivo del presente artículo de revisión es mostrar las diferentes investigaciones de los últimos diez años relacionadas con recursos psicosociales, bienestar subjetivo y sentimientos de ausencia. La metodología utilizada fue el rastreo de fuentes bibliográficas producto de investigación y de revisión teórica. Los resultados revelan que las personas cuentan con instituciones, grupos, comunidades y recursos internos que les permiten construir un proyecto de vida que genere bienestar. Abstract According to the results found on the Profamilia survey (2010 and the World Family Map (Trends, 2013, children and young people are growing with the physical absence of either of their parents and some, in spite of their physical presence, experience feelings of absence, since it seems that forms of accompaniment have changed. It has become necessary to look into the resources, alternative to the family, new generations draw on, so that social, institutional, personal, family, and community options are available for the building of well-being among people. The purpose of the present revision paper is to show different studies carried out in the last ten years, which are related to psychosocial resources, subjective well-being and feelings of absence. The methodology used was the tracking of bibliographical references

  17. Construcción sostenible y madera: realidades, mitos y oportunidades

    Directory of Open Access Journals (Sweden)

    Rolando Fournier Zepeda

    2008-04-01

    Full Text Available La construcción biológica sostenible se basa en el estudio de las interrelaciones entre el ser humano, el ambiente construido y su entorno. Es una filosofía de construcción que busca edificar espacios saludables, mejorar la calidad de vida, preservar la especie humana y el ambiente, conceptualizando la vivienda como nuestra tercera piel.La bioarquitectura tiene como propósito promover el estudio de materiales, elementos, componentes de construcción, viviendas y edificios que propicien el desarrollo, mejoramiento y uso de materiales compatibles con la vida, frente a otros que no lo son tanto.El avance de la tecnología y la versatilidad de los materiales, especialmente de la gama de plásticos, concreto y acero, ha hecho posible que los sistemas de construcción hayan variado mucho en pocas décadas.La disminución del uso de la madera no ha sido ajena a este hecho. Se ha olvidado casipor completo el conocimiento tradicional acerca de su uso, dando por consecuenciasu desprestigio.La madera es el material más noble, renovable, sano, sostenible, estético y confortable de la construcción. Prácticamente todas las culturas de la humanidad la han empleado en sus obrasconstructivas. En la medida en que la sensibilidad proteccionista de los bosques autóctonos y en especial, de los tropicales, vaya creciendo, también la industria de la madera irá tomando el tren de la tecnología, adaptándose a los nuevos tiempos. El conocimiento de la madera y el desarrollo de su tecnología en los aspectos de plantación, secado, técnicas de tratamiento y transformación permitirán garantizar el éxito de su utilización en el Sector de la Construcción, lo que la convertirá a corto plazo en el material del futuro. La madera es un material paradigmático en cuanto a su adecuación a los objetivos del respeto al medio ambiente.

  18. Variabilidad genética y morfológica y estructuración poblacional en Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endémica de Chile Genetic and morphological variation and population structure in Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endemic to Chile

    Directory of Open Access Journals (Sweden)

    EDUARDO RUIZ

    2010-12-01

    Full Text Available El género Alstroemeria es exclusivamente sudamericano y consta de 82 taxa distribuyéndose, principalmente en Chile y Brasil. La gran importancia económica que han adquirido las Alstroemerias chilenas como plantas ornamentales ha despertado gran interés en la variabilidad morfológica de las flores y variabilidad genética en especies con potencial valor económico. Una de ellas es Alstroemeria hookeri que posee cuatro subespecies, de las cuales, la subespecie tipo, es endémica de las regiones del Maule y Biobio. Su distribución geográfica consiste de dos rangos, separados por la Cordillera de la Costa. Así, existen poblaciones costeras, creciendo, entre los 5-20 m de altura en las provincias de Arauco, Concepción, Nuble y Cauquenes y poblaciones del interior creciendo entre los 100-150 m de altura, en las provincias de Biobio y Nuble. Evidencias preliminares señalan diferencias fenotípicas entre poblaciones costeras y del interior, relacionadas con el color y forma de los tépalos. Por esta razón, se realizó un estudio morfológico comparativo en el rango completo de distribución de esta subespecie y estudiar su genética poblacional, especialmente los niveles de estructuración poblacional. Se analizaron 33 caracteres florales, mediante métodos de ordenación. El estudio morfológico indica una tendencia a separar las poblaciones en dos grupos, coincidiendo con los extremos de la variación morfológica y con ambos rangos de distribución, existiendo caracteres que aportan a ello. Los índices de variabilidad genética fueron determinados usando 17 loci aloenzimáticos. Además, se estimaron los valores de estructuración poblacional y se realizó un análisis de AMOVA. Se estimaron valores de distancia genética de Nei, entre todos los pares de poblaciones para construir un dendrograma que refleje las relaciones de similitud genética. Los resultados indican altos valores de estructuración entre poblaciones y baja variabilidad

  19. Selected Abstracts of the 10th International Workshop on Neonatology; Cagliari (Italy; October 22-25, 2014

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2014-06-01

    (Italy ABS 9. Traffiking of thymosin beta-4 in the cellular compartments of HepG2 cells at different conditions • M. Piras, M. Piludu, G. Pichiri, P. Coni, T. Cabras, R. Ambu, M. Castagnola; Cagliari and Rome (Italy ABS 10. Thyroid carcinoma in sardinian children and adolescents is often associated with autoimmune thyroiditis • P. Coni, E. Tamponi, A. Lampis, G. Pinna, A.M. Nurchi, S. Farci, M.L. Lai; Cagliari (Italy ABS 11. Prolonging nephrogenesis in preterm infants: a new approach for the prevention of renal disease in adulthood? • A. Sanna, C. Gerosa, D. Fanni, P. Van Eyken, M. Castagnola, R. Ambu; Cagliari, Rome (Italy and Leuven (Belgium ABS 12. Human adrenal gland development: morphogenesis and molecular mechanisms • E. Obinu, V. Fanos, A. Dessì, R. Ambu; Cagliari (Italy ABS 13. Biometrics application for newborns safe identification in Neonatal Intensive Care Units • A. Casanova, S. Barra, M. De Marsico, D. Riccio, L. Barberini, M. Puddu, V. Fanos; Cagliari, Rome and Naples (Italy ABS 14. Metabolomics in neonatal hypoxic-ischemic encephalopathy (HIE: a proposal for a european multicenter study • P. Gancia, G. Pomero, A. Delogu, C. Dalmazzo, G. Palmas, V. Fanos; Cuneo and Cagliari (Italy ABS 15. Longitudinal evaluation of myocardial function in infants with Hypoxic-Ischemic Encephalopathy (HIE: preliminary data • F. Vitali, S. Galletti, A. Aceti, L. Ridolfi, G. Aquilano, M. Fabi, G. Faldella; Bologna (Italy ABS 16. Changes in podocyte number during intrauterine development • M. Desogus, A. Crobe, A. Sanna, C. Gerosa, C. Fanni, C. Loddo, M. Puddu, G. Ottonello, D. Fanni; Cagliari (Italy ABS 17. Efficacy of recombinant human erythropoietin in anemic pregnant women with heterozygous beta-thalassemia • S. Angioni, V. Mais, G.B. Melis; Cagliari (Italy ABS 18. WT1 expression in ontogenesis of human fetus • R. Ambu, L. Vinci, C. Gerosa, D. Fanni, E. Obinu, A. Faa, V. Fanos; Cagliari (Italy ABS 19. Brain hypothermia in perinatal arterial ischemic

  20. Conceptual rainfall-runoff model with limited and low quality data in the Pirai River basin, Bolivia

    Science.gov (United States)

    Gonzalez-Sanchez, Alvaro; Villazon, Mauricio; Willems, Patrick

    2010-05-01

    In zones where limited data to apply a distributed hydrological model is available, a combination of lumped conceptual models with channel routing may be a useful tool in the support system for catchment planning. In this approach the whole basin is divided into sub basins, and for each sub basin a lumped conceptual model is built-up. In the present case study the lumped model is NAM and the GIS environment is performed by MIKE BASIN which introduces the hydrological modeling tools into ArcGIS 9.2. Therefore in the Bolivian Amazon, specifically in the Piraí river basin, a confluent of the Amazon River, the MIKE BASIN has been applied for the hydrologic modeling of the gauged sub catchments at daily basis starting in January, 1st 1987 to December 31st 1995. Nevertheless, due to the low quality data, routines in the data have been executed first. The temperature-based methods proposed by Thornthwaite and Hargraves-Samani have been calibrated to local conditions for the evaluation of the reference evapotranspiration (ETo). A rating curve analysis has also been performed in order to complete the discharge series and to correct clearly identifiable errors. SEARPI (River Flood Channeling and Control Service) has been the main source for the data base, it consisted of hourly time series of precipitation for 16 stations and daily time series for 25 stations, 3 weather stations with full climatic data, 6 weather stations with only mean daily temperature values and hourly records of water levels for 4 gauging stations. In general, Hargreaves yields to a more real ETo comparing with the FAO56 than the Thornthwaite method, and could be to the inclusion of the thermal amplitude. However, the aerodynamic factors cannot be fully approximated by the thermal amplitude as it is the case of Viru Viru station. Calculating the maximum and minimum temperature based on other stations may lead to extra uncertainty, taking into account the local range of the mean temperature and latitude

  1. New exposure ages for the Last Glacial Cycle in the Sanabria Lake region (northwestern Spain)

    Science.gov (United States)

    Rodríguez-Rodríguez, Laura; Jiménez-Sánchez, Montserrat; Domínguez-Cuesta, María Jose; Rinterknecht, Vincent; Pallàs, Raimon; Braucher, Régis; Bourlès, Didier; Valero-Garcés, Blas

    2013-04-01

    ., 2011. Last deglaciation in northwestern Spain: New chronological and geomorphologic evidence from the Sanabria region. Geomorphology 135, 48-65. Palacios, D., Andrés, N., Úbeda, J., Alcalá, J., Marcos, J., Vázquez-Selem, L., 2012. The importance of poligenic moraines in the paleoclimatic interpretation from cosmogenic dating. Geophysical Research Abstracts 14, EGU2012-3759-1. Pérez-Alberti, A., Valcárcel-Díaz, M., Martini, I.P., Pascucci, V., Andrucci, S., 2011. Upper Pleistocene glacial valley-junction sediments at Pias, Trevinca Mountains, NW Spain. In: Martini, I.P., French, H.M., Pérez-Alberti, A. (Eds.), Ice-Marginal and Periglacial Processes and Sediments. Geological Society (London) Special Publication 354, pp. 93-110. Research funded by the projects LIMNOCLIBER (REN2003-09130-C02-02), IBERLIMNO (CGL2005-20236-E/CLI), LIMNOCAL (CGL2006-13327-C04-01) and GRACCIE (CSD2007-00067) of the Spanish Inter-Ministry Commission of Science and Technology (CICYT). Additional funding was provided by the Fundación Patrimonio Natural de Castilla y León through the project "La investigacion en el Lago de Sanabria dentro del proyecto CALIBRE: perspectivas y posibilidades", and by the projects Consolider Ingenio 2006 (CSD2006-0041, Topo-Iberia), 2003 PIRA 00256, HF02.4, and RISKNAT (2009SGR520). L. Rodríguez-Rodríguez has developed her research under a Severo Ochoa Programme fellowship (FICYT- Asturias).

  2. Evaluación y modelización hidrológica para el diagnóstico de “desastres naturales”

    Directory of Open Access Journals (Sweden)

    Pla Sentís Ildefonso

    2012-05-01

    Full Text Available La degradación de suelos afecta negativamente sus funciones como base de la producción de alimentos, de la regulación del ciclo hidrológico y de la calidad ambiental. Está creciendo en todo el mundo, en parte debido a faltas o deficiencias en las evaluaciones de los procesos y causas de dicha degradación en cada situación específica. Los procesos de degradación física de suelos se manifiestan a través de problemas de compactación, sellado, encostrado, escorrentía, erosión hídrica y eólica, movimientos en masa, etc., con efectos colaterales "in situ" y a distancia, a menudo con consecuencias desastrosas como inundaciones, deslizamientos de tierra, sedimentaciones, sequías, etc. Estos procesos están frecuentemente asociados a cambios desfavorables en los procesos hidrológicos responsables del balance de agua y régimen hídrico de los suelos, derivados principalmente de cambios en el uso y manejo de las tierras y de cambios climáticos. La evaluación de dichos procesos bajo diferentes escenarios de cambios de clima, propiedades de los suelos y uso y manejo de las tierras con el uso de modelos de simulación sencillos y flexibles, basados en procesos hidrológicos, permitiría predecir su desarrollo, y con ello, la selección y aplicación de prácticas apropiadas de conservación de suelos para eliminar o moderar sus efectos. Estos modelos requieren, como base, información adecuada sobre clima y propiedades hidrológicas de los suelos. A pesar de que existen metodologías y equipos comerciales cada vez más sofisticados y "precisos" para medir las diferentes propiedades físicas e hidrológicas de los suelos relacionados con los procesos de degradación, la mayoría de ellos solo son aplicables bajo condiciones de laboratorio y en suelos y condiciones muy particulares. A menudo se utilizan métodos indirectos, basados en relaciones o índices empíricos sin una adecuada validación, que frecuentemente conducen a costosos

  3. INCENDIARIOS "Es preferible morir por el fuego, en combate, que morir en casa, por el hambre: Fidel Castro" Arson

    Directory of Open Access Journals (Sweden)

    Lisieux Elaine de BorbaTelles

    2012-09-01

    Full Text Available Antecedentes. El concepto de fuego siempre ha atraído la atención del hombre. En la literatura abundan referencias a este término, que tanto puede representar poder y pasión como terror y destrucción. El incendio es un delito de fácil ejecución, pero de difícil investigación. La prevalencia de este delito es de 1,13%. La incidencia de este crimen está creciendo alrededor del mundo, provocando un impacto social importante por las pérdidas financieras, muertes, lesiones físicas y secuelas emocionales dejadas en sus víctimas. El comportamiento incendiario puede ser observado desde la infancia, siendo que cerca de la mitad de los individuos presos por incendios se encuentran en la adolescencia. El consumo de alcohol está asociado a la conducta incendiaria, en la mitad de individuos que cometieron tal delito motivados por venganza. Objetivo. Revisar los estudios más recientes sobre el perfil de los incendiarios, las características diagnósticas, los factores de riesgo, la neurobiología, el tratamiento, la reincidencia y el pronóstico. Material y métodos. Revisión de la literatura. En la revisión de la literatura se encuentran que los incendiarios son una categoría heterogénea de criminales. Se torna interesante el desarrollo de una clasificación para los mismos, considerando las características del agresor, la presencia de eventual enfermedad mental, los aspectos del crimen y las motivaciones. Conclusión. Hasta el presente, la población de incendiarios estudiada es subrepresentada, pues apenas un pequeño porcentaje es enviado para evaluación diagnóstica y tratamiento. Se expone, así, una incongruencia entre los grandes daños emocionales y financieros, causadas por este delito, y la atención que él recibe de la comunidad científica.Background. The concept of fire has always attracted human attention. There are abundant references to the term in worldwide literature, representing power and passion as well as terror

  4. Trabajo de Tesis Presentado a la Facultad Nacional de Agronomía de Medellín como Requisito Parcial para Optar al Título de Ingeniero Agrónomo.

    Directory of Open Access Journals (Sweden)

    Facultad Nacional de Agronomía Universidad Nacional de Colombia

    1956-12-01

    Full Text Available El propósito del presente estudio es obtener información acerca de la forma de heredarse la reacción a la roya amarilla, en el estado de planta madura, con particular referencia a la naturaleza genética de las variedades progenitoras. El presente estudio de planta adulta, bajo condiciones de campo, debido a la ausencia de invernadero adecuado, en donde se pueda regular la temperatura a las variantes biológicas en cuestión. Se relieva la importancia ecinomia de la roya amarilla del trigo en nuestro medio, en donde cauca serias pérdidas en el rendimiento y calidad del grano, especialmente en la variedad regional Bola Picota, constituyendo así la enfermedad más peligrosa en las zonas trigueras de Cundinamarca, Boyacá y Nariño. El objeto del presente estudio es determinar la herencia de la resistencia de la planta madura a Puccinia glumarum, por medio del estudio de la progenie híbrida F2 y F3 de dos cruces. Es importante en todo programa de mejoramiento de la planta conocer el comportamiento genético del material usado, de acuerdo con las condiciones ambientales y con la virulencia de las razas patogénicas, del medio en que se trabaja. La revisión de literatura que hace referencia a los factores que influyen en la herencia de la resistencia, ofrece datos muy disímiles, a veces opuestos, de acuerdo con las regiones, variedades empleadas y especialización fisiológica del patógeno. Se emplean dos fuentes de resistencia a p. glumarum, a saber: variedad Frontana procedente de Brasil, y Chinese 166, variedad de la China; las cuales se han comportado en nuestro medio, desde altamente resistente hasta inmune, a través de todos los años. Se cruzan con las variedades susceptibles Supremo 211 de México, y Timstein de Australia, en 1950-B; creciendo la F1 en 1951-A. La generación segregante F2 es observaday analizada durante 3 fechas de siembra, con replicaciones en la Granja de La Picota y Tibaitatá. La generación F3 se

  5. El transporte urbano entre la globalización y la fragmentación: El caso de la Región Metropolitana de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Susana Kralich

    1998-03-01

    Full Text Available Con la consolidación del capitalismo avanzado se deslocalizan las cadenas productivas, a la par que se internacionalizan los oligopolios del capital. Ellos florecen en el mundo subdesarrollado estimulados por la suburbanización, las políticas de ajuste, la flexibilización laboral, el desempleo, la privatización y desregulación de los servicios públicos, la hegemonía de las leyes de mercado y la gradual desaparición de la concepción keynesiana del Estado, exacerbándose la segregación y la exclusión y creciendo la violencia urbana hasta límites impensados. La concentración demográfica intensifica y complejiza las demandas, en especial las de transporte, complicándose la gestión de los servicios y dificultándose la compatibilización de intereses contradictorios. Puja en la cual indefectiblemente se ven perjudicadas las crecientes franjas de menores recursos, profundizándose las inequidades propias del modelo, cuyo resultado son ciudades cada vez más dualizadas. En este marco, la gestión de servicios urbanos requiere ser repensada y rediseñada, particularmente en las grandes aglomeraciones, ya que aparece cada vez como más acuciante la resolución de la pluralidad y superposición de administraciones que funcionan fragmentadas, dispersando la responsabilidad sobre los problemas integrales a afrontar. Tal el caso de la Región Metropolitana de Buenos Aires (RMBA, a la que nos referiremos enfocando la cuestión relativa a la gestión del transporte urbanoWith the consolidation of the advanced capitalism, the productive chains are dislocalizated, as well as the internacionalization of the capital oligopolies. They blossom in the underdeveloped world, stimulated by the suburbanization, the adjustment policies, the occupational flexibilization, the unemployment, the privatization and the desregulation of the public services, the hegemony of the market laws and the gradual disappearance of the Welfare State. All items previously

  6. Let others manufacture! Towards a new manufacturing framework ¡Qué fabriquen ellos! Hacia un nuevo modelo productivo

    Directory of Open Access Journals (Sweden)

    Carlos Rodriguez Monroy

    2009-11-01

    salida, flexibilidad geográfica, bajos costes, difusión tecnológica en la red muy rápida, alta diversificación a través de los fabricantes subcontratados y excepcionales economías de escala. Este trabajo propone un modelo teórico que analizará las causas de la formación de estas redes incluyendo sus cuatro pilares básicos: estrategia, estructura, dinámica y cultura. Para ello, se tendrán en cuenta aspectos como las alianzas estratégicas entre empresas competidoras, la naturaleza permeable y difusa de los actores de la red y el riesgo de canibalizaciones de roles, la paradoja inherente de colaborar con competidores, los aspectos culturales a nivel sistémico o las tecnologías de información y comunicación a nivel de red. El modelo teórico propuesto permitirá conocer de una manera ordenada, todos los aspectos relevantes de este tipo de redes para esclarecer y dar perspectiva a uno de los tipos de organizaciones que más ha creciendo en los últimos años.

  7. Ecoanatomía foliar deárboles y arbustos delos distritos chaqueños occidental y serrano (Argentina Leaf ecoanatomy of trees and shrubs from Chacoan Occidental and Serrano Districts (Argentina

    Directory of Open Access Journals (Sweden)

    Ana M Arambarri

    2011-12-01

    Full Text Available El objetivo de este trabajo fue evaluar parámetros micrográficos foliares que permitan comprender mejor la relación planta-ambiente y contribuyan al desarrollo de nuevas tecnologías para el aprovechamiento sustentable y conservación de los bosques de esta región. Se empleó material de hoja de ejemplares recolectados en la región subtropical seca de la provincia chaqueña y material fresco de especies creciendo en zona templado-húmeda para comparar las variaciones de la estructura foliar. Se determinaron densidades por mm-2 de células epidérmicas, estomas y tricomas, tipos de mesofilo y tipo y distribución de los tejidos vascular y de sostén. Se encontró que estos caracteres anatómicos de la hoja son influenciados por una combinación de factores intraespecíficos y del ambiente. Los caracteres xeromórficos puestos de manifiesto fueron: presencia de ceras epicuticulares, estrías cuticulares, estomas hundidos con reborde peristomático, de epidermis bistrata o pluristrata y/o de hipodermis, mesofilo en empalizada o isolateral y abundante esclerénquima. Algunas especies tales como: Celtis ehrenbergiana, C. iguanaea, Jodina rhombifolia, Lycium cestroides y Parkinsonia aculeata, muestran desde caracteres xeromórficos (e.g. hojas anfistomáticas, equifaciales hasta caracteres mesomórficos (e.g. hojas hipostomáticas, bifaciales incluyendo algunos hidromórficos como la ausencia de esclerénquima.The objective of this work was to evaluate foliar micrographic parameters to deepen our understanding of the plant-environment relationships, contributing to new technologies to preserve the forests of this area. Leaf material of specimens collected in chacoan biogeographic province with subtropical and dry climatic conditions, and from species growing in template and humid conditions were studied to compare leaf structure variations. Epidermal cells, stomata and trichomes by unit of area (mm-2, types of mesophyll, sclerenchymatic tissue

  8. La vegetación como indicador de la Geomorfología Fluvial

    Directory of Open Access Journals (Sweden)

    Juan José Neiff

    2010-04-01

    Full Text Available Aguas abajo de la confluencia con el río Paraguay, el Paraná se expande en una ancha planicie lateral que, durante las inundaciones extraordinarias completa un área 2-10 veces mayor que el área ocupada por las aguas en los períodos de bajantes extraordinarias, en los que el curso queda aislado de la planicie inundable. El propósito de esta contribución es presentar las características más salientes de este tramo entrelazado del río, usando las unidades de paisaje y los tipos de vegetación, como indicadores de las formas del relieve. Imágenes satelitales Landsat TM5 y TM7 procesadas con el SIG IDRISI, de la inundación extrema de 1998 y de la sequía extrema de 2001, fueron usadas para la clasificación de los tipos de vegetación, usando el criterio propuesto por CET (Clasificación Ecológica de Tierras. Observaciones de campo fueron realizadas en ambas fases hidrológicas para obtener la posición topográfica de las unidades de vegetación y de los ensambles de comunidades vegetales. Nosotros encontramos que los albardones están ocupados por tipos de bosques, mientras que los bañados y cuerpos de aguas someros están cubiertos por plantas herbáceas y que las praderas flotantes de vegetación flotante libre, como el aguapé, crecen en lagos conectados al río una o más veces en el año. La vegetación acuática del curso principal es muy pobre como consecuencia del flujo del río y las fluctuaciones de nivel del agua. Sólo pequeñas manchas de carrizo se encontraron creciendo en barras de arena. La interrelación entre la vegetación y las formas del relieve es muy dinámica, con cambios drásticos en períodos de décadas o aún de pocos años, dependiendo del caudal y de la carga de sólidos transportados. En otro sentido, la vegetación fluvial tiene un importante rol en la fijación de depósitos fluviales y como núcleos de acreción en las barras o para entender la obstrucción de pequeños cursos de agua en la planicie

  9. Evaluation of the ORYZA2000 Rice Growth Model under Nitrogen-Limited Conditions in an Irrigated Mediterranean Environment Evaluación del Modelo de Crecimiento de Arroz ORYZA2000 bajo Condiciones Limitadas de Nitrógeno en un Ambiente Mediterráneo Regado

    Directory of Open Access Journals (Sweden)

    Pamela Artacho

    2011-03-01

    Full Text Available ORYZA2000 is a growth model for tropical lowland rice ( Oryza sativa L. developed by the International Rice Research Institute and Wageningen University. This model has been evaluated extensively in a wide range of environments. However, reports examining japonica cultivars growing in temperate climates are scarce. In this study, ORYZA2000 was calibrated and evaluated using data from experiments carried out in the South-Central area of Chile. These experiments were performed on a japonica rice cultivar growing under an irrigated Mediterranean environment at various N rates. ORYZA2000 was then applied to explore potential yield and grain yield response to N fertilization under likely weather conditions in the major rice-producing area in Chile. ORYZA2000 was sufficiently accurate to simulate grain yield and crop N uptake at the end of the season. Final crop N uptake was simulated with a root mean squared error (RMSE of 20 kg ha-1 (15% and grain yield with a RMSE of 1666 kg ha-1 (19%. However, the prediction of biomass and N uptake of individual organs throughout the season was poor. A long-term simulation study confirmed a potential yield as high as 12 000 kg ha-1 in the Parral area, as well as the existence of a scope for yield increase. The yield response to N fertilization was predicted even at rates of 300 kg ha-1, although a significant probability of low yields was also observed. This trend supports the need to incorporate dynamic N management in Chilean rice production.ORYZA2000 es un modelo para arroz tropical regado desarrollado por el Instituto Internacional de Investigación en Arroz y Universidad de Wageningen, que ha sido evaluado en un amplio rango de ambientes. Sin embargo, los reportes para cultivares japónica creciendo en ambientes templados son escasos. En este estudio, ORYZA2000 fue calibrado y evaluado usando datos de experimentos realizados en el centro-sur de Chile, que incluyeron una variedad japónica cultivada bajo un

  10. Estimación de impacto paisajístico de las carreteras

    Directory of Open Access Journals (Sweden)

    Cañas Guerrero, Igancio

    1993-08-01

    Full Text Available Perhaps one of the most important ways in which public opinion knows the landscape is through roads. The 325,000 km of roads in Spain are of great importance since they are used by 16.5 million vehicles. It seems that this importance will continue to grow in the years to come. This process goes together with the increasing sensitivity of the population where environmental issues are concerned. For this reason we constantly face confrontations between the development and the nature preservation. We believe it possible to reduce these conflicts by identifying the most problematic areas and the possible solutions in the initial stages of planning and design. In the road - landscape relation the importance of landscape studies is obvious since one of the aspects the public opinion values most directly is the integration of the road in the landscape. The aim of this paper is precisely to identify the principal stages in the analysis of the landscape issue in road projects. This is not a thorough description but a comment of various steps to be taken in the estimation of the impact on landscape which can serve as the starting point to be developed further in different projects.

    Quizá uno de ¡os medios más importantes por los cuales la opinión pública conoce el paisaje sea a través de la carretera. En España tenemos más de 325.000 km de carreteras que son utilizadas por 16,5 millones de vehículos, su interés es pues grande. Esta importancia parece que en los próximos años seguirá creciendo. Este proceso va unido a una sensibilidad cada vez mayor por parte de la población con los temas medioambientales. Esto da lugar a que nos encontremos con enfrentamientos crecientes entre el desarrollo y la conservación de la naturaleza. Estos conflictos pensamos que pueden reducirse, si ya en las primeras etapas de la planificación y diseño se identifican las áreas más problemáticas y sus posibles soluciones. Dentro de la relaci

  11. Identificación y sitios de acumulación de sustancias ergásticas en tallos de Cuphea Glutinosa (Lythraceae: Variaciones debidas a la madurez y al ambiente Identification and accumulation sites of ergastic substances in Cuphea glutinosa (Lythraceae stems: Variations due to maturity and environment

    Directory of Open Access Journals (Sweden)

    Ana C. Martínez Tosto

    2009-12-01

    Full Text Available Cuphea glutinosa Cham. et Schltdt. es una especie ampliamente distribuida en América templada, presente en las sierras bonaerenses, potencialmente importante desde el punto de vista industrial y medicinal. El presente trabajo tiene por objeto determinar las sustancias ergásticas presentes en los tallos, los sitios de acumulación de las mismas y las características anatómicas de tallos maduros y jóvenes de plantas creciendo en diferentes condiciones de humedad y luz. Se muestrearon tallos jóvenes y maduros de plantas de Sierra Bachicha, Sierra de los Padres y Sierra de los Difuntos. Se realizaron cortes a mano alzada para el estudio de la anatomía del tallo y la aplicación de test histoquímicos para identificar almidón, grasas-aceites, mucílago y taninos. Se confirma la presencia de grasas-aceites y mucílagos en células de los pelos glandulares y gotas exudadas; amiloplastos y taninos en distintos tejidos. Los tallos jóvenes provenientes de suelos húmedos presentan mayor cantidad de drusas que aquellos de suelos secos, mientras que los tallos adultos de suelos húmedos, mayor cantidad de amiloplastos que aquellos de suelos secos. Los tallos adultos, especialmente aquellos de suelos húmedos presentan mayor abundancia de taninos. Las diferencias estructurales halladas, tanto en tallos jóvenes como en adultos pueden ser atribuidas a las diferentes condiciones ambientales que afectan los sitios individuales de crecimiento.Cuphea glutinosa Cham. et Schltdl. is widely distributed in temperate areas of America, present in the southeast sierras of Buenos Aires Province, and potentially important from industrial and medicinal points of view. The aim of this work was to determine the accumulation sites of ergastic substances and the anatomical characteristics of mature and young stem of plants growing at different conditions of water and light. Mature and young stems of plants from Sierra Bachicha, Sierra de los Padres and Sierra de los

  12. Pistillate Flower Abcission Symptoms of ‘Serr’ Walnut (Juglans RegiaL. Sintomatología del Aborto en flores Pistiladas de Nogal (Juglans regiaL. ‘Serr’

    Directory of Open Access Journals (Sweden)

    Cristián González R

    2008-06-01

    observación en microscopio óptico, utilizando como tinción azul de toluidina-O al 0,05%. La flor abortada por exceso de polen se deterioró rápidamente, presentó detención del crecimiento, pérdida del brillo del involucro y stigmatic necrosis. La flor abortada por falta de polinización mostró un deterioro lento que se prolongó dos semanas más que la abortada por exceso de polen. La flor cuajada siguió creciendo, sin perder su brillo. La flor abortada por exceso de polen puede caer con o sin pedúnculo adherido. Se pueden presentar dos zonas de separación: zona distal y zona proximal del pedúnculo. La cicatriz en el pedúnculo permite diferenciar el aborto por exceso de polen, falta de polen y por otras razones.

  13. Les états du roi des Ponts et Chaussées pendant l’administration des Trudaine : 1743-1777

    Directory of Open Access Journals (Sweden)

    Stéphane Blond

    2012-01-01

    Full Text Available Au cours du XVIIIe siècle, l’importante stabilité en poste des intendants des finances Trudaine rend possible l’examen, sur une longue période, des procédures comptables et des contrôles financiers au sein du département administratif des Ponts et Chaussées. Alors que le budget consacré à cette administration ne cesse de croitre, l’analyse de la correspondance entre les Trudaine et plusieurs intendants de généralités permet d’étudier la confection des états du roi et les différentes étapes de vérification/validation des opérations financières. Cet article aborde aussi la présentation des comptes financiers, les modes de calculs et les modalités de distribution des enveloppes budgétaires en fonction des généralités et des domaines d’activité.During 18th century, the administrative stability of intendants des finances Trudaine makes possible a precise description of financial procedures and controls, especially for the Department of Ponts et Chaussées. The budget of this administration knows an important growth, and the analysis of the correspondence between Trudaine and various intendants of province, allows to study the preparation of countable documents. This paper also examines the material presentation of financial documents and the distribution of the budget between each field of activity.Es posible hacer un estudio a mediano plazo de los procedimientos contables y los controles financieros en el seno del departamento de Ponts et Chaussées en el siglo XVIII, dado que los intendentes de Hacienda Trudaine permanecen mucho tiempo en su empleo. El análisis de la correspondencia entre los Trudaine y varios intendentes de généralités permite estudiar la preparación de los états du roi, los libros contables que describen la distribución prevista de los fondos de este departamento en cada provincia, en una época en que estos fondos van creciendo. Asimismo, se pueden estudiar las etapas de verificación y

  14. Tendencias de la mortalidad por cáncer de mama en México, 1980-2009 Breast cancer mortality trends in Mexico, 1980-2009

    Directory of Open Access Journals (Sweden)

    Elvia de la Vara-Salazar

    2011-10-01

    Full Text Available El cáncer de mama ha trascendido como un importante riesgo para la salud de las mujeres a escala mundial. Las muertes por cáncer de mama han tenido un destacado incremento dentro de los tumores malignos a nivel mundial al cobrar más de 460 000 vidas en 2008, convirtiéndolo en el padecimiento con más decesos alrededor del mundo.Los cambios demográficos y en estilos de vida han modificado la exposición de la población al riesgo de enfermedades como el cáncer,y desde 1980la mortalidad porcáncerdemama ha mantenido una tendencia ascendente,ubicándose por encima de las muertes por cáncer cervicouterino desde 2006. Al analizar las tasas de mortalidad en las mujeres mexicanas de 25 años de edad en adelante a lo largo de 30 años, se distinguen diferencias estatales y por grupos de edad. Aun cuando el perfil de esta causa de muerte se ha asociado con un mayor desarrollo regional, en este trabajo se puede observar que están ocurriendo cambios y las muertes también están creciendo en la población de mujeres de regiones y entidades menos desarrolladas.Queda de manifiesto el reto que México enfrenta, y la necesidad de conjuntar esfuerzos e implementar programas para educar a la población hacia el autocuidado de la salud, así como promover estilos de vida saludables, además de mejorar la infraestructura diagnóstica para lograr una detección a tiempo y garantizar un tratamiento adecuado.Breast cancer has become an important health risk for women worldwide.The important growth of breast cancer-related deaths within those caused by malign tumors throughout the globe went past the 460 000 in 2008,becoming the deadliest disease worldwide.Demographic changes and lifestyles have modified the population exposure to risk factors of maladies such as cancer, and since 1980 breast cancer mortality has remained on an upward tendency,surpassing cervical cancer in 2006. After analyzing mortality rates along 30 years in Mexican women 25 or more years

  15. Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps con características probióticas y potencial en la degradación del pasto

    Directory of Open Access Journals (Sweden)

    Cecilia Lara Mantilla

    2013-06-01

    Full Text Available Título corto: Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps  Título en ingles:  Cellulolytic bacteria isolated from  termites’ gut (Nasutitermes nigriceps with probiotic characteristics and potential pasture degradationResumen: El objetivo de la presente investigación fue aislar bacterias celulolíticas del intestino de termitas (Nasutitermes nigriceps para determinar sus propiedades probióticas in vitro y su potencial en la degradación de pasto. Las termitas fueron tratadas con detergente antibacterial, separando y macerando luego, el intestino de las mismas en agua peptonada estéril. Diluciones de esta mezcla fueron inoculadas en cajas Petri con medio Luria Bertani (LB y Carboximetilcelulosa (CMC al 2%, incubando a 37º C por 24 horas, para luego revelar con Rojo Congo al 1%. Las bacterias que presentaron mayores halos de degradación fueron sometidas a tinción de Gram y a pruebas probióticas de temperatura, pH, salinidad y presencia de sales biliares, así como también a pruebas de antagonismo y degradación de pasto. Los resultados revelaron la presencia de 9 bacilos celulolíticos Gram (- de los cuales, los bacilos BTN7 y BTN8, presentaron los mejores halos de degradación, 12 y 14 mm de diámetro respectivamente, creciendo adecuadamente en las diferentes pruebas probióticas con densidades entre 106 y 108 UFC/ml; el porcentaje de degradación de materia seca fue de 39.73% y 36.10% en 48 y 72 horas respectivamente.  Las pruebas bioquímicas API E (bioMérieux SA revelaron que los bacilos BTN7 y BTN8 pertenecen al género Enterobacter sp. Los anteriores resultados abren la posibilidad de emplear, estos microorganismos como aditivos en la alimentación de rumiantes, a fin de contribuir con un mayor aprovechamiento de pastos, y otros sustratos vegetales lignocelulósicos.Palabras claves: Probióticos, Maralfalfa (Pennisetum sp., microorganismos ruminales, lignocelulosa, Enterobacter

  16. Diagnóstico teológico a los 50 años del Vaticano II (Theological Diagnosis 50 years after Vatican II - DOI: 10.5752/P.2175-5841.2011v9n24p1368

    Directory of Open Access Journals (Sweden)

    José Maria Vigil

    2011-12-01

    Full Text Available Resumen:Partiendo de la idea de que el Vaticano II quiso ser un diálogo con la modernidad, el autor comienza señalado (el «ver» en la medotología latinoamericana los grandes cambios de paradigma que se han sucedido en estos 50 años posteriores al Concilio: la revolución de la posmodernidad, el despertar de la conciencia política y la irrupción de la teología de la liberación, la nueva conciencia pluralista, el descubrimiento de la ecología profunda, la crisis de las «religiones agrarias» en un mundo que parece querer entrar en un mundo «post-religioso», y la transformación de la epistemología religiosa tradicional. En un segundo momento («juzgar» analiza lo que sucedió con el Vaticano II y el posconcilio: las transformaciones que propuso, la oposición que fue creciendo apoyándose en el propio poder jerárquico institucional, y el impase de la actual falta de diálogo. En una tercera parte («actuar» el autor propone unas pistas interpretativas como la mejor forma de aportar a una situación eclesial actual que parece no tener salida.Palabras clave: Diagnóstico teológico. Vaticano II. Concilio. Iglesia. Futuro. Cambio de ParadigmaAbstract:Starting from the idea that Vatican II wanted to stablish a dialogue with the modernity, the author starts pointing out (the «see», in the Latin American methodology the big changes of paradigm which have taken place in these last 50 years after the Council: the revolution of pos-modernity, the waking up of the politic conscienceand the irruption of the theology of Liberation, the new conscience of cultural and religious pluralism, the discovery of the depp ecology, the crisis of the «agrarian religions» in a world which seems to want enter into e post-religious world, and the transformation of the traditional religious epistemology.        In a second moment («judge» analizes what happened in the Vatican II and the pos-council: the transformations it proposed, the growing

  17. Desenvolvimento de instrumento de coleta de dados de enfermagem para pacientes com câncer de pulmão em quimioterapia ambulatorial Desarrollo de instrumento de recogida de datos de enfermería para pacientes con cáncer de pulmón en quimioterapia ambulatoria Developing a nursing data colleting instrument to patients with lung cancer treated by chemotherapy in ambulatory

    Directory of Open Access Journals (Sweden)

    Anita Moda Salvadori

    2008-03-01

    Full Text Available O câncer é um grave problema de saúde pública, e, dentre suas variedades, há o câncer de pulmão, que vem crescendo na população brasileira e mundial. A principal causa do câncer de pulmão é o tabagismo. Há três formas de tratamento: cirurgia, radioterapia e quimioterapia; para essa patologia a mais utilizada é a terceira. A enfermeira deve estar apta a lidar com as dificuldades desses pacientes, que durante o tratamento ambulatorial manifestam em seus domicílios efeitos colaterais. Os objetivos desta pesquisa são elaborar um instrumento de coleta de dados para pacientes com câncer de pulmão em quimioterapia ambulatorial e avaliar a validade de seus conteúdos e sua confiabilidade. Teve como guia a teoria do autocuidado de Dorothea Orem. Para sua validação, o instrumento foi primeiramente avaliado por juízes; após isso, foram realizados o pré-teste e o teste de confiabilidade pelo método da equivalência entre observadores. O instrumento se demonstrou confiável, considerando aquilo que se pretendia medir.El cáncer es un grave problema de salud pública y entre sus variedades existe el cáncer de pulmón, que está creciendo en la población brasileña y mundial. La principal causa de cáncer de pulmón es el tabaquismo. Existen tres formas de tratamiento, quirúrgica, por radioterapia y quimioterapia, siendo que para esta patología la más utilizada es la tercera. La enfermera debe estar habilitada para manejar dificultades de los usuarios que ante el tratamiento ambulatorio visiblemente pozo a su domicilio lado efectos. Los objetivos de esta investigación son elaborar un aparato desde colecta de datos para pacientes con cáncer de pulmón en quimioterapia en ambulatorio y evaluar la validad de sus contenidos y su confiabilidad. Tuvo como guía la teoría utilizada del auto-cuidado de Dorothea Orem.Para que sea comprobada la validez de dicho instrumento primeramente este fue evaluado por jueces, luego fue realizado un

  18. El b-learning como modalidad educativa para construir conocimiento

    Directory of Open Access Journals (Sweden)

    María Elena González

    2015-01-01

    Full Text Available El propósito es presentar la modalidad b-learnig que se enmarca dentro de la modalidad de educación a distancia, como una forma de im- plementar las TICs en la educación pues éstas han ido aumentando su impacto en todas las áreas de la vida de las personas, y específicamente su auge va creciendo cada día más, en el área educativa. Con la imple- mentación de las TICs en las diferentes modalidades en educación, el proceso de enseñanza-aprendizaje mejora notablemente, ya lo señalan en sus trabajos (Salinas, 1994; Pérez y García, 2001; Cabero, 2005; La- borde, 2001, cuando se habla de modalidades, nos referimos tanto la modalidad presencial como a distancia. En la primera, el proceso educa- tivo se da en un aula, y en el proceso intervienen el profesor y el alumno. Se puede decir entonces, que es la forma academicista de enseñar. En esta modalidad, el profesor siempre está presente para orientar, informar, responder preguntas, realizar comentarios sobre uno o varios temas. En la modalidad de educación a distancia en el proceso de enseñanza apren - dizaje están presentes diversos elementos, específicamente, las tecnolo - gías, con el objetivo de promover el acto educativo sin limitaciones de edad, ubicación y tiempo. En la educación a distancia, cada estudiante guía su propio proceso de aprendizaje, y es el mismo quien organiza y planifica su tiempo, además de buscar por sí mismo el material didáctico a trabajar, para responder de esa manera a las exigencias de la asignatura que cursa. Cada una de las modalidades tiene sus ventajas y característi - cas particulares, no puede decirse que la educación a distancia puede Recibido: 01-08-2015 • Aceptado: 01-09-2015 sustituir a la educación, presencial, sino que ambas modalidades pueden enriquecerse cada una con elementos de la otra. Esto es lo que da origen al blended learning o b-learning, es una modalidad, que concentra tanto elementos de la educación presencial como de

  19. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama The role of estrogen receptor alpha in breast cancer cell proliferation mediated by progestins

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.In C4-HD murine mammary carcinomas and in human breast cancer T47D cells, we showed that medroxyprogesterone acetate (MPA induces a nuclear physical association between estrogen receptor alpha (ERa and progesterone receptors (PR. The blockade of ERa inhibits cell proliferation mediated by progestins. We hypothesized that this nuclear association between ERa/PR is necessary to trigger progestin-induced cell proliferation and tumor growth. We demonstrated that fulvestrant (FUL, ICI182.780 induced complete regression of C4-HD tumors growing with progestins. MPA treatment induced an early increase in both CCND1 and MYC expression in T47D cells. The blockade of ERa

  20. Profile of scientific and technological production in nursing education research groups in the south of Brazil Perfil de la producción científica y tecnológica de los grupos de investigación en educación en enfermería de la región Sur de Brasil Perfil da produção científica e tecnológica dos grupos de pesquisa em educação em enfermagem da Região Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Mônica Motta Lino

    2010-06-01

    Full Text Available This research aimed to present the profile of production of Nursing Education Research Groups’ (NERG scientific and technological production in the South of Brazil. This documentary, quantitative, exploratory-descriptive retrospective research was guided by the active search for products in the Lattes curriculum of previously selected NERG researchers, based on the 2006 Census of the Research Group Directory/CNPq, between 1995 and 2008. The results indicated that the 18 NERG from southern Brazil produced 453 papers in proceedings, 371 book chapters, 206 books, 1,437 scientific articles and 08 technological products, but no patent was registered. NERG’s scientific production in the research region has grown progressively over the past 14 years. To strengthen this structure, the establishment of collaborative networks can be used as a strategy, so that political-scientific joint actions in the sector can advance science and technology.El objetivo del estudio fue presentar el perfil de la producción científica y tecnológica de los Grupos de Investigación en Educación en Enfermería (GIEE de la región sur de Brasil. Se trata de una investigación documental, cuantitativa, exploratoria-descriptiva retrospectiva, guiada por la búsqueda activa de las producciones, en el Currículo Lattes, de los investigadores de los GIEE, preseleccionados a partir del Censo-2006 del Directorio de Grupos/CNPq, en el período de 1995-2008. Los resultados indicaron que los 18 GIEE del sur de Brasil produjeron 453 trabajos en anales, 371 capítulos de libros, 206 libros, 1437 artículos científicos y 8 productos tecnológicos, sin embargo, ninguna patente registrada. La producción científica de los GIEE de la Región investigada viene creciendo, progresivamente, en los últimos 14 años. Para que esa estructura sea fortalecida, se puede utilizar como estrategia la formación de redes colaborativas que viabilicen articulaciones político-científicas en el

  1. Nuevos registros de macroalgas para el Atlántico mexicano y riqueza florística del Caribe mexicano New records of macroalgae for the Mexican Atlantic and floristic richness of the Mexican Caribbean

    Directory of Open Access Journals (Sweden)

    Neidy Pauline Cetz-Navarro

    2008-03-01

    Full Text Available Se revisaron muestras de macroalgas de un hábitat pocas veces analizado (colindante a la parte basal del tejido vivo de los corales Acropora palmata y Diploria strigosa y de una zona de México poco conocida florísticamente (parte Sur del Caribe mexicano, con base a lo cual se reporta a Corallophila verongiae (Rhodophyta, Derbesia fastigiata (Chlorophyta y Hincksia onslowensis (Phaeophyta como nuevos registros de macroalgas para la costa del Atlántico mexicano. Además, se reporta a Lophosiphonia obscura (Rhodophyta como nuevo registro para la parte costera continental del Atlántico mexicano, ya que sólo se había registrado hace más de 40 años para Arrecife Alacranes, sitio alejado aproximadamente 180 km al norte de Puerto Progreso, Yucatán. Aunque las especies de macroalgas no presentaron estructuras reproductoras, probablemente por tener crecimiento clonal y estar invadiendo tejido coralino, los caracteres morfológicos permitieron su identificación con certeza. Con excepción de la primera especie, las otras no se habían registrado creciendo sobre corales. Tomando en cuenta estos nuevos registros, el total de especies de macroalgas registradas hasta este estudio para el Caribe mexicano es de 546, incluyendo 307 Rhodophyta, 171 Chlorophyta y 68 Phaeophyta. Esta zona tropical y la costa templada de Baja California conforman las dos zonas florísticas marinas más ricas de México.Macroalgae samples from a habitat uncommonly analyzed (next to the basal part of live tissue of the corals Acropora palmata and Diploria strigosa, and from a Mexican zone barely known floristically (the southern part of the Mexican Caribbean were studied. Based on those samples, Corallophila verongiae (Rhodophyta, Derbesia fastigiata (Chlorophyta, and Hincksia onslowensis (Phaeophyta are recognized as new records for the Mexican Atlantic coast. Similarly, Lophosiphonia obscura (Rhodophyta is recognized as a new record for the continental coast of the Mexican

  2. Estimación a largo plazo de la prevalencia de obesidad en la Argentina

    Directory of Open Access Journals (Sweden)

    Erica Milin

    2010-01-01

    Full Text Available RESUMENIntroducciónLa obesidad está creciendo más aceleradamente en América latina que en los países desarrollados,sumándose a la desnutrición como factor que incide en la mortalidad. Aunque esnecesario conocer la evolución de las tasas de obesidad para implementar políticas de saludpública, en la Argentina no existen hasta el momento estudios que permitan proyectar lasituación en el futuro.ObjetivoEstimar a largo plazo la evolución de la prevalencia de obesidad en adultos en la Argentinaa través de un modelo de simulación basado en la tendencia de los últimos años.Material y métodosSe desarrollaron un modelo conceptual y un sistema de simulación estocástico en base a losdatos de obesidad publicados con anterioridad para representar el número de adultos obesosy su tasa de prevalencia a 20 años. La información para el funcionamiento del modelo seobtuvo de tres estudios poblacionales locales que incluían la prevalencia de obesidad endistintos años desde 1991. A los fines comparativos también se estimó la prevalencia deobesidad con tres ajustes estadísticos: lineal, exponencial y logarítmico.ResultadosA partir de una prevalencia actual del 20%, el modelo de simulación estimó que la prevalenciade obesidad en adultos en la Argentina será del 25,9% ± 2,75% (mediana: 26%, rango:18,0% a 32,0% para 2027, lo que representa para ese entonces 5.431.000 ± 554.000 obesos(mediana: 5.421.000 personas, rango: 3.605.000 a 6.631.000 personas. Estos resultadosfueron consistentes con los obtenidos con los métodos de ajuste y proyección estadísticos.ConclusionesEl modelo permitió estimar la tasa de obesidad a 20 años en la Argentina. Los valores deprevalencia en adultos hallados con el modelo fueron coincidentes con otros tipos de proyecciónestadística tradicionales. La validez de la estimación sólo podrá determinarse en base alas observaciones futuras de la evolución de la obesidad. Por último, el modelo podría ser

  3. LAS INCUBADORAS UNIVERSITARIAS DE ECONOMÍA SOLIDARIA EN BRASIL - UN ESTUDIO DE CASOS / THE UNIVERSITY INCUBATORS OF SOLIDARITY ECONOMY IN BRAZIL – A CASE STUDY

    Directory of Open Access Journals (Sweden)

    Ioshiaqui SHIMBO

    2011-09-01

    Full Text Available La Economía Solidaria es un término que designa un movimiento social que viene creciendo en Brasil durante los últimos 15 años e incluye un gran conjunto de actores socioeconómicos. En él se generan alternativas de inserción productiva para colectivos socialmente desfavorecidos, pero sus objetivos no son solamente los cambios económicos, sino la promoción de cambios socioculturales hacia una sociedad más igualitaria y solidaria. Para apoyar y fortalecer la economía solidaria se crearon desde algunas universidades brasileñas las Incubadoras de Cooperativas Populares. En el presente estudio se analiza la trayectoria de la Incubadora Regional de Cooperativas Populares de la Universidad Federal de São Carlos, situada en el Estado de São Paulo (Brasil, como estructura que conjuga la investigación, la docencia y la extensión universitaria dirigidas hacia los procesos de incubación de emprendimientos solidarios. Aplicando el estudio de casos se sistematizan los avances conceptuales y metodológicos que se relacionan con las dificultades encontradas por estos emprendimientos para su consolidación y la creación de redes de iniciativas económicas solidarias en el territorio estudiado. El examen de este proceso ayudó a identificar y discutir estrategias para el progreso de los argumentos conceptuales, de la metodología de asesoramiento y para la aplicación a otras iniciativas similares. / The Solidarity Economy is a social movement who is growing up in the last 15 years in Brazil and it includes a very big group of socioeconomic actors. This movement improves alternatives of productive insertion to disadvantage groups of population. However its objectives are not only the economic changes, but the promotion of social and cultural changes toward a more equal and solidarity society. To support and strengthen the solidarity economy, the Popular Cooperatives Incubators had been created in some Brazilian Universities. In this study we

  4. Seasonal changes in the photosynthetic performance of two evergreen Nothofagus species in south central Chile Cambios estacionales en el desempeño fotosintético de dos especies siempreverdes de Nothofagus en el centro sur de Chile

    Directory of Open Access Journals (Sweden)

    RAFAEL ZÚÑIGA

    2006-12-01

    del aparato fotosintético bajo condiciones de jardín común de estas especies podrían explicar sus contrastantes preferencias de hábitat. Se estudian algunas de estas propiedades en estas dos especies creciendo en un jardín común en el centro sur de Chile. La eficiencia fotoquímica máxima (Fv/Fm de ambas especies permanece en el rango de los valores normales (» 0,8 con excepción de un decrecimiento al mediodía y en verano en N. dombeyi, que sugiere una reducción reversible de la eficiencia fotoquímica máxima del fotosistema II (PSII. Durante el verano, la eficiencia fotoquímica efectiva del PSII (F PSII, el apagamiento fotoquímico (qP, la fotosíntesis (Amax, conductancia estomática (gs y las tasas de transpiración (E en N. dombeyi fueron mayores que en N. nitida. Los mayores incrementos en los contenidos de pigmentos fotoprotectores (zeaxantina + anteraxantina y luteína entre prealba y mediodía se obtuvieron en verano en N. dombeyi. En N. nitida se presentó en invierno una retención nocturna de zeaxantina sin decrecimiento de Fv/Fm. Los resultados sugieren que bajo condiciones de mayor intensidad lumínica, mayor temperatura y sequía, N. dombeyi mostró un mejor desempeño fotosintético que N. nitida. Los datos presentados son consistentes con la capacidad pionera de N. dombeyi y las propiedades de semitolerancia a la sombra y distribución más restringida de N. nitida. Estas características fotosintéticas, junto con las diferencias de la resistencia al congelamiento, sequía y anegamiento pueden resultar de su separación de hábitat

  5. Efecto de la Adición de Residuos de Cosecha y de un Hongo Micorrizógeno Sobre el Crecimiento Trigo y Parámetros Químicos y Biológicos de un Andisol Effect of Addition of Crop Residues and Mycorrhizal Fungi on Wheat Growth and the Chemical and Biological Parameters of an Andisol

    Directory of Open Access Journals (Sweden)

    Redel Yonathan

    2006-06-01

    Full Text Available Entre las diversas prácticas agrotecnológicas aplicables a sistemas agrícolas de baja inversión, se consideran la adición de residuos de plantas como una fuente de nutrientes, y el manejo adecuado de la simbiosis micorriza arbuscular (MA. Por ello, el objetivo general de este estudio fue determinar el efecto de la aplicación de residuos de cosecha e inoculación micorrízica sobre el desarrollo y nutrición mineral de plantas de trigo (Triticum aestivum L. creciendo en un suelo ácido (Typic Distrandepts y algunos parámetros químicos y biológicos del suelo. Residuos de lupino (Lupinus albus L. y de trigo se adicionaron al suelo a una dosis equivalente a 6 Mg ha-1, sobre el cual se sembró trigo cv. Otto, con y sin inoculación de una cepa nativa de un hongo MA exógeno (Glomus etunicatum CH 110. La adición de residuos orgánicos incrementaron significativamente el rendimiento de materia seca en un 50-60% y la adquisición mineral de las plantas de trigo hasta en un 100%. Los residuos de trigo incrementaron el pH del suelo y la disponibilidad de P, mientras que los residuos de lupino incrementaron la colonización de hongos MA de 49 a 61%. La inoculación de un hongo MA exógeno disminuyó la adquisición de minerales, especialmente Al, lo que puede contribuir a la disminución de problemas de toxicidad en suelos ácidos.Among the diverse agro-technological practices applicable to low-input investment agricultural systems, the additions of plant residues to soils as a nutrient source, and the appropriate management of arbuscular mycorrhizal (MA symbiosis, are being worldwide considered. Therefore, the main objective of this study was to test the application effect of two crop residues and mycorrhizal inoculation on wheat (Triticum aestivum L. plants growing in an acidic soil (Typic Distrandepts and some chemical and biological soil parameters. Both, lupine (Lupinus albus L. and wheat residues were added to soil at equivalent rates of 6

  6. Uses of heritage, social action and tourism: towards a needed consensus - doi: 10.4025/dialogos.v12i1.34 Usos del patrimonio, acción social y turismo: hacia un necesario consenso* Usos do patrimônio, ação social e turismo: em busca de um necessário consenso - doi: 10.4025/dialogos.v12i1.34

    Directory of Open Access Journals (Sweden)

    Josep Ballart Hernández

    2010-05-01

    és del turismo. Este fenómeno, que constituye la industria cultural más importante de muchos países del mundo, está llamado a seguir creciendo en los próximos años, especialmente en Iberoamérica. En tanto que manifestación del dinamismo social que caracteriza en diversos campos a nuestras sociedades, el turismo cultural contribuye a su vez al progreso de la conciencia conservacionista y estimula la mejora de las prácticas conservacionistas y por ende de la gestión del patrimonio en su conjunto. Por tanto, en este contexto de cambio y desarrollo es muy pertinente la reflexión especializada sobre cómo utilizar de forma ventajosa el patrimonio, cómo encauzar su consumo individual (en términos turísticos y demás y qué nuevos equilibrios y consensos habrá que forjar al respecto, para que el tipo de desarrollo que buscamos se fundamente y se sustente en un desarrollo cultural real, participativo y equilibrado.A teoria do patrimônio nos adverte da contradição real que existe entre conservação e uso do patrimônio como se se tratasse de expressões excludentes. Porém, a chave de uma boa gestão do patrimônio consiste, precisamente, em encontrar saídas viáveis para este problema e em superar a dita contradição desfazendo esse nó gordiano da cultura material. O desafio é mais exigente nos tempos atuais e nos países com rápido desenvolvimento devido a que a forma mais usual e expansiva de dar um uso aos recursos culturais patrimoniais se produz através do turismo. Este fenômeno, que constitui a indústria cultural mais importante de muitos países do mundo, continuará crescendo nos próximos anos, especialmente na América Ibérica. O turismo cultural, enquanto manifestação do dinamismo social que caracteriza às nossas sociedades em diferentes âmbitos, também contribui para o progresso da consciência conservacionista e estimula a melhora das práticas conservacionistas e, por tanto, da gestão do patrimônio em seu conjunto. Por isto, neste

  7. Photosynthetic responses to temperature and light of Antarctic and Andean populations of Colobanthus quitensis (Caryophyllaceae Respuestas fotosintéticas a la temperatura y a la luz de poblaciones antarticas y andinas de Colobanthus quitensis (Caryophyllaceae

    Directory of Open Access Journals (Sweden)

    ÁNGELA SIERRA-ALMEIDA

    2007-09-01

    ínsula Antartica. A pesar de que ambos habitats se caracterizan por ser fríos y con temperaturas congelantes, existen importantes diferencias microclimáticas entre estos habitats durante el período de crecimiento. Por ello, sería esperable encontrar importantes diferencias en la respuesta del aparato fotosintético a factores abióticos entre poblaciones antarticas y andinas de C. quitensis. Estudiamos la relación de la fotosíntesis neta con la temperatura foliar y la intensidad lumínica en dos poblaciones de C. quitensis, una proveniente de La Parva en Los Andes de Chile central y la otra de la Isla Rey Jorge, en la Antartica marítima. Plantas de ambas poblaciones fueron crecidas en laboratorio a 15 °C y 250 μmol fotones m-2 s-1, con un fotoperíodo de 16/8 h luz/oscuridad. Veinte plantas de cada población fueron transferidas a una cámara a 4 °C, con las mismas condiciones de luz y fotoperíodo antes mencionadas, de modo de evaluar la capacidad de aclimatación de la fotosíntesis. A 15 °C, las poblaciones presentaron diferencias en su temperatura foliar óptima para la fotosíntesis. Estos óptimos fueron 24,0 °C en individuos provenientes de los Andes y 18,6 °C en individuos de la Antártida. En contraste, los individuos antarticos mostraron la más alta tasa de fotosíntesis neta bajo ambos tratamientos de temperatura, con puntos de compensación y saturación más bajos. Los individuos antarticos tuvieron mayor capacidad fotosintética a menores temperaturas que los individuos andinos. Nuestros resultados sugieren que C. quitensis ha adaptado el desempeño fotosintético de individuos creciendo en diferentes localidades a las condiciones climáticas predominantes en dichas localidades. Las diferencias en las respuestas fotosintéticas a la temperatura y a la luz son discutidas en relación a la diferenciación ecotípica entre las dos poblaciones estudiadas

  8. Analysis of the re-colonization of San Benito Archipelago by Guadalupe fur seals (Arctocephalus townsendi Análisis de la recolonización del archipiélago de San Benito por el lobo fino de Guadalupe (Arctocephalus townsendi

    Directory of Open Access Journals (Sweden)

    Manuel Esperón-Rodríguez

    2012-03-01

    -colonización y el estado actual del LFG en el ASB. También se informan los primeros nacimientos y la ocupación de la isla del Oeste del ASB. Con base en los censos de 1997 a 2007, la población creció con una tasa de incremento anual de 21,6%. Se estudió el tamaño de la población, la tendencia de crecimiento de la colonia, biología reproductiva y preferencias alimentarias. Se contaron 2,227 individuos en el ASB. Tres especies de calamar se encontraron como el principal componente de la dieta (Loligo opalescens, Onychoteuthis banksii y Dosidicus gigas. La territorialidad, los patrones de actividad y el comportamiento reproductivo, muestran una conducta similar entre los individuos de isla Guadalupe y ASB. Se calculó la tasa de crecimiento promedio de las crías del ASB y se comparó con la tasa de crecimiento de las crías de isla Guadalupe (ASB: 6.7 ± 1.4 kg y 68,9 ± 2.64 cm; isla Guadalupe 5.9 ± 0.5 kg, y 67.29 ± 4.3 cm. Se midió la duración de los viajes de alimentación de las hembras, indicando que la colonia de San Benito probablemente se encuentra cerca de una importante zona de alimentación. En cuanto a los patrones de asistencia materna, estos podrían indicar una estrategia de lactancia-viajes de alimentación diferente entre SBA e isla Guadalupe. Se puede esperar que la población de lobos finos en San Benito siga creciendo, ya que no hay limitantes en cuanto al espacio reproductivo y los recursos alimenticios disponibles en la zona.

  9. Leaf phenology and its associated traits in the wintergreen species Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae Fenología foliar y sus caracteres asociados en la especie invierno-verde Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae

    Directory of Open Access Journals (Sweden)

    MARÍA ANGÉLICA DAMASCOS

    2001-12-01

    Full Text Available The post-summer leaf demography of the wintergreen species Aristotelia chilensis growing near San Carlos de Bariloche, Argentina, is described. Its specific leaf mass (SLM, g m-2 is compared to that of the deciduous and evergreen species of the Andean-Patagonian forests and to that of other communities abroad. The pattern of leaf emergence is intermediate, with leaf flush in spring (basal cohort, BC, followed by successive unfolding of the remaining leaves (distal cohort, DC during summer. The senescence of the BC occurs mainly in autumn, with a loss of 11-31 % of its SLM. The DC falls synchronously in mid-spring and the SLM loss in winter is 10-13 %. The SLM of A. chilensis (103.6 ± 6.2 g m-2 is intermediate when compared to the general mean values of deciduous (73.7 ± 15.9 g m-2 and evergreen species (154.8 ± 45.8 g m-2. The SLM of deciduous and evergreen species of three different forests near San Carlos de Bariloche varied significantly at the end of the growing season while that of A. chilensis showed more constant values. The periodicity of leaf production and senescence in A. chilensis allows the maintenance of one leaf cohort throughout the year, covering the carbon demand for flowering and leaf production in spring. This differentiates the deciduous from the wintergreen species, despite their similar mean leaf life span values, while the evergreen species have a longer leaf turnover. Considering the conditions for growth in each studied forest, the leaf life span was not the only factor determining the SLM value. This variable would also depend on multiple stresses that may act during the ontogenesis and evolution of the leaves in each phenological groupSe describe la demografía foliar después del verano de la especie invierno-verde Aristotelia chilensis, creciendo cerca de la ciudad de San Carlos de Bariloche, Argentina. Se compara su peso específico foliar (SLM, g m-2 con los valores de especies deciduas y siempreverdes de los

  10. Estudo comparativo entre ultrassom e neuroestimulação no bloqueio do plexo braquial pela via axilar Estudio comparativo entre ultrasonido y neuroestimulación en el bloqueo del plexo braquial por la vía axilar A comparative study between ultrasound and neurostimulation guided axillary brachial plexus block

    Directory of Open Access Journals (Sweden)

    Diogo Brüggemann da Conceição

    2009-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O uso do ultrassom em Anestesia Regional vem crescendo. Existem poucos estudos comparando o uso do ultrassom com a neuroestimulação. O objetivo deste estudo foi comparar a execução do bloqueio do plexo braquial pela via axilar guiado por neuroestimulação com dupla injeção e guiado por ultrassonografia em procedimentos cirúrgicos na mão. Para isto, foram comparados o tempo de realização, a taxa de sucesso e complicações. MÉTODO: Após a aprovação do Comitê de Ética em Pesquisa do Hospital Governador Celso Ramos foram selecionados 40 pacientes escalados para operações eletivas na mão com bloqueio de plexo braquial via axilar. Os pacientes foram distribuídos aleatoriamente eletronicamente em dois grupos de 20 pacientes: Grupo Neuroestimulação (NE e Grupo Ultrassonografia (US. Foram comparados tempo de realização, taxa de sucesso e taxa de complicações. RESULTADOS: As taxas de bloqueio completo, falha parcial e falha total não apresentaram diferença estatística significativa entre os grupos US e NE. O tempo médio para realização do procedimento no grupo US (354 segundos não apresentou diferença estatística significativa quando comparado ao grupo NE (381 segundos. Pacientes do grupo NE apresentaram maior taxa de punção vascular (40% quando comparados ao grupo US (10%, p JUSTIFICATIVA Y OBJETIVOS: El uso del ultrasonido en Anestesia Regional ha venido creciendo. Existen pocos estudios comparando el uso del ultrasonido con la neuroestimulación. El objetivo de este estudio, fue comparar la ejecución del bloqueo del plexo braquial por la vía axilar, guiado por neuroestimulación con doble inyección y guiado por ultrasonido en procedimientos quirúrgicos en la mano. Para eso, se compararon el tiempo de realización, la tasa de éxito y las complicaciones. MÉTODO: Después de la aprobación por parte del Comité de Ética en Investigación del Hospital Governador Celso Ramos, se

  11. Influencia de la madera juvenil de pino radiata sobre las propiedades físicas y mecánicas de tableros OSB Influence of radiata pine juvenile wood on the physical and mechanical properties of oriented strand boards (OSB

    Directory of Open Access Journals (Sweden)

    ROBERT PECHO

    2005-01-01

    Full Text Available En este trabajo se analizó la influencia de la madera juvenil de pino radiata (Pinus radiata D. Don, en particular el ancho de los anillos de crecimiento y el espesor de la pared celular, sobre las propiedades físicas (hinchamiento y expansión lineal y mecánicas (adhesión interna, MOR y MOE de tableros de hojuelas orientadas OSB. La madera para los ensayos fue recogida de 10 árboles en pie de un rodal de 26 años creciendo en plantaciones manejadas de la Octava Región, Chile. La determinación de madera juvenil fue realizada observando la variación radial de los anillos de crecimiento de la madera, sobre la base de análisis de imágenes y el apoyo de un software comercial. Los detalles de la estructura anatómica fueron determinados sobre cortes microtomados, mediante análisis de imágenes usando un software comercial. El diseño experimental consideró como factores variables la proporción de madera juvenil (0, 30, 70 y 100% de madera juvenil y el tipo de corte de las hojuelas (radial y tangencial. El ciclo de prensado utilizado consideró una temperatura máxima de 195°C, una presión máxima de 40 bar y un tiempo de prensado de 230 segundos. Los resultados mostraron que la proporción de madera juvenil condiciona las propiedades físicas y mecánicas de los tableros OSB. El IB (con 0,46 MPa para madera juvenil y 0,70 MPa para madera adulta y el MOE (madera juvenil de 3.271 y de 5.159 MPa para madera madura disminuyeron significativamente con el incremento de la proporción de madera juvenil. Los valores del MOR de 29 MPa en madera juvenil y 36 MPa en el caso de madera madura, en cambio, resultaron independientes de la proporción de madera juvenil. El hinchamiento (32% para madera juvenil y 24% para madera adulta fue mayor que lo exigido por la norma O437 series 93; en cambio, la expansión lineal (0,22% para madera juvenil y 0,17% para madera adulta cumplió con la norma al igual que todas las propiedades mecánicas estudiadas

  12. SOIL-PLANT NUTRIENT INTERACTIONS IN TWO MANGROVE AREAS AT SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Ana Paula Lang Martins Madi

    2015-11-01

    Full Text Available ABSTRACTMangrove forests have a simple architecture. They shelter a few number of arboreal species that grow in a saline environment subject to tidal activity. The research objective was to evaluate possible interactions between physical-chemical soil attributes and plant-leaf nutrient concentrations of different mangrove species. Different mangrove species growing in the same soil, and the same mangrove species growing in two different soil classes were evaluated as to their leaf nutrient concentration patterns. The study was carried out in mangrove areas of the State of Paraná, southern Brazil, in two distinct soil classes: HISTOSOL THIOMORPHIC Salic sodic and GLEYSOL THIOMORPHIC Salic sodic; and three different species: Avicennia schaueriana, Laguncularia racemosa and Rhizophora mangle. Two subareas were delimited within each area from which soil and leaf samples were collected. Samplings from five individuals of each dominant mangrove species were taken from the soil (0-10 cm deep under each tree crown projection. The data was submitted to statistical analysis using a set of simple and multivariate analysis in order to determine possible differences among mangrove species leaf nutrient concentrations, and whether these differences might be correlated with the soil attributes or not. The results exposed that the nutritional state of the mangrove species is different and independent form the soil attributes in which they grow. Few correlations were found among leaf nutrient concentrations and soil attributes, suggesting differential selective nutrient uptake among species.RESUMENLos manglares son bosques de arquitectura simple que albergan pocas especies arbóreas, creciendo en un ambiente salino sometido a la influencia de las mareas. El objetivo de este trabajo fue evaluar las posibles interacciones entre las propiedades fisicoquímicas del suelo y la concentración de nutrientes en hojas de diferentes especies de mangle. Se investigó si

  13. Risk factor control in hypertensive and diabetic subjects attended by the Family Health Strategy in the State of Pernambuco, Brazil: the SERVIDIAH study Control de los factores de riesgo en hipertensos y diabéticos seguidos por la Estrategia Salud de la Familia en el estado de Pernambuco, Brasil: estudio SERVIDIAH Controle dos fatores de risco em hipertensos e diabéticos acompanhados pela Estratégia Saúde da Família no Estado de Pernambuco, Brasil: estudo SERVIDIAH

    Directory of Open Access Journals (Sweden)

    Adriana Falangola Benjamin Bezerra

    2013-06-01

    sobrepeso u obesidad, pocos informaron estar siguiendo una dieta para perder peso. El estudio, en esta muestra representativa de hipertensos y diabéticos registrados en la ESF de Pernambuco, muestra qué mejorías se deben buscar a fin de perfeccionar la prevención de las complicaciones de esos problemas, cuya incidencia está creciendo.O estudo SERVIDIAH (Avaliação de Serviços de Atenção Básica à Saúde para Diabéticos e Hipertensos foi realizado em 2010 no Estado de Pernambuco, Brasil. Foi constituída uma amostra aleatória de 785 hipertensos e 823 diabéticos oriunda dos cadastros de 208 equipes da Estratégia Saúde da Família (ESF sorteadas em 35 municípios do estado. Os usuários foram entrevistados por meio de formulário padronizado, e tiveram aferição de peso, altura e pressão arterial e, para os diabéticos, da hemoglobina glicada (HbA1c. A idade média foi em torno de 60 anos, com sobrerrepresentação de mulheres (70%. A pressão arterial foi controlada em 43,7% dos hipertensos e 25,8% dos diabéticos; 30,5% dos diabéticos apresentaram HbA1c abaixo de 7%. Apesar de 70% apresentarem sobrepeso ou obesidade, poucos referiram estar seguindo dieta para perder peso. O estudo, nesta amostra representativa de hipertensos e diabéticos cadastrados na ESF de Pernambuco, mostra que melhorias devem ser buscadas a fim de aprimorar a prevenção das complicações desses agravos, cuja incidência está crescente.

  14. A strategic learner for a new society Un aprendiz estratégico para una nueva sociedad

    Directory of Open Access Journals (Sweden)

    Bernardo Gargallo López

    2012-07-01

    1246 12.0 0 false 18 pt 18 pt 0 0 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:12.0pt; font-family:"Times New Roman"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Nuevos tiempos precisan de nuevos aprendices. En una escuela inmersa en la sociedad de la información, que queremos que sea del conocimiento, hace falta desarrollar nuevas actitudes y habilidades para el aprendizaje. El estudiante ha de aprender a desarrollar su autonomía y responsabilidad en un mundo abierto en que hay sobreabundancia de información y estímulos. Para ello hace falta que el estudiante llegue a ser “aprendiz estratégico”, una persona autónoma que quiere aprender para crecer, para sí y para los demás, teniendo como referente los valores, alguien que aprende a movilizar, observar, evaluar, planificar y controlar sus propios procesos de aprendizaje. Estamos hablando de aprendizaje autorregulado, de “aprender a aprender” Y, si bien es cierto que la escuela ha perdido su papel clave en la transmisión de la información, también lo es que se constituye en el espacio privilegiado para enseñar a aprender a aprender. La autorregulación, el pensamiento crítico, el compromiso cívico, etc. han de asentarse en la escuela para continuar creciendo luego, y se pueden y deben trabajar desde edades tempranas. En este trabajo presentamos claves para el desarrollo del aprendizaje estratégico en el sistema educativo.

  15. Incorporación de elementos traza en conchas de Melanopsis durante el crecimiento: posibilidades de aplicación en paleoecología

    Directory of Open Access Journals (Sweden)

    Alonso, J. J.

    1988-12-01

    stas tienen que ver, o no, con la fluctuación de una serie de parámetros ambientales. La importancia del trabajo radica en la posibilidad de la aplicación paleoecológica de sus resultados, ya que el género Melanopsis tiene un abundante registro fósil durante todo el Cenozoico. La incorporación de oligoelementos se efectúa a medida que la concha va creciendo por acreción; lo ideal sería que tal crecimiento fuera circadiano, ya que se podría seguir día a día, sobre la concha, la fluctuación de sus componentes químicos. Sin embargo, nuestro trabajo muestra que, para esta especie, ello no es así. La tasa de acreción, tanto si se mide en función de los incrementos segregados por unidad de tiempo como del espesor segregado durante un período fijo, es función del tamaño de la concha para la misma población. Una primera campaña, de un mes de duración, ha revelado que en aquellas conchas, cuya tasa de acreción coincide con el número de días, las composiciones químicas de cada línea de crecimiento no parecen tener una relación de carácter fijo con las variaciones diarias de los parámetros del medio. Parece haber unos organismos más sensibles que otros a tal variación. Ello, pues, probablemente sea atribuible a variabilidad genética en cuanto a la capacidad de filtrado de los distintos iones. Durante un período de siete meses, en que la variación más significativa corresponde a la temperatura, uno de los morfotipos presenta variaciones de composición química correlacionadas con las variaciones de los parámetros del medio, mientras que el otro no muestra tendencias claras al respecto. La posibilidad de ritmos circadianos de acreción en caparazones de invertebrados está en contradicción con los resultados obtenidos en este estudio. Sería interesante analizar casos dados como válidos desde las perspectivas que aquí se abren. Las posibilidades de aplicación paleoecológica son también bajas, al menos para el género aquí estudiado.

  16. (GEHO Grupo español del hormigón

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1986-12-01

    by its inscription at the Madrid Provincial Registry of Associations, N.P. 6.771 of July 4th 1985.

    El Comité Europeo del Hormigón (CEB fue fundado en 1957 con el objeto de desarrollar, a nivel internacional, el estudio de toda cuestión científica y técnica susceptible de hacer progresar la construcción en hormigón. Entre sus seis miembros fundadores figuraba el profesor español Eduardo Torroja. Desde esa fecha, el prestigio alcanzado por el CEB ha ido creciendo continuamente, gracias a los trabajos y publicaciones realizados. Por otra parte, desde 1976 en que se reformaron sus Estatutos, el CEB ha pasado a denominarse Comité Euro-Internacional del Hormigón, con lo que admite en su seno a cualquier país del mundo. En la actualidad, los países miembros pasan de cuarenta. En España, la vinculación con el CEB ha venido siendo asegurada tradicionalmente por el Instituto de la Construcción y del Cemento "Eduardo Torroja" (lETcc, perteneciente al Consejo Superior de Investigaciones Científicas, quien centralizaba las relaciones tanto técnicas como administrativas. Esta labor del Instituto ha sido muy positiva y de ella se han beneficiado, directa o indirectamente, gran número de expertos y profesionales españoles del sector de la construcción. En particular, la normativa técnica española del sector del hormigón está basada en los trabajos del CEB. El desarrollo creciente de la técnica del hormigón en nuestro país, en sus distintas vertientes de investigación, docencia, proyecto, cálculo, construcción, control de calidad, etc., ha traído consigo que el número de profesionales interesados en el CEB sea hoy considerable. Ello aconseja la creación de una Asociación, al amparo de la Ley de 24 de Diciembre de 1964, que pueda servir de cauce a todas las actividades que se derivan de la pertenencia al CEB, potenciando con ello la participación de los expertos españoles en tan prestigiosa organización. A esta idea de participaci

  17. Influencias de las variaciones en el clima y en la concentración de C0(2 sobre el crecimiento de Nothofagus pumilio en la Patagonia Influences of climatic and C0(2 concentration changes on radial growth oí Nothofagus pumilio in Patagonia

    Directory of Open Access Journals (Sweden)

    ANA M SRUR

    2008-06-01

    Full Text Available El objetivo de este trabajo fue evaluar las relaciones entre las variaciones en el clima y en la concentración de C0(2 durante el siglo XX con el crecimiento radial y la eficiencia en el uso del agua en los bosques de Nothofagus pumilio a lo largo de un gradiente altitudinal, en El Chaltén (49°22' S, Santa Cruz, Argentina. Se empleó una combinación de técnicas dendrocronológicas e isotópicas. Los patrones de crecimiento radial a lo largo del gradiente altitudinal reflejan las tendencias climáticas registradas en la zona durante el siglo XX. El crecimiento de los árboles ubicados en el límite superior muestra una tendencia positiva en respuesta al incremento regional de las temperaturas. Por el contrario, los bosques en contacto con la estepa patagónica presentan, en respuesta a una intensificación del déficit hídrico, una tendencia negativa de crecimiento durante el siglo pasado. Los árboles creciendo en bosques mésicos ubicados en alturas intermedias muestran una tendencia levemente negativa no significativa. Los valores de 6(13C reflejan en qué medida el contenido de humedad en el suelo regula en forma diferencial los procesos de conductancia estomática y tasa fotosintética a lo largo del gradiente altitudinal. En sitios donde el déficit hídrico varía desde leve a muy marcado, la eficiencia intrínseca en el uso del agua (EIUA parece estar influenciada por la disponibilidad de agua en el suelo. La relación entre la EIUA y las variables climáticas es más clara en sitios con reducido estrés hídrico. En sitios secos, el estrés hídrico muy marcado reduciría la tasa fotosintética en grado tal que el crecimiento no podría ser compensado por el aumento en EIUA. En contraste con el concepto tradicional en dendrocronología que postula una relación más estrecha entre el crecimiento radial y las variaciones climáticas en los bosques ecotonales, los valores isotópicos de 6(13C representan más claramente las

  18. Historia del tratamiento de la Sífilis The history of Syphilis´ treatment

    Directory of Open Access Journals (Sweden)

    R M C Leitner

    2007-03-01

    Full Text Available El nombre sífilis proviene del griego siph: cerdo y philus: amor. Recuerda al personaje de una obra, llamado Syphilo, que fue castigado por los dioses a sufrir una terrible enfermedad. Se analizan los datos sobre la sífilis en la antigüedad (que difieren según su fuente. Su mención en la Edad Media, su controversial origen, la ayuda de los paleopatólogos para encontrarlo. Luego de la Revolución Francesa y el inicio de la Edad Contemporánea, el porcentaje de enfermos fue creciendo y se acentuó la segregación de los mismos por la sociedad. Desde el año 1500 hasta principios del siglo XX el tratamiento de la sífilis dependía del mercurio. Tenía una gran variedad de formas de aplicación. La vía tópica: el ungüento gris, en calomelano o tabletas, en inyecciones, en fricciones y fumigaciones en donde el mercurio se introducía en el cuerpo por lo pulmones. Se adjudicó a la madera del guayaco pretendidas características curativas, que no poseía. Los ioduros se utilizaron para el terciarismo. Ehrlich en 1907, patentó el compuesto 606 o Salvarsan y en 1910, el Neo-Salvarsan o Arsfenamina (compuesto 914. Por estos descubrimientos recibió el Premio Nobel. En 1887, Julios Wagner Jauregg sugirió que la fiebre terapéuticamente inducida era útil en el tratamiento de enfermos psicóticos. En 1912 publicó sus satisfactorios resultados al tratar la paresias con una combinación de mercurio-iodo y tuberculina de Koch. En 1917 ingresó a su servicio un enfermo de malaria, con cuya sangre escarificaron la piel palúdica de tres paréticos, en lugar de darle inmediatamente quinina. Por ello fue galardona con el Premio Nobel. Se utilizó luego el bismuto, a partir de 1922, pero posteriormente fue sustituido por las sulfamidas, de aplicación dificultosa. El avance terapéutico más importante ocurrió en 1943, año en que se comenzó a utilizar la penicilina por Mahoney y colaboradores. Luego se confirmó la eficacia de la tetraciclina para

  19. BAELO CLAUDIA Y POLLENTIA: NUEVAS EVIDENCIAS SOBRE LAS FLUCTUACIONES ECONÓMICAS EN LA HISPANIA ROMANA DE LOS SIGLOS I-II D. C. (Baelo Claudia and Pollentia: new evidence on the economic fluctuations in Roman Spain during the first and second centuries AD

    Directory of Open Access Journals (Sweden)

    Pascual Izquierdo-Egea

    2012-06-01

    Full Text Available La revisión cronológica de la necrópolis sureste de Baelo Claudia (Bolonia-Tarifa, Cádiz y la de Can Fanals, en Pollentia (Alcudia, Mallorca, ha permitido ampliar el conocimiento sobre las fluctuaciones económicas en la Hispania romana de los siglos I y II de nuestra era y los cambios sociales asociados a las mismas. Se ha obtenido una nueva confirmación del impacto de la gran crisis de tiempos de Tiberio en los registros funerarios de Baelo Claudia y Pollentia, detectada previamente en Ampurias o Emporiae (Gerona. La bonanza de la época de Claudio se puede comprobar en Baelo Claudia de forma más elocuente que en Emporiae. Ahora bien, esta coincidencia en el devenir económico se rompe a lo largo de la segunda mitad del siglo I d. C., en concreto durante el periodo comprendido entre Nerón y principios de los Flavios. Es entonces cuando, frente a la decadente Ampurias, una pujante Pollentia sigue los pasos de la opulenta Baelo mostrando su mayor prosperidad. Sin embargo, esas tres ciudades romanas de Hispania mantienen un claro nexo basado en la exhibición durante ese periodo de su máxima complejidad social. Siempre se da una proporción directa entre la acumulación económica amortizada en los ajuares y la diferenciación entre los individuos, salvo en dos casos excepcionales. Uno, ya conocido, se refiere a la Ampurias de la segunda mitad del siglo I d. C., donde el empobrecimiento que la caracteriza se asocia con un incremento de la distancia social. Y, el otro, corresponde al extraño fenómeno documentado en la Pollentia del siglo II d. C. En esta sigue creciendo el gasto funerario, pero la diferenciación social medida desciende durante la primera mitad hasta caer abruptamente a lo largo de la segunda parte de dicha centuria. No obstante, lo más importante es que, por ahora, se detecta la misma evolución de la diferenciación social en Emporiae, Baelo Claudia y Pollentia desde la época de Tiberio hasta la primera mitad del

  20. 钙蛋白酶10基因多态性与妊娠期糖代谢异常的关系%Association of the calpaain-10 gene polymorphism with glucose metabolism disorder in pregnant women

    Institute of Scientific and Technical Information of China (English)

    武海荣; 杨慧霞

    2009-01-01

    Objective To study three single nucleotide polymorphisms (SNP), SNP-43, -19 and - 63 of calpain-10 (CAPN10) gene in pregnant women with glucose metabolism disorders and their relationship with the risk of these disorders. Methods Totally, 270 pregnant women including 156 with an abnormal oral glucose tolerance test (study group) and 114 healthy controls were selected among those delivered at the Department of Obstetrics and Gynecology, Peking University First Hospital from Jan. 2005 to Dec. 2006. The SNP of CAPN10 gene at posifons 43, 19, and 63 were analyzed by primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR). Results (1) The frequencies CAPN10 SNP-19 2R/2R genotype (26.9% ,42/156) and 2R allele (48.9%, 152/312 ) were higher than those in controls (12.3% ,14/114 and 36.8% ,84/228, respectively; P=0.012, 0.006). (2) Stratified analysis according to family history of diabetes mellitus showed the proportion of the CAPN10 SNP-19 2R/2R+2R/3R genotypes (83% ,47/57) in the study group were significantly higher than that of control group (52%,11/21 ; P=0.009), and the proportion of SNP-63 T/T + T/C genotypes(47% ,27/57) in study group were significantly higher than that of control group (14%, 3/21 ; P=0.026) among those with positive family history. (3) The combined effect of CAPN10 SNP-43, -19 and -63 on glucose metabolism disorders was analyzed by comparing with the other haplotypes and showed that the haplotype 121 distribution in study group was significantly higher than those in controls(P=0.036), and 221 haplotype was significantly lower than controls (P=0.042). Conclusions (1) CAPN10 SNP-19 is associated with glucose metabolism disorders in pregnant women. And 2R allele might be the risk factor. CAPN10 SNP-19 2R/2R +2R/3R and SNP-63 T/T + T/C genotypes might increase the risk of glucose metabolism disorders in women with positive family history. Haplotype 121 might increase the risk of glucose metabolism disorders in pregnant women and

  1. Crecimiento demográfico y cambio climático

    Directory of Open Access Journals (Sweden)

    Wilfredo Bulege Gutiérrez

    2013-06-01

    Full Text Available El mundo seguirá creciendo. Las más recientes proyecciones de las Naciones Unidas no prevén todavía un punto de inflexión en el crecimiento poblacional en el transcurso del presente siglo, pero se estima que, dadas las tendencias demográficas registradas, para mediados de siglo seremos alrededor de 9 mil 300 millones de habitantes en el planeta. La dinámica demográfica es la principal fuerza conductora del cambio ambiental global, pues constituye una presión para ocupar cada vez más espacios, explotar más recursos, producir más alimentos, consumir más agua, contaminar más, utilizar más energía y emitir más gases de efecto invernadero (1. La disminución del crecimiento demográfico resulta un requisito necesario para reducir las emisiones de carbono en el futuro; sin embargo, se objeta que ello puede dar lugar a programas de “control demográfico” en los países en desarrollo. Y como se sabe, estos países se verían afectados gravemente por el cambio climático; desde tal perspectiva ha sido identificado por lo menos una de tres posibles formas de interacción entre las tendencias demográficas y los efectos del cambio climático: (i un rápido deterioro de las fuentes de recursos naturales, (ii mayordemanda de recursos escasos y (iii el aumento de la vulnerabilidad humana a fenómenos meteorológicos extremos (2. Resultados de investigaciones indican que habría que ofrecer más posibilidades de acceso voluntario a los servicios de planificación familiar a las comunidades pobres de los países menos adelantados. Este enfoque prioriza el bienestar de las comunidades pobres afectadas por el cambio climático, a diferencia de la otra postura que propone la reducción del crecimiento de la población a fin de limitar el aumento de las emisiones de carbono mundiales (2. El crecimiento poblacional aumenta la demanda de bienes y servicios, sin duda implica una mayor presión ambiental. Al mismo tiempo, el crecimiento econ

  2. Alergia ao látex em paciente com síndrome de Kabuki: relato de caso Alergia al látex en paciente con síndrome de Kabuki: relato de caso Latex allergy in a patient with Kabuki syndrome: case report

    Directory of Open Access Journals (Sweden)

    Vera Coelho Teixeira

    2010-10-01

    conocimiento del profesional de Anestesiología sobre los aspectos específicos de pacientes portadores de síndromes raros, es una necesidad que ha venido creciendo, pues cada vez más, esos pacientes son derivados a los quirófanos. Nuestro objetivo es describir un caso de alergia al látex que ocurrió en uno de esos pacientes con diagnóstico del Síndrome de Kabuki, y cuyos aspectos todavía no fueron completamente aclarados, alertando a los anestesiólogos en cuanto a la posibilidad de esa asociación. RELATO DEL CASO: Paciente de 11 años, con diagnóstico de Síndrome de Kabuki, que fue admitida para exéresis de lesiones de las partes blandas. Presentaba un historial de reacciones alérgicas previas posteriores a los procedimientos quirúrgicos de pequeño porte. Con la necesidad de realizar un nuevo procedimiento, y después de la evaluación preanestésica, la paciente fue derivada a un alergista que la sometió a pruebas cutáneas las cuales confirmaron la hipótesis de alergia al látex. Una vez más fue enviada al quirófano para exéresis de las lesiones bajo anestesia general. Fueron tomadas todas las precauciones con el objetivo de evitar nuevas manifestaciones clínicas. El procedimiento transcurrió sin intercurrencias y la paciente recibió alta el mismo día, sin que presentase ningún tipo de complicación, lo que reforzó mucho más el diagnóstico. CONCLUSIONES: El Síndrome de Kabuki parece tener un curso relativamente benigno en su historial natural. Sin embargo, existen muchos aspectos que todavía necesitan ser aclarados y por lo tanto, no descartamos la posibilidad de la asociación de esa patología con otras condiciones que son del interés del anestesiólogo. Esa descripción tiene el objetivo de alertar sobre el riesgo de la asociación de ese síndrome con la alergia al látex. Para tanto, debemos incentivar la evaluación preanestésica de esos pacientes, la realización de una anamnesis correcta y el análisis de otros factores

  3. Pobreza urbana e degradação ambiental: algumas reflexões sobre Curitiba, Brasil. Urban poverty and environmental degradation:considerations on Curitiba, Brasil Pobreza urbana y deterioro ambiental: algunas reflexiones sobre Curitiba, Brasil.

    Directory of Open Access Journals (Sweden)

    Madianita Nunes da Silva

    2011-06-01

    the analysis of the city of Curitiba, Parana, Brazil, the text discusses the relationship between illegal occupations, urban poverty and environmental degradation. It seeks to demonstrate that, despite being a reference in urban planning, Curitiba is no exception to the pattern of most Latin American cities, where predominate the socio-spatial segregation and environmental degradation. This pattern is due to the production of the city according to the logic of capitalism, which expels to inappropriate areas that portion of the population whose income does not allow to pay the costs of a good location. Given that in Latin American urban poverty is rising, and the city being structured based on market laws, it seeks to demonstrate that there is a trend of risk urbanism to consolidate itself as a prevailing practice.Este trabajo reflexiona sobre el concepto de urbanismo de riesgo. Al mirar la ciudad de Curitiba, en Paraná, Brasil, el texto analiza la relación entre las ocupaciones irregulares, la pobreza urbana y la degradación del medio ambiente. A pesar de constituirse en referencia de planificación urbana, Curitiba no es una excepción al patrón de las ciudades de América Latina, dominadas por la segregación socioespacial y la degradación del medio ambiente. Este patrón es resultado de la producción de la ciudad según la lógica capitalista, que expulsa para zonas inadecuadas a la población cuyos ingresos no cubren los costos de una buena ubicación. Dado que en América Latina la pobreza urbana está creciendo y la ciudad se estructura a partir de las leyes del mercado, el trabajo pretende demostrar que existe una tendencia hacia la consolidación del urbanismo de riesgo como práctica predominante.Abstract:Curitiba, Parana, Brazil, the text discusses the relationship between irregular occupations, urbanpoverty and environmental degradation. It seeks to demonstrate that, despite being a reference in urban planning, Curitiba is no exception to the pattern

  4. Situación y tendencias epidemiológicas de la infección por VIH/SIDA en Colombia

    Directory of Open Access Journals (Sweden)

    Ricardo Luque Núñez

    2004-03-01

    heterosexual, 28,3% homosexual y 16,8% bisexual, para un total de 96% transmitidos por vía sexual, 3,1% perinatal, 0,67% transfusional, 0,11% en usuarios de drogas intravenosas y 0,12% por otras formas. Por otro lado, en el estudio centinela realizado en el año 2000 (2, se encontraron prevalencias por encima de lo esperado en departamentos de la costa atlántica, lo que sugiere una tendencia a una epidemia generalizada en estos sitios. Las mujeres representan el 18% de los casos, pero este número continúa creciendo y la relación hombre-mujer sigue siendo cada vez más cercana, con una relación de 3:1 promedio en el país, que en algunos departamentos puede ser de 2:1. El 52.86 % de los casos por VIH se presenta en personas entre los 15 y los 35 años, lo que quiere decir que este grupo poblacional, probablemente, se infectó antes de los veinte años de edad.

    La tendencia de la epidemia es creciente y las curvas no parecen aplanarse de la forma como se ha logrado en otros países. Según las proyecciones, si las intervenciones no logran su efecto o no se les da la sostenibilidad requerida, para el año 2010 tendremos una prevalencia cercana al 1.5%, lo que representará un número estimado de 800.000 casos.

     

    REFERENCIAS

    1. INSTITUTO NACIONAL DE SALUD. Estudio de prevalencia al VIH con HSH en Bogotá, Liga Colombiana de Lucha contra el SIDA, 2000.

    2. INSTITUTO NACIONAL DE SALUD. Estudio Centinela Nacional, 2000.

  5. Secondary Education in Afghanistan: a portray of postconflict education reconstrution

    Directory of Open Access Journals (Sweden)

    Juan Manuel Moreno Olmedilla

    2005-01-01

    importante: Dependiendo de la región o la provincia, la tasa de escolarización de las niñas en secundaria varía desde el 34 por ciento hasta el 0. Todavía hoy hay provincias enteras en que ni una sola niña está matriculada en la escuela secundaria superior. A todo esto se une la limitación impuesta por el escaso número de profesores ¿ y sobre todo de profesoras ¿ de secundaria tanto en determinadas regiones y provincias como en ciertas áreas curriculares (matemáticas y ciencias especialmente. El casi exclusivo énfasis actual, en buena medida impulsado por las distintas organizaciones donantes, sobre la educación primaria y en la universitaria, no permite anticipar que se vayan a llevar a cabo las reformas y las inversiones necesarias en el sector de la secundaria. Y no es necesario insistir en que ello puede llevar a desequilibrios importantes en el sistema educativo afgano, que al no poder hacer frente a la demanda de secundaria, podría ver cómo disminuyen ¿ o no siguen creciendo como es necesario ¿ las tasas de graduación en la primaria, cómo se amplía el déficit de profesorado tanto de primaria como de secundaria, y cómo continúan sin abrirse las puertas de la educación superior a las mujeres. Conseguir universalizar la educación secundaria de primer ciclo ¿ ya obligatoria, como se ha dicho ¿ va a requerir políticas muy decididas y orientadas a colectivos específicos. La provisión de escolarización habría de concentrarse en provincias, distritos y grupos étnicos muy específicos, además de las mujeres, que en principio no tienen asegurada su inclusión en un sistema que está en rapidísimo crecimiento

  6. Selected Abstracts of the 9th International Workshop on Neonatology; Cagliari (Italy; October 23-26, 2013

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2013-06-01

    Full Text Available Selected Abstracts of the 9th International Workshop on Neonatology • LEARNED LESSONS, CHANGING PRACTICE AND CUTTING-EDGE RESEARCH • Cagliari (Italy • October 23rd-26th 2013The Workshop has been organized on behalf of Union of European Neonatal and Perinatal Societies, Union of Mediterranean Neonatal Societies, Italian Society of Neonatology, UNICEF, and under the High Patronage of the President of the Italian Republic. ABS 1. Aetiology and type of reference hospital for neonatal transport in Greece during 2012 • S. Mouskou, C. Varakis, D. Pyrros, N. Iacovidou; Athens (Greece ABS 2. Changes in neonatal outcomes of very low birth weight infants in Hospital of Lithuanian University of Health Sciences • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 3. Autoimmune liver disease in childhood • Y. Gibo, D. Fanni, P. Van Eyken, S. Nemolato, G. Floris, C. Gerosa; Matsumoto (Japan, Leuven (Belgium and Cagliari (Italy ABS 4. Lactoferrin attenuates intestinal injury afther perinatal hypoxia and hypothermia • N. Barisic, G. Konstantinidis, V. Stojanovic, A. Doronjski, S. Spasojevic; Novi Sad (Serbia ABS 5. Osteopenia in prematurity: case report • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 6. Neonatal Bartter syndrome: case report of a very unusual entity • A. Koutroumpa, K. Georgiou, H. Georgaki, F. Anatolitou; Athens (Greece ABS 7. Placental Growth Factor (PlGF and placental function • I. Atzeni, S.F. Deiana, A. Meloni, B. Piras, P. Zedda, S. Soddu, G. Parodo, G. Faa, G.B. Melis, A.M. Paoletti; Cagliari (Italy ABS 8. Neonatal ECMO: initial experience of Hospital de São João • G. Rocha, P. Soares, T. Henriques-Coelho, J. Correia-Pinto, J. Monteiro, H. Guimarães, R. Roncon-Albuquerque Jr; Porto (Portugal ABS 9. GCMS-based metabolomics analysis of urines in hypoxic neonatal piglets • C. Fattuoni, L. Barberini, N. Iacovidou, T

  7. Evaluation of child health care in the Family Health Program, in the southern region of Porto Alegre, Brazil Evaluación de la atención a la salud infantil del Programa Saúde da Família en la región sur de Porto Alegre, Brasil Evaluación de la atención a la salud infantil del Programa Saúde da Família en la región sur de Porto Alegre, Brasil

    Directory of Open Access Journals (Sweden)

    Erno Harzheim

    2010-11-01

    Full Text Available

    La atención primaria de salud (APS busca optimizar la salud y promover la equidad. Es definida, a través de SUS atributos, como el primer nivel de asistencia, caracterizándose por la continuidad e integralidad de la atención, la coordinación de la asistencia, la atención centrada en la familia, la orientación comunitaria y la aptitud cultural. En la literatura, se evidencia una creciente asociación entre sus atributos y una mayor efectividad y equidad de la atención sanitaria. Así, investigaciones que respondan preguntas complementarias sobre el binomio proceso/efectividad de la APS presentan relevancia internacional. En Brasil, desde 1994, el Ministerio de la Salud inició una estrategia de multiplicación de los servicios de atención básica llamada Programa Saúde da Familia (PSF. Esta estrategia, basada en los atributos de la APS, pretende complementar la red de servicios públicos ya existente, las Unidades Sanitarias (USs, aumentando el acceso AL Sistema Único de Saúde para la población más vulnerable. En 2002, el PSF ya atendía cerca de 30% de la población, más de 50 millones de personas, y seguía creciendo. Resulta importante, así, evaluar la extensión de los atributos de APS en los servicios de atención básica brasileños y su relación con la efectividad de la atención. Para ello fue necesario validar uma herramienta de medida de la extensión de los atributos de la APS, el Primary Care Assesment Tool (PCATool, para su uso em los servicios de atención a la salud infantil en Brasil. Además, se ha comparado la extensión de estos atributos entre El PSF y las USs de Porto Alegre, municipio del sur de Brasil, y la relación entre estos atributos y la satisfacción de los cuidadores de los niños que consultaban en estos servicios, la salud percibida por los cuidadores y la cobertura de actividades preventivas realizadas. Se ha realizado estudio transversal, a través de encuestas estructuradas incluyendo El