WorldWideScience

Sample records for bledo pira creciendo

  1. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa 'PiraRoxa': triple red lettuce cultivar

    OpenAIRE

    Fernando César Sala; Cyro Paulino da Costa

    2005-01-01

    'PiraRoxa' é uma cultivar de alface (Lactuca sativa L.) crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004) o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado...

  2. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa 'PiraRoxa': triple red lettuce cultivar

    Directory of Open Access Journals (Sweden)

    Fernando César Sala

    2005-03-01

    Full Text Available 'PiraRoxa' é uma cultivar de alface (Lactuca sativa L. crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004 o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado às cvs. Banchu New Red Fire e Loretta, respectivamente. Trata-se da primeira cultivar tropicalizada para o segmento de alface vermelha com resistência a doenças no Brasil.'PiraRoxa' is a triple red leaf lettuce (Lactuca sativa L. cultivar resistant to Bremia lactucae, Thielaviopsis basicola and LMV, pathotype II. This cv. was obtained through pedigree selection from the cross between a Lolla Rossa 'RS 521998' and cv. Gizela. This shiny and intense red lettuce presents vigorous plants with loose leaves. In summer trials (2003/2004 'PiraRoxa' presented slow bolting performance (10 to 20 days later in comparison to cvs. Banchu New Red Fire and Loretta. This is the first tropicalized red leaf lettuce with multiple disease resistance developed in Brazil.

  3. 'PiraRoxa': cultivar de alface crespa de cor vermelha intensa

    OpenAIRE

    Sala,Fernando César; Costa,Cyro Paulino da

    2005-01-01

    'PiraRoxa' é uma cultivar de alface (Lactuca sativa L.) crespa de cor vermelha intensa, resistente à Bremia lactucae, Thielaviopsis basicola e LMV, patótipo II. Foi selecionada por meio do método genealógico a partir do cruzamento entre o tipo Lolla Rossa 'RS 521998' e a cv. Gizela. Apresenta plantas grandes e vigorosas, folhas crespas, coloração vermelha intensa e brilhante. Em ensaios conduzidos no verão (2003/2004) o pendoamento da 'PiraRoxa' foi de 10 e 20 dias mais lento quando comparado...

  4. Bromeliaceae from Pico Piraí, Guaratuba Municipality (Parana, Brazil Bromeliaceae Juss. do Pico Piraí, município de Guaratuba (Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Rosemeri Morokawa

    2011-12-01

    Full Text Available The results of a Bromeliaceae Juss. floristic survey in the Piraí Mountain, Araraquara complex(Guaratuba Municipality, Paraná State are presented. Twenty six species included in nine genera and three subfamilies were registered. Bromelioideae presented the highest genera diversity and Tillandsioideae showed the highest species diversity, including twelve species belonging to the genus Vriesea (46%. It was the first register of Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vrieseaflava And.Costa, H. Luther & Wand., Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm. at the Guaratuba Municipality. Dyckia leptostachya Baker was collected for the first time at the coastal zone of Paraná State, being this record done after 40 years since its last register in the State. For each species, information on phenology, geographic distribution and vulnerability level are included. Apresentam-se resultados de levantamento florístico das espécies de Bromeliaceae Juss. no Pico Piraí, Complexo do Araraquara (Guaratuba, Paraná. Verificou-se a ocorrência de 26 espécies pertencentes a nove gêneros e três subfamílias. Bromelioideae englobou a maior diversidade de gêneros e Tillandsioideae registrou-se a maior diversidade de espécies, sendo 12 delas incluídas no gênero Vriesea (46%. As seguintes espécies foram registradas pela primeira vez no município de Guaratuba: Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vriesea flava And. Costa, H. Luther & Wand.,Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm.. Dyckia leptostachya Baker foi registrada pela primeira vez na zona litorânea paranaense e após 40 anos do último

  5. A tale of two very different comets: ISO and MSX measurements of dust emission from 126P/IRAS (1996) and 2P/Encke (1997)

    Science.gov (United States)

    Lisse, C. M.; Fernández, Y. R.; A'Hearn, M. F.; Grün, E.; Käufl, H. U.; Osip, D. J.; Lien, D. J.; Kostiuk, T.; Peschke, S. B.; Walker, R. G.

    2004-10-01

    We present the characteristics of the dust comae of two comets, 126P/IRAS, a member of the Halley family (a near-isotropic comet), and 2P/Encke, an ecliptic comet. We have primarily used mid- and far-infrared data obtained by the ISOPHOT instrument aboard the Infrared Space Observatory (ISO) in 1996 and 1997, and mid-infrared data obtained by the SPIRIT III instrument aboard the Midcourse Space Experiment (MSX) in 1996. We find that the dust grains emitted by the two comets have markedly different thermal and physical properties. P/IRAS's dust grain size distribution appears to be similar to that of fellow family member 1P/Halley, with grains smaller than 5 microns dominating by surface area, whereas P/Encke emits a much higher fraction of big (20 μm and higher) grains, with the grain mass distribution being similar to that which is inferred for the interplanetary dust population. P/Encke's dearth of micron-scale grains accounts for its visible-wavelength classification as a "gassy" comet. These conclusions are based on analyses of both imaging and spectrophotometry of the two comets; this combination provides a powerful way to constrain cometary dust properties. Specifically, P/IRAS was observed preperihelion while 1.71 AU from the Sun, and seen to have a 15-arcmin long mid-infrared dust tail pointing in the antisolar direction. No sunward spike was seen despite the vantage point being nearly in the comet's orbital plane. The tail's total mass at the time was about 8×10 9 kg. The spectral energy distribution (SED) is best fit by a modified greybody with temperature T=265±15 K and emissivity ɛ proportional to a steep power law in wavelength λ: ɛ∝ λ- α, where α=0.50±0.20 (2σ) . This temperature is elevated with respect to the expected equilibrium temperature for this heliocentric distance. The dust mass loss rate was between 150-600 kg/s (95% confidence), the dust-to-gas mass loss ratio was about 3.3, and the albedo of the dust was 0.15±0

  6. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae in Piraí do Sul, Paraná, southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda G. Braga

    2010-06-01

    Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although

  7. Efectividad del programa educativo“Creciendo Saludable”en los conocimientos, actitu- des y prácticas sobre lactancia materna exclusiva en las madres con niños menores de 6 meses, del Programa Integral de Nutrición del Hospital de Huaycán, Lima, 2011.

    OpenAIRE

    Callacondo Quispe, Juana Candelaria; Chanducas Lozano, Bertha

    2011-01-01

    Objetivo: El objetivo de esta investigación fue determinar la efectividad del Programa Educativo “Creciendo Sa- ludable” en conocimientos, actitudes y prácticas sobre lactancia materna exclusiva en las madres con niños menores de 6 meses. Metodología: El tipo de estudio empleado fue longitudinal pre-experimental con pre-test y post-test de un solo grupo. La intervención fue realizada a 35 madres con niños menores 6 meses de edad del Programa Integral de Nutrición del Hospital de Huaycán - Lim...

  8. Elaboración y Aplicación de un Manual de Convivencia Familiar, Creciendo Juntos para Mejorar la Relación Intrafamiliar de los Estudiantes de Decimo Grado de Educación Básica de la Unidad Educativa "Juan Bautista Vasquez" del Cantón Azoguez Provincia del Cañar en el periodo 2013-2014

    OpenAIRE

    Quito Sánchez, Luis Alfredo

    2015-01-01

    Esta investigación está relacionada con el mejoramiento de las relaciones intrafamiliares a través de talleres de escuela para padres y la elaboración conjunta de un Manual de Convivencia Creciendo Juntos para los estudiantes del décimo año de Educación Básica y sus padres de la Unidad Educativa Juan Bautista Vásquez del Cantón Azogues Provincia del Cañar, manejando de manera adecuada técnicas grupales tanto con los estudiantes como con los padres de familia. En los talleres se promovió a la ...

  9. Una bola de nieve está creciendo en los servicios sanitarios: los pacientes supervivientes de cáncer The growing snowball in health services: long-term cancer survivors

    Directory of Open Access Journals (Sweden)

    Tàrsila Ferro

    2011-06-01

    Full Text Available Una de las consecuencias del progreso en el diagnóstico y el tratamiento del cáncer es el aumento de la supervivencia observado en las últimas décadas en Europa y en España. El número de nuevos casos de cáncer continúa aumentando principalmente debido al envejecimiento de la población, por lo que es previsible que el número de personas que viven años tras un diagnóstico de cáncer continúe creciendo. Este hecho supone un elemento de presión a los sistemas sanitarios, que muestran sus limitaciones para atenderlos con el modelo actual de seguimiento. Deben plantearse nuevos escenarios asistenciales, tanto desde la perspectiva de la gestión sanitaria como de la clínica. A pesar de no haber suficiente evidencia científica sobre cómo sistematizar el seguimiento de los casos, se están impulsando diversas estrategias, sobre todo en otros países, para lograr una mayor adecuación en la provisión de servicios a estos pacientes. En España tales experiencias son muy escasas, pero dada la situación emergente, que bien puede ser comparada a un efecto en bola de nieve, se requiere la revisión y la reformulación del modelo actual para ofrecer una respuesta más efectiva y ajustada a la realidad. El propósito de este artículo es identificar las prioridades de atención de estos pacientes desde el punto de vista sanitario, revisar los modelos organizativos que se ensayan en otros países y proponer un marco de referencia, basado en la integración de niveles asistenciales, incluyendo atención primaria de la salud, que es la Cenicienta en este problema, como aproximación a un modelo que permita evaluar las mejores opciones asistenciales para estos pacientes en nuestro entorno sanitario.One of the consequences of diagnostic and therapeutic progress in cancer is the increased survival observed in the last few decades in Spain and elsewhere in Europe. New cancer cases are increasing steadily due to population aging, among other factors

  10. Creciendo emocionalmente. Desarrollo de las competencias socioemocionales en el 1r Ciclo de Primaria

    OpenAIRE

    Olmedo-Fernández, Eva

    2013-01-01

    Este trabajo propone una propuesta de intervención para mejorar las competencias socioemocionales de los alumnos de Primer Ciclo de Educación Primaria. Su objetivo es aportar una visión general de los beneficios de la educación emocional en el desarrollo de la personalidad del alumnado. Se inicia con un breve repaso de aspectos teóricos clave en esta materia, definiendo conceptos tales como emoción, inteligencia emocional, educación emocional y habilidades sociales. A continuación, se inci...

  11. Early Book Stages, 0-5 Years [and] Creciendo con Libros (Growing [up] with Books). [Videotape.

    Science.gov (United States)

    Holguin, Roxanna

    Using a lighthearted and simple approach, this 23-minute videotape in English and Spanish versions presents interactions between parents and children while reading books. The children in the videotape range in age from 0 to 5 years. The video is introduced by scenes of children enjoying books while narration discussing the impact of reading to…

  12. Papá Noel en la pira (Father Christmas on the Pyre

    Directory of Open Access Journals (Sweden)

    Claude Lévi-Strauss

    2010-05-01

    Full Text Available En “Papá Noel en la pira”, Lévi-Strauss desdobla la aproximación al noble anciano en una pesquisa histórica y en otra etnológica. La primera lo lleva a leyendas medievales en las que sobreviven festividades del Imperio Romano y oscuras celebraciones en las que niños y muertos se confunden. La segunda sumerge al lector en una especulación acerca de la relación entre los vivos y los muertos que toma por excusa las katchina de los indios de Norteamérica. Al cabo, constata que esta figura mediadora enmascara la presencia de la muerte y tiende a negarla.

  13. Creciendo Sin Drogas: Guia de Prevencion para Padres (Growing Up Drug-Free: A Parent's Guide to Prevention).

    Science.gov (United States)

    Office of Elementary and Secondary Education (ED), Washington, DC. Safe and Drug Free Schools Program.

    This publication is part of the Department of Education's ongoing effort to provide information to emerging populations in their native language on how to create and maintain drug-free and safe schools across the nation. Throughout the publication are personal stories and artwork of elementary and secondary school students that promote the message…

  14. Biology and conservation status of Piraja’s Lancehead Snake Bothrops piraña Amaral, 1923 (Serpentes: Viperidae, Brazil

    Directory of Open Access Journals (Sweden)

    M.A.D. Freitas

    2014-09-01

    Full Text Available The venomous snake Bothrops pirajai (Amaral, 1923 is endemic to Brazil. Despite being described almost a century ago, very little is known about this species, which has never been studied in situ. Here, we present new data on the biology and natural history of B. pirajai based on a review of existing museum specimens and a field study (1504 man hours carried out throughout the species range. The distribution of B. pirajai was found to be restricted to the eastern Atlantic forest of the state of Bahia, Brazil, between Todosos Santos Bay, Itabuna and Ilhéus (12050’S-14050’S, 88-835 m. We recommend the species be uplisted to Endangered in the International Union for the Conservation of Nature’s global Red List of Threatened Species as its estimated extent of occurrence is under 5000km2. The effective conservation of B. pirajai will rely on addressing two key issues: improving our knowledge of the species and successfully mitigating habitat loss and fragmentation.

  15. La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-12-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  16. Chlorofluorocarbons (CFC's): Regulation and replacement. (Latest citations from the PIRA Ppackaging, Paper, Printing, and Publishing, and Nonwovens abstracts database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The bibliography contains citations concerning chlorofluorocarbons (CFC's), and efforts to find substitute materials in response to the need to lessen the environmental impact of CFC on the ozone layer, as agreed to in the international Montreal Protocol. CFC alternatives are expected to be used as aerosol propellants, blowing agents, refrigerants, fire extinguishants, and solvents. References to the effects of CFC on ozone are found in separate bibliographies. (Contains 250 citations and includes a subject term index and title list.)

  17. “Sou caipira pira pora...”: representations of the provincial, from the parasite of the land to the paradigm of national reality (1889-1945“Sou caipira pira pora...”: representações sobre o caboclo, do parasita da terra a paradigma da realidade nacional (1889-1945

    Directory of Open Access Journals (Sweden)

    Jonathan de Oliveira Molar

    2009-04-01

    Full Text Available This paper is aimed at discussing the representations about the hillbilly, the national peasant based on visions of two intellectuals: writer Monteiro Lobato and painter José Ferraz de Almeida Jr. Therefore, both literature and iconographic sources will support an analysis of the living standards of the rustic, as found in the historical period covered – 1889 until 1945. Contributions from authors who work with image analysis will be used as method, such as Henry Silva’s and Ana M. Mauad’s, and authors who work with the said period and the provincial issue: Lilia Schwarcz, Glauco Barsalini and Antonio Candido. O presente trabalho se propõe a discutir as representações elaboradas acerca do caboclo, do caipira nacional a partir das visões de dois intelectuais: o escritor Monteiro Lobato e o pintor José Ferraz de Almeida Júnior. Desse modo, analisar tanto na literatura quanto no conjunto iconográfico o ir e vir que perpassa as considerações sobre o modo de vida do caboclo, de acordo com o período histórico abordado – de 1889 até 1945. Para tanto, utiliza-se de autores que trabalham com análise de imagens, tais como: Henrique Silva e Ana M. Mauad; e, autores que trabalham com o citado período e a questão cabocla: Lilia Schwarcz, Glauco Barsaline e Antônio Cândido.

  18. PirAB toxin from Photorhabdus asymbiotica as a larvicide against dengue vectors.

    Science.gov (United States)

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-07-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of PirA plus PirB, has any impact on biological control efficacy needs further investigation.

  19. Protein (Cyanobacteria): 249773 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782242.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAQLWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCQEGQRFGALKSGKRQG

  20. Protein (Cyanobacteria): 249820 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09780023.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREELIAQIEQMEPEGLVYLDEAGMNSSDSDYPYGYCEEGTTLPMPSNQGRGKGRGELYGPRGLNNNFLTPL ...

  1. Protein (Cyanobacteria): 249770 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782144.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  2. Protein (Cyanobacteria): 249781 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781797.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERDEQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSMIAAWCHQQLLAPF

  3. Protein (Cyanobacteria): 144862 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNLSRILRETSKQNHYDGCGFQNPAGMKKAGMGIPTIQDRAKQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYLCINHSDYYVLDADIACETFRSEIGLQCLK ...

  4. Protein (Cyanobacteria): 249776 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09783561.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MKKIGFTRKKTYGYQERWKQQREEFIAQIEQMEPEGLVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQGRVSYMAPWCDQQLLAPF

  5. Protein (Cyanobacteria): 144863 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ded protein LtrA-like (Includes: Reverse-transcriptase ; RNA maturase ; HNH endonuclease) (fragment) Arthros...pira sp. PCC 8005 MNWLRALREISKPNHCDGCGFQNLEGMKKAGMGIPTIQDRARQALVKSALEPEWESRFEGTSYGFRPGRSAQDAIARIYSSINKGEYFVLDAGARRSGMK ...

  6. Protein (Cyanobacteria): 249772 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781578.1 1117:4644 1150:2740 35823:86 376219:14 transposase (fragment) Arthros...pira sp. PCC 8005 MAELWDDDISPRTISRALKKIGFTRKKTYGYQERWKQQREEFMAQIEQMEPQEVVYLDEAGMNSQDSDYPYGYCEEGKRFHALKSGKRQG

  7. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel

    2012-09-01

    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los 20 y 66 DDS, respectivamente, y también se redujo a una menor saturación de Al. En suelos con 60% de saturación de Al se observó una gran producción de esporas a los 41 DDS, siendo 'Aurora' el de más alta densidad de esporas a los 66 DDS. A los 20 DDS se observó una relación negativa (r = -0.37, p < 0,001 entre la colonización MA temprana y la masa de las raíces. Además, dicha relación fue más fuerte (r = -0.49, p < 0,001 cuando las plantas fueron cultivadas en alta saturación de Al. Una temprana colonización MA se observó en todos los cultivares ensayados cuando se cultivaron en alta saturación de Al y fue superior en las variedades aparentemente más tolerantes a Al, sugiriendo que una temprana colonización MA puede ser un factor importante en la tolerancia a Al para plantas agrícolas cultivadas en suelos ácidos.

  8. Field Insect Pests and Crop Damage Assessment of Pigeon Pea (Cajanus cajan [L.] Huth grown under Ratoon and in Mixture with Maize Evaluación de Campo de Insectos Pestes y Daño del cultivo de Gandul (Cajanus cajan [L.] Huth creciendo bajo Rebrotes o en Mezcla con Maíz

    Directory of Open Access Journals (Sweden)

    Madang A Dasbak

    2012-03-01

    Full Text Available The widespread adoption of cropping systems that are sustainable and environmentally friendly is vital for the macroeconomic survival of civilization. Intercropping could ensure stability of insect populations in a system. A 3-yr (2005-2007 field trial was therefore carried out in Nigeria under regular and ratoon crops to evaluate five recently developed pigeon pea (Cajanus cajan [L.] Huth genotypes (ICPL 87, ICPL 161, ICPL 85063, ICP 7120, and ICPL 87119 from the International Crops Research Institute for Semi-Arid Tropics (ICRISAT and one local variety for their relative performance and susceptibility to insect pests. The pigeon pea genotypes were in a mixture with two maize genotypes (Zea mays L., open-pollinated and hybrid in regular crops for 2 yr (2005-2006 followed by a ratoon crop for 1 yr (2007. Termites (Odontotermes badius, crickets (Gymnogryllus lucens, and variegated grasshoppers (Zonocerus variegatus were the crop's seedling pests and caused minimal damage. Clavigralla spp. infestations were high at the reproductive stage causing 24% and 29% seed damage in regular and ratoon pigeon pea crops, respectively. Maize slightly suppressed insect pest incidence and damage to pigeon pea pods and seeds but significantly (P La extendida adopción de sistemas de cultivo que son sustentables y benignos para el medio ambiente es vital para la supervivencia macro-económica de la civilización. El intercultivo podría asegurar la estabilidad de población de insectos en un sistema. Un ensayo de campo de 3 anos (2005-2007 fue realizado en Nigeria bajo condiciones de cultivo regular y ratoon para evaluar cinco genotipos de poroto gandul (Cajanus cajan [L.] Huth: ICPL 87, ICPL 161, ICPL 85063, ICP 7120, e ICPL 87119 desde International Crops Research Institute for Semi-Arid Tropics (ICRISAT y una variedad local, por sus rendimientos y susceptibilidades relativas a insectos plaga. Los genotipos de poroto gandul estaban en mezcla con dos genotipos de maíz (Zea mays L., de polinización abierta e híbrido en cultivos regulares por 2 anos (2005-2006 seguido por un ratoon por 1 ano (2007. Termitas (Odontotermes badius, grillos (Gymnogryllus lucens y saltamontes variegado (Zonocerus variegatus fueron las plagas de plántula del cultivo, causando dano mínimo. Infestaciones con Clavigralla spp. fueron altas en el estado reproductivo causando 24% y 29% de dano seminal en cultivos regular y de poroto gandul ratoon. El maíz suprimió la incidencia de la plaga y el dano a las vainas y semillas de poroto gandul pero redujeron significativamente (P < 0,01 el rendimiento de grano en los cultivos de poroto gandul en 2005 y 2006, pero no en ratoon en 2007. Los genotipos de poroto gandul difirieron significativamente (P < 0,05 en incidencia de la plaga al estado de vaina en cultivos regular y ratoon y en rendimiento de grano (P < 0,01 bajo el cultivo regular. El rendimiento de granos de los cultivos de poroto gandul ratoon fue aproximadamente 60% de aquel del cultivo regular. Los genotipos ICPL 161 e ICPL 87 se recomendaron para adopción por los agricultores basados en tolerancia a las plagas y alto rendimiento de granos o como idiotipos en programas de hibridación de poroto gandul.

  9. Growing up with HIV/AIDS: a study on adolescents with HIV/AIDS and their family caregivers Creciendo con VIH/SIDA: un estudio con adolescentes portadoras de VIH/SIDA y sus cuidadoras familiares Crescendo com HIV/AIDS: estudo com adolescentes portadoras de HIV/AIDS e suas cuidadoras-familiares

    Directory of Open Access Journals (Sweden)

    Ana Amélia Antunes Lima

    2008-06-01

    Full Text Available This is an exploratory study with a qualitative approach, which looks at the adolescent process with HIV/AIDS. The purpose is to identify how the adolescent process occurs, from the perspective of these teenagers and their family caregivers. The investigation was performed in Porto Alegre, RS between May and July 2005, and the subjects were four adolescents and three caregivers. Data were collected by means of interviews, which were subject to the content analysis technique. The study revealed that both teenagers and family caregivers did not show concern with the changes typical of the period, especially regarding sexuality questions. Yet, the underlying diagnosis and coping with HIV remain in the family core in order to protect these agents against the stigma of the disease.Es un estudio exploratorio con abordaje cualitativo, que trata del proceso de desarrollo de la adolescencia en portadoras de VIH/SIDA, con el objetivo de identificar cómo ocurre el proceso de la adolescencia, en la visión de estas adolescentes y de sus cuidadoras familiares.La investigación se realizó en Porto Alegre-RS, entre los meses de mayo y julio de 2005; los sujetos fueron cuatro adolescentes y tres cuidadoras. La colecta de las informaciones se hizo por medio de entrevistas que fueron sometidas a la técnica de análisis de contenido. El estudio reveló que las adolescentes y sus cuidadoras familiares, manifestaron preocupación con los cambios propios de ese período, especialmente en asuntos relacionados a la sexualidad. Se hizo evidente que el diagnóstico y la convivencia con el VIH permanecen ocultos en el contexto familiar, con el objetivo de proteger, a estos actores, del estigma de la enfermedad.Estudo exploratório com abordagem qualitativa, que trata do processo de adolescer de portadoras de HIV/AIDS, com o objetivo de identificar como ocorre o processo da adolescência, na ótica dessas adolescentes e de suas cuidadoras-familiares. A investigação foi realizada em Porto Alegre, RS, entre os meses de maio e julho de 2005, sendo que os sujeitos foram quatro adolescentes e três cuidadoras. A coleta das informações ocorreu por meio de entrevistas que foram submetidas à técnica de análise de conteúdo. O estudo revelou que tanto as adolescentes quanto suas cuidadoras-familiares não manifestaram preocupação com as transformações próprias do período, especialmente nas questões que envolvem a sexualidade. Evidenciou-se que o diagnóstico e a convivência com o HIV ainda permanecem velados no círculo familiar, visando a proteção desses atores com relação ao estigma da doença.

  10. Análisis de la construcción de un aula con incorporación de materiales reciclados en la Escuela de Gestión Social Creciendo Juntos en Paso del Rey, Moreno, pcia. de Buenos Aires

    OpenAIRE

    Rossi, Silvia

    2016-01-01

    Dentro del ámbito del desarrollo sostenible, antes de comenzar cualquier diseño deben considerarse tres aspectos fundamentales: el social, el económico y el ambiental. Como bien se conoce, la actividad de la Construcción es responsable de una gran parte del mal uso de recursos naturales y los arquitectos tienen una responsabilidad ambiental y social en la reducción de la huella de carbono y ecológica. En este contexto se presenta el proyecto y la vinculación con la escuela de Autogestión Crec...

  11. PirAB Toxin from Photorhabdus asymbiotica as a Larvicide against Dengue Vectors▿

    OpenAIRE

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R.; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-01-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of P...

  12. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products.

    Science.gov (United States)

    El-Houssini, Ola M; Zawilla, Nagwan H; Mohammad, Mohammad A

    2013-01-01

    Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20-200, 20-1000 and 25-1000 μgmL(-1) for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations.

  13. Talcum Powder and Cancer

    Science.gov (United States)

    ... would not have the same type of potential bias, have not found an increased risk. For any ... well as journalists, editors, and translators with extensive experience in medical writing. Coggiola M, Bosio D, Pira ...

  14. Analysis of the genome of a Korean isolate of the Pieris rapae granulovirus enabled by its separation from total host genomic DNA by pulse-field electrophoresis.

    Directory of Open Access Journals (Sweden)

    Yong Hun Jo

    Full Text Available BACKGROUND: Most traditional genome sequencing projects involving viruses include the culture and purification of the virus particles. However, purification of virions may yield insufficient material for traditional sequencing. The electrophoretic method described here provides a strategy whereby the genomic DNA of the Korean isolate of Pieris rapae granulovirus (PiraGV-K could be recovered in sufficient amounts for sequencing by purifying it directly from total host DNA by pulse-field gel electrophoresis (PFGE. METHODOLOGY/PRINCIPAL FINDINGS: The total genomic DNA of infected P. rapae was embedded in agarose plugs, treated with restriction nuclease and methylase, and then PFGE was used to separate PiraGV-K DNA from the DNA of P. rapae, followed by mapping of fosmid clones of the purified viral DNA. The double-stranded circular genome of PiraGV-K was found to encode 120 open reading frames (ORFs, which covered 92% of the sequence. BLAST and ORF arrangement showed the presence of 78 homologs to other genes in the database. The mean overall amino acid identity of PiraGV-K ORFs was highest with the Chinese isolate of PiraGV (~99%, followed up with Choristoneura occidentalis ORFs at 58%. PiraGV-K ORFs were grouped, according to function, into 10 genes involved in transcription, 11 involved in replication, 25 structural protein genes, and 15 auxiliary genes. Genes for Chitinase (ORF 10 and cathepsin (ORF 11, involved in the liquefaction of the host, were found in the genome. CONCLUSIONS/SIGNIFICANCE: The recovery of PiraGV-K DNA genome by pulse-field electrophoretic separation from host genomic DNA had several advantages, compared with its isolation from particles harvested as virions or inclusions from the P. rapae host. We have sequenced and analyzed the 108,658 bp PiraGV-K genome purified by the electrophoretic method. The method appears to be generally applicable to the analysis of genomes of large viruses.

  15. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas Evaluation of cuban hemp, nut sedge, johnson grass and herb of grace extracts in weed control

    OpenAIRE

    Liliana Osorio Salazar; Francisco Antonio Valverde; Carmen Rosa Bonilla Correa; Manuel Salvador Sánchez Orozco; Carmen Elena Mier Barona

    2009-01-01

    En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique), Cyperus rotundus L (coquito), Sorghum bicolor L (sorgo), y Ruta graveolens L (ruda) sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga) y Amaranthus dubius Mart (bledo) y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo co...

  16. Tectono-volcanic control of fissure type vents for the 28 Ma Panalillo ignimbrite in the Villa de Reyes Graben, San Luis PotosI, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Tristan-Gonzalez, Margarito; Labarthe-Hernandez, Guillermo; Aguillon-Robles, Alfredo [Instituto de Geologia/DES IngenierIa, UASLP, Av. Dr. Manuel Nava 5, Zona Universitaria, C.P. 78240, San Luis PotosI, S.L.P. (Mexico); Aguirre-DIaz, Gerardo J [Centro de Geociencias, Universidad Nacional Autonoma de Mexico, Campus Juriquilla, Queretaro, 76230 (Mexico)], E-mail: mtiistan@uasln.mx, E-mail: ger@geociencias.unam.mx

    2008-10-01

    The volcano-tectonic events at the Villa de Reyes Graben (VRG), in the southern Sierra Madre Occidental, Mexico, include 1) a regional NNE fault system developed before 32 Ma, 2) this pre-32 Ma faulting controlled the emplacement of 31.5 Ma dacitic domes, 3) NE faulting at 28 Ma that displaced the 31.5 Ma dacitic domes and formed the VRG, as well as the oblique grabens of Bledos and Enramadas oriented NW, 4) emplacement of Panalillo ignimbrite at 28 Ma filling the VRG and erupting from fissures related to the oblique grabens, and eruption of Placa basalt apparently also from fault-controlled vents.

  17. INFOINCLUSÃO EM PIRAÍ DIGITAL: EVIDÊNCIAS EMPÍRICAS A PARTIR DA TEORIA ATOR-REDE

    Directory of Open Access Journals (Sweden)

    Adonai Teles

    2012-08-01

    Full Text Available O artigo apresenta o status quo do programa Piraí Digital, com base na Teoria Ator-Rede (ANT e no modelo heurístico de inclusão digital (2iD. Numa primeira etapa desta pesquisa, o modelo heurístico original foi expandido com base nos pressupostos da ANT, gerando uma versão mais adequada (e2iD para a observação do fenômeno da infoinclusão em Piraí. Em seguida, a ANT foi adotada como suporte metodológico para que os autores, por meio de entrevistas e observação direta, compreendessem, sob a ótica dos atores ouvidos, como a infoinclusão tem ocorrido no município de Piraí. A partir daí, os resultados são apresentados com base na taxonomia da ANT e dos elementos do modelo e2ID. O presente trabalho de pesquisa sobre a infoinclusão em Piraí começou em 2007 e se estendeu até os últimos meses de 2009. Concluiu-se que a inclusão digital em Piraí tem sido uma realidade na administração pública local, na educação e na saúde. Porém, percebeu-se que o setor produtivo e a sociedade civil local, pouco ou nada tem se beneficiado do programa em questão. Finalmente, foi possível compreender o papel dos vários atores públicos nas redes de atores da ANT e explicar porque os resultados de Piraí Digital não têm, até agora, impactado homogeneamente a sociedade local.

  18. Control Químico de Malezas en Fríjol en el Valle de Medellín

    Directory of Open Access Journals (Sweden)

    Carmona B. Carlos

    1972-08-01

    Full Text Available En el C.N.I.A "Tulio Ospina", se realizaron durante tres semestres consecutivos, ensayos sobre control de malezas en el cultivo de fríjol. Las malezas que predominaron durante el experimento fueron: hoja angosta: coquito y argentina; de hoja ancha: falsa uchuva, bledo, verdolaga, botoncillo, y cadillo falso. En cuanto a los herbicidas que controlaron malezas y no causaron fitotoxicidad al fríjol se pueden mencionar: vernolale, a las dosis de 3.0 y 5.0 Kg. I.A./Ha., el cual fue bastante efectivo para el control de malezas de hoja angosta, pero, poco o nada efectivo para las malezas de hoja ancha. Metobromurón y C-6313, en la dosis de 2.0 Kg. I.A./Ha., presentaron buen control de todas las malezas, excepto el coquito. El DNBP a la dosis de 6.0 Kg. I.A./Ha., en sus dos forma (Premerge y Caldón presentó un buen control de toda las malezas, excepto el coquito y el bledo. Es importante mencionar el efecto de malezas que se consideran de segundo orden. Estas, una vez eliminadas las malezas primarias, se desarrollan con gran agresividad y pueden llegar a ocasionar pérdidas aún mayores. Esta situación se presentó principalmente en relación con el bledo y la falsa uchuva. De las anteriores conclusiones se deduce que para hacer recomendaciones es necesario tener muy en cuenta las malezas predominantes./Abstract Three different tests with herbicides on beans were made during 3 consecutive semesters in the C.N.I.A. Tulio Ospina in the Medellín valley. The weeds present were: coquito (Cyperus rotundus, pasto Argentina (Cynodon dactylon, falsa uchuva (Nycandra physalodes, bledo (Amaranthus sp., verdolaga (Portulaca oleracea, botoncillo (Galinsoga parviflora y cadillo falso (XanthiulIl occidentale. The herbicides tested and their doses were: C-63l3 (LO, 1.5 and 2.0 kg., A. I. /Ha.; Bensulide (4.0 and 6.0 kg. A.I. /Ha.; Vernolate (3.0, 5.0 and 6.0 kg. A. I. /Ha.; Fluometuron (2.0 kg. A. I. /Ha.; Trifluralina (1.5 and 2.0 kg. A. I. /Ha.; DNBP (P

  19. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae, e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Oscar A. Shibatta

    2005-12-01

    Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.

  20. A New Typology for State-Sponsored International Terrorism

    Science.gov (United States)

    2011-12-01

    Organization NIF National Islamic Front PIJ Palestinian Islamic Jihad PIRA Provisional Irish Republican Army WMD Weapons of Mass Destruction xii THIS PAGE...Islamic Front ( NIF ) to power. The party’s leader, Hassan al-Turabi, sought to establish an Islamist state in Sudan and offered sanctuary for Islamic

  1. Primer-introduced restriction analysis polymerase chain reaction method for non-invasive prenatal testing of β-thalassemia.

    Science.gov (United States)

    Liu, Saijun; Chen, Liyuan; Zhang, Xiandong; Li, Jian; Lin, Haiying; Liu, Louhui; Xie, Jiansheng; Ge, Huijuan; Ye, Minglan; Chen, Caifen; Ji, Xingwen; Zhang, Caifen; Xu, Fengping; Jiang, Hui; Zhen, Hefu; Chen, Shiping; Wang, Wei

    2015-01-01

    We have developed a new method for non-invasive prenatal testing (NIPT) of paternally inherited fetal mutants for β-thalassemia (β-thal). Specially designed primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR) were used to detect four major mutations [IVS-II-654, HBB: c.316-197C > T; codon 17 (A > T), HBB: c.52A > T; -28 (A > G), HBB: c.-78A > G and codons 41/42 (-TTCT), HBB: c.126_129delCTTT] causing β-thal in China. The PIRA-PCR assay was first tested in a series of mixed DNA with different concentrations and mixed proportions. Subsequently, this assay was further tested in 10 plasma DNA samples collected from pregnant women. In the DNA mixture simulation test, the PIRA-PCR assay was able to detect 3.0% target genomic DNA (gDNA) mixed in 97.0% wild-type gDNA isolated from whole blood. For plasma DNA testing, the results detected by PIRA-PCR assay achieved 100.0% consistency with those obtained from the amniocentesis analysis. This new method could potentially be used for NIPT of paternally inherited fetal mutants for β-thal.

  2. NCBI nr-aa BLAST: CBRC-HSAP-06-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0001 sp|Q01456|OAM_ASCSU Ovarian abundant message protein (Protein OAM...) pir||A48461 ovarian abundant message protein oam - common roundworm gb|AAA73355.1| [Ascaris lumbricoides mRNA sequence.], gene product Q01456 2e-11 52% ...

  3. NCBI nr-aa BLAST: CBRC-HSAP-02-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-02-0005 sp|Q01456|OAM_ASCSU Ovarian abundant message protein (Protein OAM...) pir||A48461 ovarian abundant message protein oam - common roundworm gb|AAA73355.1| [Ascaris lumbricoides mRNA sequence.], gene product Q01456 2e-06 28% ...

  4. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  5. Understanding Why Terrorist Operations Succeed or Fail

    Science.gov (United States)

    2009-01-01

    they can draw when deciding how many members are devoted to a particular attack.13 Large groups (e.g., PIRA, Hezbollah, or the Liberation Tigers of...the food supply: The case of botulinum toxin in milk ,” Proceedings of the National Academy of Sciences, Vol. 102, No. 28, 2005, pp. 9984–9989.

  6. Disease: H01159 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01159 Anterior segment dysgenesis (ASD), including: Anterior segment mesenchymal d...ysgenesis; Aniridia; Axenfeld-Rieger syndrome (ARS); Peters anomaly; Iridogoniodysgenesis (IRID) Anterior se...OMIM: 107250 106210 180500 602482 604229 601631 137600 261540 PMID:18989383 Summers KM, Withers SJ, Gole GA, Piras S, Taylor PJ Anter...ior segment mesenchymal dysgenesis in a large Australian family is associated with

  7. Micropropagação de cebola a partir de bulbinhos induzidos in vitro Micropropagation of onion from in vitro induced bulblet

    Directory of Open Access Journals (Sweden)

    Benedita Maria Rodrigues

    1996-01-01

    Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the

  8. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    Directory of Open Access Journals (Sweden)

    Filip Cvitić

    2014-07-01

    Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.

  9. Dicty_cDB: VSD680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nces producing significant alignments: (bits) Value VSD680 (VSD680Q) /CSM/VS/VSD6-D/VSD680Q.Seq.d/ 228 1e-59...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N (...quences producing significant alignments: (bits) Value (Q6UK63) RecName: Full=Protein pirA; &AY368270_1(AY36

  10. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  11. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  12. Approaches Towards the Identification of Patterns in Violent Events, Baghdad, Iraq

    Science.gov (United States)

    2009-05-01

    Gianfranco Piras May 2009 C on st ru ct io n E n gi n ee ri n g R es ea rc h L ab or at or y Approved for public release; distribution is... GIS operations. Julia Koschinsky provided logistical support. The report and its findings are those of the authors alone, and should not be attributed...news sources. While precise geocoding was not possible, there was sufficient information in the reports to associate each event with a neighborhood. A

  13. Killing Range: Explaining Lethality Variance within a Terrorist Organization.

    Science.gov (United States)

    Asal, Victor; Gill, Paul; Rethemeyer, R Karl; Horgan, John

    2015-04-01

    This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for careful IED usage, which significantly minimizes civilian casualties (a specific strategic goal of PIRA) while increasing the ability to kill more high value targets with IEDs. Lethal counter-terrorism events also significantly affect a brigade's likelihood of killing both civilians and high-value targets but in different ways. Killing PIRA members significantly decreases IED fatalities but also significantly decreases the possibility of zero civilian IED-related deaths in a given year. Killing innocent Catholics in a Brigade's county significantly increases total and civilian IED fatalities. Together the results suggest the necessity to analyze dynamic situational variables that impact terrorist group behavior at the sub-unit level.

  14. Déficit y oportunidades de la legislación costarricense sobre comercio electrónico: Un aporte desde la perspectiva de la seguridad, la protección de datos y los derechos del consumidor.

    OpenAIRE

    Chen Sui, Susan

    2013-01-01

    El comercio electrónico se ha desarrollado en los últimos años a un nivel mundial. De acuerdo con el Informe de la UNCTAD (2003), la Economía Digital sigue creciendo con gran empuje. En lo que se refiere a la utilización de Internet, el Informe indica que los países en desarrollo sigue n creciendo a un ritmo más rápido que los países desarrollados. A fines de 2002, el número de usuarios de Internet de los países en desarrollo representaban el 32% de los 591 millones de usuarios...

  15. Plan de educación alimentario nutricional para niños y niñas de 0 a 5 años del proyecto Municipio de Mira.

    OpenAIRE

    De Jesús Méndez, Marcia Noemí

    2013-01-01

    Mejorar las condiciones de nutrición y alimentación de los niños y niñas de 0 a 5 años con bajo peso del Proyecto CNH (Creciendo con nuestros Hijos) Municipio de Mira. El propósito fundamental es investigar el estado nutricional de los niños y niñas de 0 a 5 años que participan en el programa creciendo con nuestros hijos del Municipio de Mira provincia del Carchi. Para lo cual el estudio se desarrolló en cinco capítulos, en el primero se planteó el problema de investigación, objetivos y ju...

  16. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  17. Primer registro del género sapranthus (annonaceae) y una nueva especie para suramérica

    OpenAIRE

    VÉLEZ-ARANGO, JUAN GONZALO; COGOLLO-PACHECO, ÁLVARO

    2012-01-01

    Se describe e ilustra una nueva especie, Sapranthus isae que se diferencia de las otrasespecies del género por sus flores fragantes y por presentar cuerpos elípticos negros en labase de los pétalos internos. La nueva especie sólo se conoce del norte de Colombia enel departamento del Cesar, Municipio de Curumaní, creciendo en afloramientos rocososde la cordillera Oriental, que se encuentran rodeados de sistemas cenagosos

  18. Comunicándonos con las cosas

    OpenAIRE

    Miguel Delgado; Sergio Ciruela; Nicolás Marín

    2009-01-01

    Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  19. Análise sensorial, teores de nitrato e de nutrientes de alface cultivada em hidroponia sob águas salinas Sensory analysis, nitrate and nutrient concentration of lettuce grown in hydroponics under saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2012-03-01

    Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of

  20. Dual Effects of IL-1 Overactivity on the Immune System in a Mouse Model of Arthritis due to Deficiency of IL-1 Receptor Antagonist

    Institute of Scientific and Technical Information of China (English)

    Jian Yan; Yan Jiao; Hong Chen; Feng Jiao; Karen A.Hasty; John M.Stuart; Weikuan Gu

    2013-01-01

    Previous studies have revealed the significance of cytokine interleukin 1 (IL-1) in the onset and progression of meumatoid arthritis (RA).The precise molecular mechanisms related to IL-1 underlying RA is still elusive.We conducted a whole genome-wide transcriptomal comparison of wild-type (WT) and arthritis-prone IL-1 receptor antagonist (IL-Irn) deficient BALB/c mice to address this issue.To refine our search efforts,gene expression profiling was also performed on paired wild-type and arthritis-resis nt IL-1m deficient DBA/1 mice as internal controls when identifying causative arthritis candidate genes.Two hundred and fifteen trans dpts were found to be dysregulated greater than or equal to 2-fold in the diseased mice.The altered transcriptome in BALB/c mice revealed increased myeloid cell activities and impaired lymphocyte functionality,suggesting dual regulatory effects of IL-1 hyperactivil on immunological changes associated with arthritis development.Phase-specific gene expression changes were identified,such as early increase and late decrease of heat shock protein coding genes.Moreover,common gene expression changes were also observed,especially the upregulation of paired Ig-like receptor A (Pira) in both early and late phases of arthritis.Real-time PCR was performed to validate the expression of Pira and an intervention experiment with a major histocompatibility complex (MHC) class I inhibitor (brefeldin A) was carried out to investigate the role of suppressing Pira activity.We conclude that global pattern changes of common and distinct gene expressions may represent novel opportunities for better control of RA through early diagnosis and development of alternative therapeutic strategies.

  1. PIR-B-deficient mice are susceptible to Salmonella infection.

    Science.gov (United States)

    Torii, Ikuko; Oka, Satoshi; Hotomi, Muneki; Benjamin, William H; Takai, Toshiyuki; Kearney, John F; Briles, David E; Kubagawa, Hiromi

    2008-09-15

    Paired Ig-like receptors of activating (PIR-A) and inhibitory (PIR-B) isoforms are expressed by many hematopoietic cells, including B lymphocytes and myeloid cells. To determine the functional roles of PIR-A and PIR-B in primary bacterial infection, PIR-B-deficient (PIR-B(-/-)) and wild-type (WT) control mice were injected i.v. with an attenuated strain of Salmonella enterica Typhimurium (WB335). PIR-B(-/-) mice were found to be more susceptible to Salmonella infection than WT mice, as evidenced by high mortality rate, high bacterial loads in the liver and spleen, and a failure to clear bacteria from the circulation. Although blood levels of major cytokines and Salmonella-specific Abs were mostly comparable in the two groups of mice, distinct patterns of inflammatory lesions were found in their livers at 7-14 days postinfection: diffuse spreading along the sinusoids in PIR-B(-/-) mice vs nodular restricted localization in WT mice. PIR-B(-/-) mice have more inflammatory cells in the liver but fewer B cells and CD8(+) T cells in the spleen than WT mice at 14 days postinfection. PIR-B(-/-) bone marrow-derived macrophages (BMMphi) failed to control intracellular replication of Salmonella in vitro, in part due to inefficient phagosomal oxidant production, when compared with WT BMMphi. PIR-B(-/-) BMMphi also produced more nitrite and TNF-alpha upon exposure to Salmonella than WT BMMphi did. These findings suggest that the disruption of PIR-A and PIR-B balance affects their regulatory roles in host defense to bacterial infection.

  2. Ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil fosfônico e a dormência e produtividade de tubérculos de batata Giberellic acid, carbon-disulphide and 2-4 chloro-ethyl phosphonic and the dormancy and yield of potato tubers

    Directory of Open Access Journals (Sweden)

    Ricardo Antonio Ayub

    1999-01-01

    Full Text Available Com o objetivo de avaliar a eficiência do ácido giberélico, bissulfureto de carbono e ácido 2-4 cloroetil-fosfônico (EthrellR na quebra de dormência e na produção de batata, cv. "Marijke", foi conduzido um ensaio no período de 1990/ 91 em Piraí do Sul, PR . A superioridade do tratamento com o ácido 2-4-cloroetil-fosfônico em relação ao ácido giberélico e ao bissulfureto de carbono, aliada a sua facilidade de aplicação, justifica a sua recomendação com vistas a quebra de dormência de tubérculos do genótipo de batata em estudo, para a região de Piraí do Sul, PR, onde a dose de 842 mg.L-1 de EthrellR ocasionou a produção máxima de 23395 kg/ha.In order to evaluate the efficiency of giberellic acid, carbon-disulphide, and 2-4 chloro-ethyl phosphonic acid (EthrellR on dormancy breaking and yield of potato cv. 'Marijke', an essay was conducted at Piraí do Sul, PR, Brazil, during 1990/1991. The superiority of the EthrellR treatment over giberellic acid and carbon-disulphide, and its easy application, justify its use for dormancy breaking of potato tubers, for the studied genotype and location, at the rate of 842 mg.L-1, resulting in a potato yield of 23,395 kg/ha.

  3. Uso da taxocenose de peixes como indicadora de degradação ambiental no rio Paraíba do Sul, Rio de Janeiro, Brasil

    OpenAIRE

    Francisco Gerson Araújo

    1998-01-01

    An adaptation of index of biotic integrity (IBI) was performed for the first time in Brazil at the Rio Paraíba do Sul, between Barra Mansa and Barra do Piraí, a very important extent of this river because of the high pollution levels, and for being the main abstraction source of Rio de Janeiro city water supply. A monthly standardised sampling programme, from March-1995 to February-1996, was carried out at four sites. Seines, casting nets and net trays were used for catching fishes. IBI was o...

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1085 ref|NP_240139.1| high-affinity zinc uptake system membrane protein Zn...uB [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] sp|P57402|ZNUB_BUCAI High-affinity zinc uptake s...ystem membrane protein znuB pir||A84967 hypothetical protein znuB [imported] - Buchnera sp. (strain APS) dbj...|BAB13025.1| high-affinity zinc uptake system membrane protein ZnuB [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] NP_240139.1 0.53 36% ...

  5. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  6. Uso da taxocenose de peixes como indicadora de degradação ambiental no rio Paraíba do Sul, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Francisco Gerson Araújo

    1998-01-01

    Full Text Available An adaptation of index of biotic integrity (IBI was performed for the first time in Brazil at the Rio Paraíba do Sul, between Barra Mansa and Barra do Piraí, a very important extent of this river because of the high pollution levels, and for being the main abstraction source of Rio de Janeiro city water supply. A monthly standardised sampling programme, from March-1995 to February-1996, was carried out at four sites. Seines, casting nets and net trays were used for catching fishes. IBI was obtained by integrating 12 ecological and environmental attributes of fish taxocene, populations, and individual organisms to assess biological integrity based in Species Composition, Trophic Structure and Fish Condition. Overall, water quality was classified between poor and fair and an improvement was detected between the high polluted Barra Mansa site and the less polluted Barra do Piraí site, showing the capacity of restoration of the river over this 50 km. Seasonally, the best conditions were reached from March to August, and the worse, from September to February, when most aloctone materials are brought to the river.

  7. Produção e indicadores fisiológicos de alface sob hidroponia com água salina Production and physiologic indicators of lettuce grown in hydroponics with saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2010-03-01

    Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes

  8. ANÁLISE DOS PARÂMETROS DE FUNCIONAMENTO E SIMULAÇÃO COMPUTACIONAL EM UM PROTÓTIPO DE TURBINA OPERANDO A AR COMPRIMIDO

    Directory of Open Access Journals (Sweden)

    Wesley Saldanha Nogueira Oliveira

    2016-12-01

    Full Text Available RESUMO. Este trabalho apresenta os resultados iniciais da comparação de alguns parâmetros de funcionamento do protótipo de uma turbina de ação simples, operando com ar comprimido como fluido de trabalho, realizados na unidade do SENAI de Barra do Piraí/RJ. O protótipo foi desenvolvido integralmente no Centro Universitário Geraldo Di Biase - UGB - Campus de Barra do Piraí/RJ, que inicialmente teve como o fluido de trabalho o vapor d’água, que nos testes inicias se mostrou ineficiente. A simulação computacional do sistema foi feita através do software SolidWorks na Universidade Federal Fluminense - UFF - Campus de Volta Redonda/RJ, o que permitiu determinar a faixa de trabalho que apresentou maior eficiência nos resultados experimentais do sistema por meio da relação entre pressão de operação, velocidade angular transmitida pelo fluido ao eixo da turbina e a potência da mesma. Os valores nas simulações em velocidade tangencial na região rotacional apresentaram-se convergentes aos valores experimentais medidos no protótipo.

  9. Presence of two alternative kdr-like mutations, L1014F and L1014S, and a novel mutation, V1010L, in the voltage gated Na+ channel of Anopheles culicifacies from Orissa, India

    Directory of Open Access Journals (Sweden)

    Bhatt Rajendra M

    2010-05-01

    Full Text Available Abstract Background Knockdown resistance in insects resulting from mutation(s in the voltage gated Na+ channel (VGSC is one of the mechanisms of resistance against DDT and pyrethroids. Recently a point mutation leading to Leu-to-Phe substitution in the VGSC at residue 1014, a most common kdr mutation in insects, was reported in Anopheles culicifacies-a major malaria vector in the Indian subcontinent. This study reports the presence of two additional amino acid substitutions in the VGSC of an An. culicifacies population from Malkangiri district of Orissa, India. Methods Anopheles culicifacies sensu lato (s.l. samples, collected from a population of Malkangiri district of Orissa (India, were sequenced for part of the second transmembrane segment of VGSC and analyzed for the presence of non-synonymous mutations. A new primer introduced restriction analysis-PCR (PIRA-PCR was developed for the detection of the new mutation L1014S. The An. culicifacies population was genotyped for the presence of L1014F substitution by an amplification refractory mutation system (ARMS and for L1014S substitutions by using a new PIRA-PCR developed in this study. The results were validated through DNA sequencing. Results DNA sequencing of An. culicifacies individuals collected from district Malkangiri revealed the presence of three amino acid substitutions in the IIS6 transmembrane segments of VGSC, each one resulting from a single point mutation. Two alternative point mutations, 3042A>T transversion or 3041T>C transition, were found at residue L1014 leading to Leu (TTA-to-Phe (TTT or -Ser (TCA changes, respectively. A third and novel substitution, Val (GTG-to-Leu (TTG or CTG, was identified at residue V1010 resulting from either of the two transversions–3028G>T or 3028G>C. The L1014S substitution co-existed with V1010L in all the samples analyzed irrespective of the type of point mutation associated with the latter. The PIRA-PCR strategy developed for the

  10. Ejercicio físico adaptado en plataformas Bosu, para la mejora del equilibrio y agilidad en la población mayor

    OpenAIRE

    Rodríguez Marugán, María de la Merced

    2014-01-01

    La actividad física ha cobrado mucha relevancia en los últimos años y con mayor acentuación en la población mayor de 65 años. Es por ello, que están creciendo muchas formas de revitalización geriátrica. El envejecimiento afecta al sistema nervioso y a las propiedades del sistema neuromuscular, lo cual conlleva déficits evidentes en el equilibrio y la marcha. Es por ello que desde la fisioterapia se ha llevado a cabo la puesta en marcha de un programa de ejercicio físico adaptado en plat...

  11. PROPUESTAS PARA EL DESARROLLO Y COMERCIALIZACIÓN DEL TURISMO ORNITOLÓGICO EN EXTREMADURA

    Directory of Open Access Journals (Sweden)

    José Manuel Hernández Mogollón

    2011-01-01

    dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia de Extremadura como destino de turismo ornitológico aportando propuestas para su desarrollo y comercialización.

  12. Electroterapia y electroporación en el tratamiento de tumores: modelos teóricos y experimentales

    OpenAIRE

    Turjanski, Pablo Guillermo

    2011-01-01

    El cáncer es una de las primeras causas de muerte por enfermedad en el mundo y su incidencia sigue creciendo con el aumento de la contaminación y la expectativa de vida. A pesar de los grandes avances científicos logrados en la lucha contra esta enfermedad, aun es necesario buscar soluciones más integrales, económicas y con menos efectos secundarios adversos que las terapias tradicionales. Aquí estudiamos el uso de campos eléctricos para la eliminación de tumores sólidos, lo que podría repres...

  13. Prácticas musicales durante el proceso de urbanización en Bogotá (Colombia), 1900-1940

    OpenAIRE

    Julio Aldemar Gómez Castañeda

    2015-01-01

    Durante el proceso de urbanización que vivió Bogotá en las primeras décadas del siglo XX, además de los cambios demográficos, de infraestructura o de servicios, las formas de ritualizar alrededor de la música experimentaron una serie de transformaciones. En la medida en que la ciudad fue creciendo, y los tiempos para el entretenimiento y la recreación fueron aflorando, las prácticas musicales se ajustaron a nuevas influencias, espacios, escenarios y condiciones técnicas. Algunas de ellas se r...

  14. Laboratorios virtuales y docencia de la automática en la formación tecnológica de base

    OpenAIRE

    Cerezo Coca, Francisco

    2016-01-01

    Recientemente, ha surgido un interés por aprender a programar, debido a las oportunidades profesionales que da este tipo de estudios universitarios. Es fácil de entender porque el número de trabajos para programadores e ingenieros informáticos está creciendo rápidamente. Por otro lado, un amplio grupo de psicólogos opinan que el pensamiento computacional es una destreza fundamental para cualquiera, no sólo para los ingenieros informáticos. Para leer, escribir y realizar operaciones aritmética...

  15. La “defensa social”. Pugnas y competencias en torno a la mano de obra en el Oriente Boliviano, 1890-1910.

    OpenAIRE

    Ana María Lema Garrett

    2010-01-01

    A fines del siglo XIX, la explotación de los gomales ubicados en la región amazónica boliviana, al norte del país, suscitó profundos cambios en otros departamentos y, entre otras cuestiones, en el mercado laboral. Los departamentos de Beni y de Santa Cruz se constituyeron entonces en reservorios de mano de obra y el flujo migratorio hacia las regiones gomeras del norte fue creciendo proporcionalmente a las necesidades de los empresarios gomeros. Sin embargo, las regiones de origen, y espec...

  16. Implementación de un EVA para el ingreso a la universidad : El caso del módulo “Estrategias de Aprendizaje en la Universidad” para los alumnos de la Licenciatura en Sistemas de Información

    OpenAIRE

    Castro Chans, Beatriz; Godoy Guglielmone, María Viviana; Sobol, Blanca; Mariño, Sonia Itatí

    2012-01-01

    La utilización de EVA –entornos virtuales de aprendizaje– ha ido creciendo en las universidades públicas y privadas del país como herramienta de apoyo a la modalidad presencial o para el dictado virtual de cursos y asignaturas tanto de grado como de posgrado. Este artículo describe y analiza la utilización de aulas virtuales en el marco del Curso de Nivelación y Ambientación 2012, implementado en la Facultad de Ciencias Exactas y Naturales y Agrimensura de la UNNE y específicamente del modulo...

  17. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Jorge Thierer

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la en...

  18. ANÁLISIS Y REPERCUSIÓN DE LAS LANZADERAS DE STARTUPS EN ESPAÑA COMO FACTOR DE ÉXITO PARA LAS MISMAS

    OpenAIRE

    2016-01-01

    {ES] El fenómeno de las aceleradoras de startup está creciendo en todo el mundo, con un número cada vez mayor de programas activos principalmente en los Estados Unidos y también en otras partes del mundo como Europa, Asia/Pacífico, Israel, Oriente Medio y Norte África etc. Sin embargo, hay poca literatura académica sobre estos programas de aceleración de startups y las fuentes de información no están completas, por lo que se dificulta enormemente la ...

  19. Plataforma para el procesamiento de imágenes médicas de ultrasonido obstétrico habilitada en la nube

    OpenAIRE

    Figueroa, Kevin Jessid; Mendoza, Luis Enrique

    2015-01-01

    El seguimiento fetal no invasivo mediante imagenología ha venido creciendo en los últimos treinta años. Con estos estudios se detectan problemas futuros con el fin de prevenirlos. Este artículo presenta un software que mediante imágenes de ultrasonido permite detectar la zona de translucencia nucal. Dicha zona es importante para la detección de trisomía 21 o síndrome de Down. Para ello el software contiene técnicas de operaciones morfológicas y la transformada Watershed. Adicionalmente, se de...

  20. Integración de una tarjeta RFID de bajo coste en el framework robot operating system

    OpenAIRE

    González de la Cruz, Gustavo

    2014-01-01

    Cada vez son más numerosas las aplicaciones que utilizan las tecnologías de identificación automática. En los últimos años, estas aplicaciones están teniendo una importancia muy grande. Un ejemplo de ello es el caso de los sistemas de identificación por radiofrecuencia RFID, ya que estos sistemas están creciendo en el campo de la robótica, en donde se necesitan nuevas formas de interactuar con el robot. Los sistemas RFID pueden ser integrados en robots personales para llevar a cabo tareas ...

  1. Diseño de un sistema de buenas prácticas de manufactura en

    OpenAIRE

    Sánchez Vásquez, Viviana Lorena; Decker Campuzano, Fernando Enrique

    2010-01-01

    Hace ya más de 60 años, abre sus puertas a sus clientes la empresa familiar LA DELICIA dedicada a la elaboración de una gran variedad de panes, dulces y tortas. La misma se ha mantenido entre las más importantes del sector debido al distintivo toque de sabor y apariencia artesanal de sus productos. En el transcurso de los años la empresa ha ido creciendo a tal punto que hoy en día ha pasado de ser una panadería artesanal de barrio como lo fue en sus orígenes, para convert...

  2. TEORÍA TRANSTEORÉTICA DE CAMBIO DE CONDUCTA: HERRAMIENTA IMPORTANTE EN LA ADOPCIÓN DE ESTILOS DE VIDA ACTIVOS

    OpenAIRE

    Carlos Álvarez

    2008-01-01

    A pesar del culto a la belleza que ha regido en esta sociedad globalizada, y a la importancia de la actividad física en relación con la prevención de las enfermedades cardiodegenerativas (US.DHHS, 1996), el sedentarismo sigue creciendo en la población. ¿Qué estrategias puede usar un profesional en movimiento humano para lograr activar a la población? Es aquí donde surge el modelo transteorético como una opción innovadora que supera con creces las intervenciones biologistas clásicas y cortopl...

  3. Anatomía Artística: Bases Anatómicas del Retrato Escultórico Realista

    OpenAIRE

    Jiménez Mateos, Miguel Ángel

    1999-01-01

    El saber sobre la estructura del organismo humano ha ido creciendo siguiendo las bases de cualquier otra ciencia. La curiosidad de los propios humanos los condujo a observar los organismos y a intentar indagar en ellos más allá de los límites de la observación superficial, penetrando en su interior dividiendo sus partes. “Anatomía: cortar repetidas veces”. La Anatomía analiza las relaciones causales que tanto la estructura como la función guardan entre sí, así como las modificaciones de índol...

  4. Crecimiento de destinos turísticos de montaña en áreas protegidas de papel. Estudio de caso Caviahue-Parque Provincial Copahue

    OpenAIRE

    Andrés, Juan Manuel

    2016-01-01

    Andrés, J. M. (2016). “Crecimiento de destinos turísticos de montaña en áreas protegidas de papel”. Estudio de caso Caviahue-Parque Provincial Copahue (Tesis de posgrado). Bernal, Argentina: Universidad Nacional de Quilmes. El turismo continúa creciendo en importancia a nivel mundial. Cada vez más la sociedad encuentra en esta actividad una alternativa viable de desarrollo. Sin embargo, este crecimiento es a veces desmedido y desorganizado, lo que produce presiones sobre los ambientes natu...

  5. Estimación a largo plazo de la prevalencia de obesidad en la Argentina

    OpenAIRE

    Erica Milin; Raúl A. Borracci; Alberto Cardone

    2010-01-01

    RESUMENIntroducciónLa obesidad está creciendo más aceleradamente en América latina que en los países desarrollados,sumándose a la desnutrición como factor que incide en la mortalidad. Aunque esnecesario conocer la evolución de las tasas de obesidad para implementar políticas de saludpública, en la Argentina no existen hasta el momento estudios que permitan proyectar lasituación en el futuro.ObjetivoEstimar a largo plazo la evolución de la prevalencia de obesidad en adultos en la Argentinaa tr...

  6. Posibilidades de formación en Seguridad Alimentaria en el contexto educativo universitario.

    Directory of Open Access Journals (Sweden)

    M Fernández

    2010-01-01

    Full Text Available La formación en Seguridad Alimentaria está creciendo en la actualidad, dadas las necesidades de profesionales con una formación científica sólida, fundamentalmente en el Análisis de riesgos, capaces de resolver los problemas variados que se plantean desde los distintos sectores relacionados con la misma. Se revisan las posibilidades de formación existentes en nuestro país, a nivel de Grado y Postgrado, haciendo especial referencia en las materias, cursos, y másters existentes en las Universidades de Valencia, Córdoba y Sevilla.

  7. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias...

  8. Very-high-energy -ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    OpenAIRE

    López Coto, Rubén; Fernández Sánchez, Enrique

    2015-01-01

    La historia de la astronomía es tan antigua como alcanzan nuestros registros. Todas las civilizaciones han estado interesadas en el estudio del cielo nocturno, sus objetos y fenómenos. Estas observaciones se realizaron a simple vista hasta el comienzo del siglo XVII, cuando Galileo Galilei empezó a usar un instrumento desarrollado recientemente llamado telescopio. Desde entonces, el rango de longitudes de onda accesible ha ido creciendo, con una explosión en el siglo XX gracias al desarrollo ...

  9. PLANTAS ARVENSES ASOCIADAS A CULTIVOS DE MAÍZ DE TEMPORAL EN SUELOS SALINOS DE LA RIBERA DEL LAGO DE CUITZEO, MICHOACÁN, MÉXICO

    OpenAIRE

    2013-01-01

    Se muestrearon comunidades de plantas arvenses en cultivos de maíz de temporal creciendo sobre suelos con problemas de salinidad, durante el ciclo agrícola 1996 en 10 sitios de la ribera del Lago de Cuitzeo. Se registraron 133 especies correspondientes a 94 géneros y 34 familias. De estas últimas las que presentaron el mayor número de especies fueron Compositae, Gramineae, Euphorbiaceae, Solanaceae y Leguminosae que en conjunto representan más de la mitad de la riqueza específica con 63.89%. ...

  10. La docencia del marketing sensorial en el Grado de Publicidad y Relaciones Públicas de la Universidad de Valladolid

    OpenAIRE

    Figueroa Escribano, Carmen

    2014-01-01

    He querido plasmar en este trabajo de investigación cómo es la docencia y qué importancia se le da al Marketing en general y al Marketing Sensorial en particular, en el grado de Publicidad y Relaciones Públicas en la Universidad de Valladolid, en la cual he estado estudiando mis cuatro años de carrera. He querido centrarme en estos dos fenómenos, puesto que valoro que el Marketing Sensorial es una estrategia que está creciendo mucho y las empresas están utilizando como reclamo publicitario pa...

  11. Native and Non-Native Dichotomy: Challenges of and Attitudes Towards Native and Non-Native English Speaking Teachers

    OpenAIRE

    Pérez Pérez, Jasmina Laura

    2015-01-01

    [ES]El número de profesores de inglés sigue creciendo debido a la importancia de esta lengua. El presente trabajo investiga el rol de los profesores de inglés nativos y los profesores de inglés no nativos en contextos en los que el inglés se enseña como lengua extranjera, mediante el análisis del concepto nativo, los desafíos de estos profesores y las actitudes de Perez 2 estudiantes, profesores de inglés nativos y no nativos hacia ambos grupos de profesores, con el propósito de identif...

  12. LA TRANSFERENCIA DE LOS ESTUDIOS SUPERIORES Y LA EDUCACION PARA EL TRABAJO

    OpenAIRE

    2005-01-01

    La demanda del sistema educativo sigue creciendo. En la sociedad se han establecido exigencias que no existían hace veinte años : movimientos populares que exigen educación bilingüe y bicultural , se está generalizando la educación para personas con necesidades especiales .Esto sucede en el contexto de una imagen desvalorizada de la enseñanza .Aún son bajos los presupuestos educativos. Aún cuesta vincular adecuadamente educación – empresa. La educación es uno de los temas que más preocupan a...

  13. Influencia de las fuentes de financiamiento externo en el crecimiento y desarrollo de las empresas agroindustriales del distrito de Abancay Apurímac Perú (periodo 2012- 2013)

    OpenAIRE

    Jiménez Mendoza, Wilber; Luciano Alipio, Rober Anibal; Soto Carrión, Carolina

    2014-01-01

    En los últimos años, el Perú viene creciendo sostenidamente, la tasa de crecimiento del PBI ha superado el 7%, lo que nos indica que estamos atravesando por una bonanza económica; sin embargo esta se explica por la explotación y exportación básicamente de materias primas como minerales, la construcción y los productos agroindustriales. Apurímac no es ajeno a esta realidad, si bien es cierto, contribuye aproximadamente con el 0.5% del PBI nacional, se prevé un futuro má...

  14. Implantación de las matemáticas en la educación secundaria obligatoria: un análisis en el contexto internacional

    OpenAIRE

    Castelnuovo, Emma

    1998-01-01

    Hace ahora cinco años que comenzó a implantarse la educación secundaria obligatoria en algunos centros de diferentes lugares. Desde entonces, el número de estudiantes y de centros que se han incorporado a esta etapa educativa ha ido creciendo progresivamente. Tenemos ya alguna experiencia que nos permite hacer un primer balance de sus características más relevantes y sus efectos en relación con la enseñanza y el aprendizaje de las matemáticas y de las condiciones en las que se ha ido poniendo...

  15. Migración e impacto de las remesas en la economía nacional

    OpenAIRE

    Rosa Albina Garavito Elías; Rino Enzo Torres Baños

    2004-01-01

    Se investigan las remesas familiares de los trabajadores migratorios mexicanos en EUA. Uno de los hallazgos es que el aumento de la tasa de migración se asocia con el agotamiento del modelo de desarrollo estabilizador y se profundiza con la aplicación del neoliberalismo; también que en tanto las asimetrías económicas con EUA no se amortigüen, la migración seguirá creciendo. Las remesas hoy, como el sector agropecuario durante el desarrollo estabilizador, están cumpliendo un papel central en l...

  16. METANO BIOGENICO COMO COMBUSTIBLE VEHICULAR

    OpenAIRE

    2013-01-01

    Actualmente la mitad del petróleo que se consume en el mundo está asociado al sector transporte y continúa creciendo a un ritmo vertiginoso, tanto así, que la International Energy Agency (IEA) proyecta que para el 2030 éste llegará al 90%, tras lo cual, no se podrá suplir adecuadamente la demanda mundial. La realidad latinoamericana no es ajena a esta problemática. Chile y Brasil son las naciones que presentan el mayor porcentaje de importación de petróleo de la región y en el cas...

  17. LA ACCIÓN Y EL ENFOQUE PSICOSOCIAL DE LA INTERVENCIÓN EN CONTEXTOS SOCIALES: ¿PODEMOS PASAR DE LA MODA A LA PRECISIÓN TEÓRICA, EPISTEMOLÓGICA Y METODOLÓGICA?. THE ACTION AND THE PSYCHOSOCIAL APPROACH OF THE INTERVENTION IN SOCIAL CONTEXTS: CAN WE MOVE FROM THE FASHION TO THE THEORETICAL, EPISTEMOLOGICAL, AND METHODOLOGICAL PRECISION?.

    OpenAIRE

    Juan David Villa Gómez

    2012-01-01

    El siguiente artículo derivado de investigación, se plantea la pregunta en torno a una realidad que viene creciendo en Colombia: el incremento de los proyectos de intervención psicosocial en diversos sectores sociales, especialmente con víctimas del conflicto armado, violencia social, violencia de género e intrafamiliar, entre otras; además de población en situación de pobreza extrema, desplazamiento forzado y víctimas de catástrofes naturales. En relación con esta lógica de intervención y de...

  18. Ejercitando el futuro a través de los parques científicos y tecnológicos

    OpenAIRE

    Bellavista, Joan

    2009-01-01

    En plena etapa de convulsión y con- nfusión sobre la evolución de la Economía y la Sociedad, el movimiento internacional de Parques Científicos y Tecnológicos continúa avanzando con fuerza. Desde esta perspectiva agregada internacional, la creación de nuevos parques, nuevas empresas del conocimiento y nuevos servicios de referencia sigue creciendo a un ritmo parecido al de años anteriores. En este contexto propongo un ejercicio de hiperrealismo, donde nuestro comportamiento individual y colec...

  19. El problema de la salud en los Estados Unidos

    OpenAIRE

    Elsie L. Montiel Ziegler

    1990-01-01

    El alto costo de la atención a la salud es uno de los principales problemas internos que ha enfrentado la sociedad norteamericana en los últimos meses. Existe un acuerdo general acerca de la necesidad de reducir los costos sin afectar el derecho de todos los norteamericanos a la atención de sus necesidades de salud.La crisis que afecta al sistema de salud de los Estados Unidos involucra varios aspectos: los costos han ido creciendo rápidamente, de manera que la nación gasta más del 12% de su ...

  20. A multi-scale analysis of transforming agricultural markets in the context of globalization: implications for natural resources, food prices and rural poverty in Latin America

    OpenAIRE

    2016-01-01

    Vivimos una época en la que el mundo se transforma aceleradamente. La globalización está siguiendo un curso imparable, la población mundial así como la población urbana siguen creciendo, y en los países emergentes los ingresos promedios aumentan, resultando en un cambio también acelerado de las dietas y hábitos alimentarios. En conjunto esos factores están causando un aumento fundamental de la demanda de alimentos. Junto con la apertura de los mercados agrícolas, estos procesos han provocado ...

  1. Contribución al estudio del sistema de lipasas de Trichoderma harzianum

    OpenAIRE

    Jorge, Maria de Lurdes Antunes

    2016-01-01

    [ES]Entre los hongos del género Trichoderma se han descrito algunas especies importantes como agentes de biocontrol, tales como las parejas anamorfo/teleomorfo T. harzianum/Hypocrea lixii, T. viride/H. rufa, T. atroviride/H. atroviridis y T. virens/H. virens. Trichoderma tiene una amplia distribución geográfica, está presente en casi todos los suelos y en hábitats diversos (creciendo en madera, corteza, sobre y dentro otros hongos y sustratos innumerables). Por su adaptación a distintos en...

  2. Estudio y análisi de viabilidad para la implantación de una fábrica de cerveza en Cataluña

    OpenAIRE

    Solanelles Martí, Joan; Rodríguez Nogal, Carlos

    2015-01-01

    El sector de la cerveza artesanal está creciendo a un ritmo muy elevado, continuamente se multiplican las microempresas que fabrican éste tipo de cerveza, pero, a menudo, el precio que se paga por una de estas cervezas es desorbitado. No se trata de una cuestión de calidad únicamente, sino de ineficiencia en los procesos, no tener acceso a economías de escala para la compra de materia prima, la distribución y por un excesivo peso de los costes fijos debido a las bajas produccio...

  3. LA CALIDAD EN LA CADENA DE VALOR DEL PRODUCTO AGROALIMENTARlO. DIFERENCIAS PERCIBIDAS ENTRE EL AGRICULTOR INDIVIDUAL Y EL ASOCIADO /

    OpenAIRE

    García Pérez, A. M.; Oreja Rodríguez, JR.; E. González Dávila

    2004-01-01

    La transformación de la agricultura ha supuesto su integración progresiva al resto de los sectores de la economía y, al mismo tiempo, la disminución de la contribución de la actividad agraria al valor final de los alimentos. Por lo tanto, el peso específico de las actividades de transformación y distribución en el valor añadido total de los productos alimentarios ha ido creciendo en detrimento de la aportación de la agricultura. Estos cambios han originado la necesidad de buscar un nuevo marc...

  4. Simón Bolívar y la cultura iberoamericana

    Directory of Open Access Journals (Sweden)

    Luis López de Mesa

    1979-08-01

    Full Text Available Simón Bolívar -en cuanto héroe de la historia de América- nació en Cartagena del Caribe en 1812 y murió en Lima hacia 1926. Comparando esos catorce años de prodigiosa actividad pública con el promedio de "realizaciones " que en el decurso de su vida lleva a cabo el hombre común, resultaría de longevidad casi milenaria: prueba de ello es que su pensamiento actúa aún en el continente americano, y que sus obras siguen creciendo a la faz del mundo.

  5. Las márgenes de los pueblos de indios. Agregados, arrendatarios y soldados en el Tucumán colonial. Siglos XVIII y XIX.

    OpenAIRE

    Farberman, Judith

    2009-01-01

    Desde mediados del siglo XVIII, la documentación sobre los pueblos de indios del Tucumán incluye escuetas referencias sobre “agregados” y “soldados”, la móvil población que va creciendo en sus márgenes y que podía incluso superar en número a las familias tributarias. Normalmente, los agregados se vinculaban a los pueblos pagando un arriendo al cacique. Por ello, pudieron contribuir a la perduración de algunas reducciones y a la consolidación de su sistema de autoridades. Sin embargo, el mismo...

  6. Como se regula el contrato corporal, la teoría del negocio jurídico, aplicación a la compraventa de órganos vivos, con lo deudos de las personas fallecidas, a título oneroso o gratuito

    OpenAIRE

    Oliveros Tinoco, Mario Andrés

    2012-01-01

    La Ley 919 del 2004, expone que la venta de órganos perjudica la salud, por ello las partes del cuerpo humano no pueden ser objeto de transacciones comerciales en Colombia. Sin embargo existe un nuestro país y en algunos otros, un mercado donde los órganos humanos, adquieren un valor desmesurado, y ha venido creciendo ostensiblemente, un comercio ilegal de esta clase de órganos, haciendo que las leyes sean ineficaces. Así las cosas se trataran de dar una solución desde el punto de vista juríd...

  7. DIVERSIDAD DE ABEJAS SIN AGUIJÓN (Hymenoptera:Meliponini) UTILIZADAS EN MELIPONICULTURA EN COLOMBIA

    OpenAIRE

    GUIOMAR NATES-PARRA; JUAN MANUEL ROSSO-LONDOÑO

    2013-01-01

    En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura), es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 d...

  8. Diversidad de abejas sin aguijón (hymenoptera:meliponini) utilizadas en meliponicultura en colombia

    OpenAIRE

    Guiomar Nates Parra; Juan Manuel Rosso Londoño

    2013-01-01

    En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura), es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 d...

  9. Fase gametofitica del helecho Llavea cordifolia (Pteridaceae)

    OpenAIRE

    2015-01-01

    Se describen las características morfológicas de la fase sexual de L. cordifolia, género monotípico, de distribución en México, Guatemala y Costa Rica. Se recolectaron plantas fertiles de los estados de Veracruz y Puebla, los cultivos se hicieron in vitro observando poblaciones de creciendo en cajas de Petri. La genninación que presenta es tipo- Vittaria, formando un filamento uniseriado de hasta cuatro células. El desarrollo protálico es tipo-A diantum. Los protalos son cordado-espatulado a ...

  10. Propiedades de líquidos iónicos y su aplicación a la síntesis de nanopartículas de fibroína de seda

    OpenAIRE

    García Montalbán, Mercedes

    2016-01-01

    Durante las últimas décadas, la mayoría de los procesos implicados en las industrias farmacéuticas y de química fina han requerido elevados consumos energéticos a la vez que han generado grandes cantidades de residuos. De este modo, han ido contribuyendo a la degradación medioambiental la cual de forma gradual se ha convertido en un problema global. Con esta perspectiva, los intereses medioambientales han ido creciendo y se han establecido leyes cada vez más estrictas por lo que ha surgido la...

  11. Televisión sobre Internet: calidad percibida en arquitecturas P2PTV (peer-to-peer television)

    OpenAIRE

    Rodríguez Bocca, Pablo

    2012-01-01

    El tráfico sobre Internet se encuentra creciendo día a día, siendo la distribución de video el principal impulsor de dicho aumento. Distribuir video en Internet es complicado por dos aspectos: el económico y el técnico. Enviar video de forma masiva requiere gran consumo de ancho de banda y por tanto altos costos. Además, al ser la Internet una interconexión de redes, la única forma de asegurar una buena calidad de video a los usuarios de distintos proveedores de acceso a Internet (ISPs) es di...

  12. El paciente geriátrico en urgencias The geriatric patient and emergency care

    OpenAIRE

    F.J. Martín-Sánchez; C. Fernández Alonso; Merino, C.

    2010-01-01

    La demanda en la atención urgente ha ido creciendo progresivamente en los últimos años y este incremento es más acusado en la población anciana. Teniendo en consideración que el paciente anciano requiere evaluaciones más complejas con una mayor realización de pruebas complementarias y consultas a otros especialistas, estancias más prolongadas en urgencias y mayor porcentaje de ingresos, el progresivo envejecimiento poblacional puede llegar a repercutir seriamente en la presión asistencial de ...

  13. Criminología sexual

    OpenAIRE

    Erick Gómez Tagle López; Estefany Juárez Ríos

    2014-01-01

    La tasa de delitos sexuales sigue creciendo,afectando principalmente a mujeres jóvenes ya la niñez, sin que exista una respuesta insti-tucional adecuada para su prevención, aten-ción y erradicación. Conductas delictivas confuerte rechazo social pero difícil comprensióncientífica, al menos desde un enfoque interdis-ciplinario eficaz. Ciencias como la biología, lacriminología, el derecho y la sociología apor-tan elementos explicativos desde sus propiasáreas, por lo cual el reto es lograr un abo...

  14. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Mier Barona Carmen Elena

    2009-06-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  15. Adaptación y rendimiento de plantas autóctonas de Guatemala en un sistema acuapónico

    Directory of Open Access Journals (Sweden)

    Carlos Valdez-Sandoval

    2017-03-01

    Full Text Available Se determinó la adaptación y rendimiento de ocho variedades de plantas autóctonas de Guatemala en un sistema acuapónico. Se utilizaron siete módulos acuapónicos, con capacidad de 80 plantas y 25 organismos de tilapia nilótica (Oreochromis niloticus. Se incluyeron en el estudio, plantas de apazote (Dysphania ambrosioides, makuy (Solanum nigrescens, amarantos (Amaranthus sp., bledo (A. cruentus, chipilín (Crotalaria longirostrata, chipilín montés (C. vitellina ayote (Cucurbita argyrosperma y güicoy (C. pepo. El periodo de evaluación fue de 60 días. Se registró la supervivencia (S, tamaño (T, peso (P y biomasa o rendimiento (B de las plantas y los peces al inicio y al final del periodo experimental. Se observó adaptación de siete de las ocho especies de plantas autóctonas, a los módulos acuapónicos experimentales. La variedad de planta con mayor crecimiento fue el ayote, seguida del makuy y el güicoy. Se observaron diferencias en la altura (p=0.00001 y el rendimiento (p=0.00001 de las variedades de las plantas. La biomasa de tilapia por tanque fue _ = 730 ± 75.2 g. En tal sentido, es posible cultivar plantas autóctonas de Guatemala en un sistema acuapónico.

  16. Monogenoidea en Serrasalmus rhombeus (Linnaeus, 1766 de la Cuenca Amazónica Boliviana

    Directory of Open Access Journals (Sweden)

    Leslie Córdova

    2013-04-01

    Full Text Available El presente trabajo analiza la diversidad de parásitos monogenoideos como un carácter indepen- diente, esperando que por su alta especifi cidad, éstos parásitos puedan caracterizar las poblaciones de sus hospederos, la piraña blanca, Serrasalmus rhombeus . El estudio se llevó acabo en cuatro sub-cuencas de la Cuenca Amazónica Boliviana (Iténez, Beni, Madre de Dios e Ichilo; se obtuvie- ron 1135 parásitos, los cuales fueron agrupados en seis géneros y once especies: Anacanthorus jegui, A. amazonicus , A. rondonensis, A. gravihamulatus, A. sciponophallus, Anacanthorus sp.1 , Anacanthorus sp.2 , Anacanthorus sp.3 ; Notothecium deleastum, N. deleastoideum, Notozothecium teinodendrum; Mymarothecium galeolum; Anphithecium diclonophallum y Enallothecium aegidatum. La elevada diversidad de parásitos encontrada puede deberse a que existe o existió un complejo de especies o poblaciones diferenciadas de Serrasalmus rhombeus.

  17. [The issue of medico-legal assessment of noise induced hearing loss: comparison of methods].

    Science.gov (United States)

    Bosio, D; Coggiola, M; Baracco, A; Andreis, P; Perrelli, F

    2011-01-01

    Audiogram classification is crucial for hearing protection of workers occupationally exposed to noise. The methods that have been proposed are based on two principles: the morphological evaluation of the audiometric curve (eg. Merluzzi-Pira-Bosio--MPB) or the average hearing loss on different frequencies (eg. Albera-Beatrice--AB). The purpose of this study was to classify audiograms compatible with chronic acoustic trauma performed at the Occupational Medicine Outpatient Clinic of CTO Hospital in Turin from 2004 to 2011 with the methods outlined in Guidelines published by SIMLII. A substantial agreement among the methods was observed. While MPB is the most appropriate method for secondary prevention, the AB would seem more appropriate for the verification of a permanent weakening that has to be reported to the competent legal authorities.

  18. La configuración de un modelo : los catafalcos madrileños durante el reinado de Felipe V

    Directory of Open Access Journals (Sweden)

    Victoria Soto Caba

    1989-01-01

    Full Text Available En el último tercio del siglo xvii la tendencia decorativista y la variedad tipológica fueron las características más acusadas de los aparatos provisionales de las exequias reales. Las tradiciones locales y los talleres barrocos mantuvieron ambos rasgos durante gran parte de la centuria siguiente. El tapizado ornamental recubrió túmulos en forma de torre, pira, templetes, baldaquinos... Estas estructuras heredadas apenas dejaron sitio para nuevas variantes arquitectónicas, por lo que se puede decir que el siglo xviii, al menos la primera mitad, contribuyó muy poco en el enriquecimiento del repertorio tipológico de los catafalcos reales.

  19. Effect of Growth on Fatty Acid Composition of Total Intramuscular Lipid and Phospholipids in Ira Rabbits.

    Science.gov (United States)

    Xue, Shan; He, Zhifei; Lu, Jingzhi; Tao, Xiaoqi; Zheng, Li; Xie, Yuejie; Xiao, Xia; Peng, Rong; Li, Hongjun

    2015-01-01

    The changes in fatty acid composition of total intramuscular lipid and phospholipids were investigated in the longissimus dorsi, left-hind leg muscle, and abdominal muscle of male Ira rabbits. Changes were monitored at 35, 45, 60, 75, and 90 d. Analysis using gas chromatography identified 21 types of fatty acids. Results showed that the intramuscular lipid increased and the intramuscular phospholipids (total intramuscular lipid %) decreased in all muscles with increasing age (pIra rabbits at different ages and muscles. Palmitic acid (C16:0), stearic acid (C18:0), oleic acid (C18:1), linoleic acid (C18:2), and arachidonic acid (C20:4) were the major fatty acids, which account to the dynamic changes of the n-6/n-3 value in Ira rabbit meat.

  20. 肾动脉各级血流多普勒参数反映肝硬化病程

    Institute of Scientific and Technical Information of China (English)

    楼丽萍; 徐晓飞; 王洁; 方蕾

    2013-01-01

    目的 应用彩色多普勒超声分析肾动脉血流动力学信息,了解肝硬化病情的发展.方法 选择肝硬化患者60例为肝硬化组,根据病程进展分为Ⅰ、Ⅱ、Ⅲ组.同期20位健康体检者为对照组,运用彩色多普勒超声进行肾动脉检查,并记录血流参数.结果 随着肝硬化病情的逐渐发展,肾主动脉(main renal artery,MRA)、段动脉(segmental renal artery,SRA)、叶间动脉(interlobar renal artery,IRA)的阻力指数(resistance index,RI)逐渐增加,差异均有统计学意义(FMRA=41.34,PMRA=0.000;FSRA=26.41,PSRA=0.000;FIRA=71.95,PIRA=0.000);MRA、SRA、IRA的搏动指数(pulsatility index,PI)逐渐增加,差异均有统计学意义(FMRA=51.90,PMRA=0.000;FSRA=72.45,PSRA=0.000;FIRA=125.31,PIRA=0.000).血流量均显著降低,差异有统计学意义(F=18.66,P=0.000).结论 通过监测肝硬化进程中肾动脉血流参数,可以为临床监护病情、客观评估病情和预后提供有力证据.

  1. Characterization and PCR Detection Of Binary, Pir-Like Toxins from Vibrio parahaemolyticus Isolates that Cause Acute Hepatopancreatic Necrosis Disease (AHPND in Shrimp.

    Directory of Open Access Journals (Sweden)

    Ratchanok Sirikharin

    Full Text Available Unique isolates of Vibrio parahaemolyticus (VPAHPND have previously been identified as the causative agent of acute hepatopancreatic necrosis disease (AHPND in shrimp. AHPND is characterized by massive sloughing of tubule epithelial cells of the hepatopancreas (HP, proposed to be induced by soluble toxins released from VPAHPND that colonize the shrimp stomach. Since these toxins (produced in broth culture have been reported to cause AHPND pathology in reverse gavage bioassays with shrimp, we used ammonium sulfate precipitation to prepare protein fractions from broth cultures of VPAHPND isolates for screening by reverse gavage assays. The dialyzed 60% ammonium sulfate fraction caused high mortality within 24-48 hours post-administration, and histological analysis of the moribund shrimp showed typical massive sloughing of hepatopancreatic tubule epithelial cells characteristic of AHPND. Analysis of the active fraction by SDS-PAGE revealed two major bands at marker levels of approximately 16 kDa (ToxA and 50 kDa (ToxB. Mass spectrometry analysis followed by MASCOT analysis revealed that both proteins had similarity to hypothetical proteins of V. parahaemolyticus M0605 (contig034 GenBank accession no. JALL01000066.1 and similarity to known binary insecticidal toxins called 'Photorhabdus insect related' proteins A and B (Pir-A and Pir-B, respectively, produced by the symbiotic, nematode bacterium Photorhabdus luminescens. In in vivo tests, it was shown that recombinant ToxA and ToxB were both required in a dose dependent manner to cause AHPND pathology, indicating further similarity to Pir-A and -B. A single-step PCR method was designed for detection of the ToxA gene and was validated using 104 bacterial isolates consisting of 51 VPAHPND isolates, 34 non-AHPND VP isolates and 19 other isolates of bacteria commonly found in shrimp ponds (including other species of Vibrio and Photobacterium. The results showed 100% specificity and sensitivity for

  2. EVALUACIÓN DE LA TELEVISIÓN INTERACTIVA DESDE UNA PERSPECTIVA DE USABILIDAD: CASO PRÁCTICO

    Directory of Open Access Journals (Sweden)

    César Alberto Collazos Ordoñez

    2009-01-01

    Full Text Available La televisión interactiva ha ido creciendo en popularidad, en poco tiempo esta tecnología estará en nuestros hogares. A diferencia de la televisión analógica, la televisión digital posibilita la transformación de televidentes pasivos en activos con la capacidad de interactuar con nuevos servicios superpuestos sobre los contenidos y novedosas formas de negocio. Uno de los aspectos más importantes a analizar en este nuevo estilo interactivo es su usabilidad. Este trabajo presenta una pauta para evaluar la usabilidad de este tipo de servicios. Por último, se presentan los resultados de un caso práctico.

  3. UN SEGMENTO DEL TURISMO INTERNACIONAL EN AUGE: EL TURISMO DE CAZA

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Rengifo Gallego

    2008-01-01

    Full Text Available El número de turistas internacionales viene creciendo de forma continuada desde que existen fuentes estadísticas. Este crecimiento, que no sólo ha sido cuantitativo, sino espacial, ha ido acompañado de una segmentación del mercado en función de las motivaciones. Entre estos segmentos se halla el turismo cinegético, modalidad que ha experimentado un importante crecimiento en los últimos años por diversos motivos. Este incremento ha ido asociado a la movilidad de un porcentaje importante de cazadores de Europa y Estados Unidos, a la existencia de una gran variedad de especies cinegéticas en el mundo que se distribuyen de forma irregular por el territorio y al desarrollo de un entramado empresarial que participa en la comercialización de la caza.

  4. Sistema de prototipos para control numérico

    Directory of Open Access Journals (Sweden)

    Abdón Sánchez Sossa

    2011-01-01

    Full Text Available La mejor utilización de equipos de alta tecnología implica el contar con el adecuado entrenamiento. La conformaci6n del Grupo de Control Numérico Computarizado de Ingenierfa de Sistemas en 1987, pionero, al permitir canalizar y consolidar en tres cursos electivos interdisciplinarios una respuesta a las inquietudes académico-docentes de apoyo al sector manufacturero. El desarrollo de varios programas, cuya complejidad ha venido creciendo con el tiempo, permitió explorar la aplicabilidad de los conceptos presentados en clase y sirvió de vinculo con la realidad Nacional de manera activa y comprometida, con el desarrollo del país. Los programas descritos en este trabajo son el resultado de muchas horas de labor y realizados contando con un exiguo presupuesto.

  5. “Stepcalories”, aplicación dedicada a una vida saludable para Android

    OpenAIRE

    Gálvez Sánchez, Rafael

    2011-01-01

    El nacimiento de la telefonía móvil hace varias décadas, generó un mercado que ha ido creciendo día a día, haciendo que se invierta cada vez más tiempo y dinero en la tecnología unida a este concepto. Actualmente, no se usan teléfonos móviles simples, sino que se han convertido en smartphones: verdaderas obras de ingeniería capaces de incluir sensores de movimiento o posición, conectividades Wi-Fi o Bluetooth, cámaras de foto y video, etc., todo un sinfín de posibilidades. Este desarrollo ...

  6. Spectroscopic diagnostics of precessing discs: the Stream-disc impact in xtej1118+480 (= kV uma in outburst

    Directory of Open Access Journals (Sweden)

    C. A. Haswell

    2004-01-01

    Full Text Available Presentamos las trazas de espectrogramas orbitales de XTE J1118+480 tomados en el momento de alcanzar el m aximo en 2000. Muestran un rasgo envolvente de onda S creciendo desde el impacto del chorro en el borde del disco exc entrico en precesi on. Comparando las ondas S observadas con las generadas en una simulaci on SPH, deducimos las fases del disco en precesi on correspondientes a nuestras observaciones. A partir de ah inferimos cambios en el per odo de precesi on del disco alrededor del m aximo de la explosi on: nuestra espectroscop a sugiere un per odo de precesi on con una duraci on tan corta como 20 d as.

  7. La reciente narrative Espaňola en el context postmoderno

    Directory of Open Access Journals (Sweden)

    Yvonna Vaňková

    2001-12-01

    Full Text Available Año tras año está creciendo la cantidad de biografia, escrita desde diversas fuentes, per­ spectivas y ramas del saber sobre lo que, en estas últimas décadas del siglo XX, se ha denominado posmodernidad/posmodernismo. Este fenómeno es tratado y debatido en numerosos articulos y volúmenes monográficos, en congresos, seminarios y reuniones científicas, abordado desde puntos de vista especializados o de forma interdisciplinar. Los teóricos más destacados y tan diferentes entre si como Habermas, Sontag, Lyotard, Vattimo, Foucault, Derrida o Jameson, desde posiciones distintas y utilizando diferentes planteamientos, intentan proporcionarnos las claves de comprensión y un sistema mas o menos adecuado para orientarnos mejor en el mundo contemporaneo.

  8. Las pruebas ponderadas : Una estrategia de evaluación en las ciencias morfológicas

    OpenAIRE

    González, Norma Viviana; Restelli, Mario A.

    2004-01-01

    La Cátedra de Histología y Embriología Animal de la Facultad de Ciencias Naturales y Museo de la Universidad Nacional de La Plata, hasta el año 1989 evaluó en forma integral a sus alumnos mediante exámenes parciales orales. El número de alumnos que recibía nuestra Cátedra por esos años fue creciendo paulatinamente en tanto que el plantel docente se mantuvo estable. Así, la elevada matrícula junto al limitado equipo docente y la dispersión horaria y edilicia de nuestras actividades prácticas y...

  9. Los retos del periodismo judicial

    Directory of Open Access Journals (Sweden)

    Lic. Javier Ronda Iglesias

    1999-01-01

    Full Text Available El periodista se consolida como un nuevo habitante de la administración de justicia. Es habitual su presencia para cubrir las numerosas informaciones que genera el complejo mundo judicial. Señala el autor que la fiebre por esta información especializada sigue creciendo cada día, ya que interesa al público y a los medios de comunicación. Este auge por la información judicial o de tribunales exige una mayor preparación específica del profesional, que redundará en la mejora de la calidad y veracidad de este hacer periodístico. Por ello, en este artículo se facilitan una serie de usos y recomendaciones para desarrollar convenientemente el periodismo judicial.

  10. Diseño de un sistema mecatrónico para la selección de arándanos

    OpenAIRE

    Rudas Ramírez, Carlos Alberto

    2016-01-01

    El sector agrícola en el Perú está creciendo de manera constante en el especial la producción de arándanos pero hay una demanda peruana insatisfecha en las maquinarias necesarias para la automatización de los procesos, el Perú acostumbrado a la compra de maquinarias necesita de una tecnología propia y más económica siendo esto una prioridad en el sector. La presente tesis es un aporte para el desarrollo de tecnología propia en la cual se diseñó un sistema Mecatrónico que sel...

  11. Reconocimiento de una plataforma para aterrizaje de UAV mediante procesamiento de imágenes

    OpenAIRE

    Álvarez Piñeiro, Emilio

    2016-01-01

    En el año 2016 se vendieron en EE.UU más de un millón de Unmanned Aerial Vehicles (UAVs, Vehículos aéreos no tripulados), casi el doble que el año anterior, país del que se dispone de información. Para el año 2020 se estima que este mercado alcance los 5.600 millones de dólares en todo el mundo, creciendo a un ritmo del 30% anual. Este crecimiento demuestra que existe un mercado en expansión con muchas y diversas oportunidades de investigación. El rango de aplicaciones en los que se utiliz...

  12. Strategic Behaviour and Performance of internet use by Second-hand Spanish Car Dealers

    OpenAIRE

    Muñoz Gallego, Pablo Antonio; Lahuerta Otero, Eva

    2010-01-01

    [ES] La venta de vehículos de segunda mano a través de Internet está creciendo continuamente, no sólo en los países europeos, sino también en el mercado español. El desarrollo de nuevas tecnologías de información permite a los distribuidores a ampliar sus servicios a nivel mundial, dando a los clientes una amplia gama de opciones en la búsqueda de información y recolección de recursos. Cuestionarios presentados a los concesionarios de automóviles españoles de segunda mano se han utilizado ...

  13. Factores edáficos que influyen en el crecimiento de Vochysia guatemalensis en la región Huetar Norte de Costa Rica

    OpenAIRE

    Mora, Fernando; Muñoz, Roger; Meza, Víctor; Fonseca, William

    2015-01-01

    Se evalúa el crecimiento de Vochysia guatemalensis en Ultisoles e Inceptisoles de la Región Huetar Norte de Costa Rica. Este documento presenta las condiciones de los sitios donde la especie está creciendo en la región bajo estudio. Por medio de variables físicas y químicas de los suelos, se explicó el comportamiento del índice de sitio (IS) y su relación con aquellas variables edáficas que muestran algún tipo de relación con este indicador de la calidad de los terrenos. Además, se determinar...

  14. Mexican Immigrants and Temporary Residents in Canada: Current Knowledge and Future Research

    Directory of Open Access Journals (Sweden)

    Richard E. Mueller

    2005-01-01

    Full Text Available La migración de mexicanos a Canadá, aunque es un fenómeno reciente, ha tenido uno de los incrementos más significativos entre los movimientos de personas de América Latina. Desde mediados de los noventa, el número de mexicanos en Canadá ha estado creciendo rápidamente como resultado del retorno de los descendientes de la población menonita que emigró a México y de las disposiciones del Tratado de Libre Comercio de América del Norte (tlcan, que facilita el ingreso de ciudadanos mexicanos. En este artículo se examina el número de mexicanos en Canadá, el tiempo de su ingreso y el número de migrantes temporales admitidos, y sugiere áreas de investigación para el futuro.

  15. Características psicológicas asociadas a la incidencia de lesiones en deportistas de modalidades individuales

    OpenAIRE

    Rosendo Berengüí-Gil; Enrique J. Garcés de Los Fayos; María D. Hidalgo-Montesinos

    2013-01-01

    Las lesiones deportivas son una de las consecuencias más negativas que se derivan de la práctica deportiva. Son múltiples los factores que pueden estar en su origen, creciendo el interés en la búsqueda de las variables psicológicas que se encuentran asociados a su producción. En el presente estudio se evaluó a 84 deportistas de cuatro disciplinas individuales, de diferentes categorías de competición y nivel competitivo. Se registran 247 lesiones en el período de dos años, una media de 2.94 po...

  16. Análisis energético y exergético de la integración de ciclos criogénicos con plantas de regasificación de gas natural licuado (GNL)

    OpenAIRE

    San José Díaz, Enrique

    2016-01-01

    Durante el año 2014, más del 85% de la energía consumida en el mundo fue de origen fósil. Este 85% se divide fundamentalmente entre tres fuentes distintas: productos petrolíferos, carbón y gas natural. De estos tres, el gas natural destaca, entre otras cosas, por ser el que tiene una extracción y combustión más limpias, o por tener el mayor poder calorífico por unidad de masa en su reacción de combustión. Esas características junto con otras, han permitido que su uso haya estado creciendo res...

  17. El sujeto sufragista, feminismo y feminidad en Colombia: 1930-1957

    OpenAIRE

    2004-01-01

    "La historiografía colombiana de las mujeres ha ido creciendo en las últimas décadas del siglo XX y aunque se han reseñado sus avances, no tengo noticia que haya aún un balance y estado de la cuestión. Un estudio pionero fue el de Diana Medrano y Cristina Escobar, Pasado y presente de las organizaciones femeninas en Colombia. Sobre el tema y el periodo que nos ocupa, han merecido atención los trabajos de Magdala Velásquez, La condición jurídica y social de la mujer, La república liberal y la ...

  18. Estudio tecno-económico del bioproceso de producción de ácido adípico

    OpenAIRE

    Peña Núñez, Álvaro

    2016-01-01

    El ácido adípico o hexanodioico es un ácido orgánico de cadena lineal y seis átomos de carbono. Desde una perspectiva industrial, es el ácido dicarboxílico más importante, con una producción de 2,5 millones de toneladas/año. Su aplicación principal es la producción de nylon 6,6, cuya demanda está creciendo actualmente, especialmente debido a las fibras y resinas de nylon por su uso en la industria de la automoción y del calzado. Otras aplicaciones incluyen su uso en pinturas y recubrimientos,...

  19. El emprendimiento social: una comparativa entre España y países sudamericanos

    Directory of Open Access Journals (Sweden)

    Catalina Nicolás Martínez

    2012-07-01

    Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.

  20. Nuevo comercio de grandes superficies en el mercado minorista en Colombia. Caso Villavicencio

    OpenAIRE

    Molina Parra, María Clemencia

    2013-01-01

    Introducción: el proceso de globalización de la economía mundial registrado en las últimas décadas ha significado la internacionalización de muchas empresas de diferentes sectores productivos; el comercio minorista no ha sido la excepción a esa tendencia. Metodología: es descriptiva. Describe cómo viene creciendo el gran comercio en el país y de manera particular en Villavicencio y la importancia del comercio minorista. Resultados: la contribución al valor agregado del comercio minorista es c...

  1. La desaceleración en la generación de puestos de trabajo: situación actual y perspectivas

    OpenAIRE

    1999-01-01

    A lo largo de 1998 la economía española continuó creciendo a buen ritmo, aunque con un perfil de moderación de sus tasas de aumento, cerrándose el año con una tasa media del 3,8%. Ello se tradujo en una expansión de la ocupación del 3, 4% en dicho año. Por sectores, en la agricultura prosiguió la pauta de destrucción de pu.estos de trabajo registrada a lo largo de la presente década, mientras que el empleo en la construcción fue el que presentó un componamiento más acelerado, a la par que en ...

  2. Diseño de un curso MOOC para las matemáticas básicas en los grados de economía

    OpenAIRE

    González, Alfonso; Calderón, Susana; Rodríguez, Beatriz; Romero, Carlos

    2015-01-01

    Desde la puesta en marcha del EEES fue evidente la necesidad de un curso de inicio a las matemáticas donde se unificara la disparidad de formación matemática que presentaban los alumnos, ya que con los nuevos planes de estudio se produjo una reducción de horas lectivas, lo cual nos obligaba a impartir nuestra docencia de una forma más rápida sin pararnos en detalles que, se suponía, debían conocer. A lo largo de estos años, este curso de inicio ha ido creciendo debido a la gran cantidad de al...

  3. ¿Falsas promesas? El impacto de la titulación de la tierra en el acceso al crédito y al mercado de tierras. Un estudio de caso en Nicaragua

    Directory of Open Access Journals (Sweden)

    Rikke J. Broegaar

    2004-06-01

    Full Text Available Los sistemas de tenencia de la tierra dan forma al desarrollo económico, a la formulación de políticas y a las estructuras de poder dentro de la sociedad. Tienen, asimismo, una fuerte influencia en la distribución de la riqueza dentro de una sociedad. No obstante, a pesar de décadas de reforma agraria en toda América Latina, las más grandes y mejores extensiones de tierra siguen concentradas en manos de grandes terratenientes. El resultado es que las brechas sociales y económicas entre los ricos y los pobres siguen creciendo y la población rural pobre enfrenta condiciones de vida cada vez más precarias (El-Ghonemy 1990, 1999.

  4. Crítica de Libros. Ginestet y otros: Manual de psicofarmacología; Octave Mannoni: Un comienzo que no termina; André Lapierre, Bernard Aucouturier: El cuerpo y el inconsciente en educación y terapia; André Lapierre y Anne Lapierre: El adulto frente al niño.

    Directory of Open Access Journals (Sweden)

    José Jaime Melendo

    1982-01-01

    Full Text Available El profesor Alberto Sois abrió el curso, hará diez años, dedicando tres cuartos de hora a arrojar sobre la mesa de la correspondiente aula de la Facultad de Medicina de la Universidad Autónoma de Madrid, un ejemplar de cada una de las revistas que había recibido el último mes sobre la materia que tenía que enseñar. El sagrado furor del bioquímico creciendo a medida que los tres cajones vomitaban bibliografía ante los ojos de sus estupefactos alumnos puede ilustrar una realidad ineludible de cualquier disciplina que roce, aunque sea de soslayo, lo científico-médico: la de una producción inabarcable de literatura que, en desigual medida, proclama la obsolescencia de los, cada vez más escasos, textos sagrados.

  5. Sistema de gestión de un gimnasio con servicio de guardería

    OpenAIRE

    2015-01-01

    En el día a día y mantenimiento de una empresa o negocio, pronto surge la necesidad de gestionar y almacenar la información, y según va creciendo la cantidad de información relativa al negocio, es más importante o primordial la adopción de soluciones y/o aplicaciones informáticas que nos faciliten dichas labores. Años atrás, antes de que las aplicaciones informáticas estuvieran al alcance de todo tipo de negocios, no quedaba otra solución que almacenar grandes cantidades de información imp...

  6. REDES SOCIALES PARA LA ENSEÑANZA DE IDIOMAS: EL CASO DE LOS PROFESORES

    Directory of Open Access Journals (Sweden)

    César Augusto Borromeo García

    2016-01-01

    Full Text Available El artículo explora teóricamente el uso de redes sociales en la enseñanza y aprendizaje de idiomas. El objetivo es conocer su presencia en la disciplina. La literatura permitió observar las redes sociales existentes y motivos que evitan que sean integradas al plan de estudios. Inicio definiendo redes sociales y explorándolas en tres niveles: educación, enseñanza y aprendizaje de idiomas, y aquellas especializadas en la disciplina. Después se exploran factores de su limitada implementación: institucionales (planeación y decisiones colegiadas, personales (contar con acceso a dispositivos e Internet y pedagógicas (poseer habilidades y destrezas para usarlas. Las conclusiones mencionan que la implementación está creciendo, mejorando planeación y encontrando áreas de oportunidad.

  7. APLICACIONES DE LA CITOMETRÍA DE FLUJO EN MICROBIOLOGÍA, VETERINARIA Y AGRICULTURA

    OpenAIRE

    José Laguado

    2007-01-01

    La citometría de flujo es un método automatizado, multiparamétrico y cuantitativo que analiza las señales dispersadas y fluorescentes producidas por una célula al pasar por un haz de luz. El potencial de los nuevos métodos de análisis en el laboratorio en el campo de la microbiología viene creciendo de manera enorme en los últimos años donde la citometría de flujo se ha consolidando como una herramienta rápida, sencilla, suficientemente sensible, económica, de fácil automatización para las cr...

  8. La “defensa social”. Pugnas y competencias en torno a la mano de obra en el Oriente Boliviano, 1890-1910.

    Directory of Open Access Journals (Sweden)

    Ana María Lema Garrett

    2010-01-01

    la región amazónica boliviana, al norte del país, suscitó profundos cambios en otros departamentos y, entre otras cuestiones, en el mercado laboral. Los departamentos de Beni y de Santa Cruz se constituyeron entonces en reservorios de mano de obra y el flujo migratorio hacia las regiones gomeras del norte fue creciendo proporcionalmente a las necesidades de los empresarios gomeros. Sin embargo, las regiones de origen, y específicamente Santa Cruz, reaccionaron en contra de este “vaciamiento”, desarrollando estrategias para controlar las migraciones o, eventualmente, frenarlas. Este proceso fue acompañado por el despliegue de varias normas novedosas en el ámbito laboral, producto de un debate parlamentario en torno al tema de las migraciones.

  9. Refugio, nido, hogar

    Directory of Open Access Journals (Sweden)

    Neutra, Richard J.

    1960-07-01

    Full Text Available Hablando sobre el tema de realizaciones sociales, los esquemas o programas de conjuntos residenciales, en los cuales he estado ocupado, han ido creciendo hasta alcanzar cifras de presupuesto colosales: treinta y cinco millones de dólares, el Elysian Park Heights; veinticinco millones, Lemoore Navy Town; catorce millones. Mountain Homes, la base aérea de Idaho... Pero ¿qué es todo esto comparado con las ciudades completas que he visitado, o para cuyo estudio, proyecto o emplazamiento he sido consultado?... Chandigarh, en la India; Thema, puerto de la Costa de Oro; Meadowlands, la ciudad africana gemela de Johannesburgo; o Brasilia, orgullo del Presidente Kubitschek, casi a 2.000 km del Palacio de Río y en el interior del país. Sin embargo, yo prefiero citar esquemas de agrupaciones más modestas, pero de gran significado, puesto que no lo es todo el tamaño.

  10. Reflexiones acerca de las familias transfronterizas y las familias transnacionales entre México y Estados Unidos

    Directory of Open Access Journals (Sweden)

    Norma Ojeda

    2009-01-01

    diferentes pero que no se excluyen entre sí, ya que algunas familias pueden comprender ambos tipos. Las familias transfronterizas forman parte de un fenómeno regional propio del espacio de la frontera geográfica entre los dos países, y que data de la creación de la misma. Las familias transnacionales, en cambio, se integran a una situación social más amplia ligada con los flujos de migrantes entre dichos países y con el fenómeno de la globalización. Ambos tipos de familia forman parte de los actuales sistemas de familias de México y Estados Unidos, y se espera que sigan creciendo en número y en complejidad social en cada uno de estos dos países. México-Estados Unidos.

  11. Trabalho rural e fatores de risco associados ao regime de uso de agrotóxicos em Minas Gerais, Brasil Rural work and risk factors associated with pesticide use in Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Wagner Soares

    2003-08-01

    Full Text Available O objetivo deste artigo foi caracterizar o processo do trabalho rural em nove municípios de Minas Gerais, considerando indicadores sócio-demográficos, a estrutura agrária dos estabelecimentos rurais, práticas de trabalho relacionadas ao uso de agrotóxicos e, a intoxicação associada a seu uso. Os dados foram obtidos de uma pesquisa realizada pela Fundação Jorge Duprat Figueiredo, de Segurança e Medicina do Trabalho, que aplicou um questionário a 1.064 trabalhadores rurais, entre os anos de 1991 a 2000. Por meio de uma regressão logística, foram obtidos os fatores de risco associados à intoxicação por agrotóxicos dos grupos organofosforados e carbamatos. Cerca de 50% dos entrevistados se encontravam ao menos moderadamente intoxicados. Os fatores de risco encontrados foram: ter o último contato a menos de duas semanas com agrotóxicos; não usar proteção; ser orientado pelo vendedor; citar organofosforado ou carbamato como agrotóxico principal e trabalhar nos municípios de Teófoli Otoni, Guidoval ou Piraúba. Os resultados apontam para o alto grau de risco de agravos à saúde a que estão sujeitos trabalhadores rurais em contato com agrotóxicos.This paper aimed to characterize the rural work process in nine counties in Minas Gerais State, considering socio-demographic indicators, the land tenure structure of farm operations, and work practices related to pesticide use and poisoning Data were obtained through the Jorge Duprat Figueiredo Foundation for Workers' Safety and Occupational Medicine, which applied a questionnaire to 1,064 rural workers from 1991 to 2000. Through a logistic regression, risk factors associated with pesticide poisoning were obtained for the carbamate and organophosphate groups. Some 50% of interviewees displayed at least moderate pesticide toxicity. Risk factors for pesticide poisoning were: last contact with pesticides less than two weeks before the blood cholinesterase test; no use of personal

  12. PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato

    Directory of Open Access Journals (Sweden)

    Dash Aditya P

    2009-07-01

    Full Text Available Abstract Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR, an Amplification Refractory Mutation System (ARMS and Primer Introduced Restriction Analysis-PCR (PIRA-PCR were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method

  13. 京郊部分牛场荷斯坦母牛脊椎畸形综合征(CVM)遗传缺陷检测%Identiifcation of Complex Vertebral Malformation (CVM) Carriers in Holstein Cows from Suburban Farms in Beijing

    Institute of Scientific and Technical Information of China (English)

    唐韶青; 梁若冰; 云鹏; 杨宇泽; 肖炜; 孙东晓

    2014-01-01

    Complex vertebral malformation (CVM) is a monogenic autosomal recessive hereditary defect of Holstein dairy cattle. It is caused by a point mutation from G to T at the 4 extron in bovine solute carrier family 35, member 3 gene (SLC35A3). Homozygous recessive can cause early pregnancy abortion, stillbirth, or cow calf birth deformities, but carriers are normal. Polymerase chain reaction–primer introduced restriction analysis (PIRA-PCR) was used to detect CVM among 552 Holstein cows from Beijing. As a result, a total of 21 CVM carriers were identiifed. The frequency of carriers was 3.80% and the recessive allele frequency of CVM was 1.90%. Our pedigree studies of the carrier cattle in this experiment revealed that, out of 21 CVM carriers, 13 ones inherited mutation from those mothers and 15 ones were found to be the offspring of Carlin-M Ivanhoe Bell (USA1667366). Based on this, in our country, it is necessary to detect CVM among Holstein cows to prevent the CVM carriers mating and reduce economic losses.%牛脊椎畸形综合征(CVM)是由牛3号染色体上SLC35A3基因第4外显子上的G/T突变引起的隐性遗传疾病,其隐性纯合子可以造成母牛妊娠早期流产、死胎或出生犊牛畸形,而CVM携带者表型正常,无发病表现。本研究利用PIRA-PCR方法对北京地区552头母牛样本进行了检测分析。研究结果表明,所检测的样本中,荷斯坦母牛CVM携带者为21头,携带率为3.80%,有害基因频率为1.90%。通过系谱分析,其中13头携带者的致病基因来源于其母亲,15头CVM携带者为Carlin-MIvanhoeBell(USA1667366)的后代。因此,牛场应当开展母牛CVM筛查,防止CVM携带个体之间的交配,减少经济损失。

  14. Seleção de clones de batata-doce resistentes a insetos de solo Screening of sweet potato clones resistant to soil insects

    Directory of Open Access Journals (Sweden)

    José Ricardo Peixoto

    1999-03-01

    Full Text Available O objetivo deste trabalho foi selecionar clones comerciais de batata-doce para a região do Triângulo Mineiro. Dos clones avaliados, 60 foram obtidos por policruzamentos e cedidos pela Universidade Federal de Lavras (UFLA, três, entre produtores rurais dos municípios de Araguari, Uberlândia e Machado, todos do Estado de Minas Gerais, e outros nove foram usados como testemunhas (Brazlândia Branca, Brazlândia Rosada, Surpresa, Rio Doce, Morena Roxa, Coquinho, Arroba, Pira 1 e o Clone 042. O experimento foi instalado no espaçamento de 1,10 x 0,45 m, utilizando-se o delineamento blocos casualizados, com 72 tratamentos, quatro repetições e 16 plantas por parcela. Entre os clones avaliados 32,8% apresentaram alta ou moderada resistência a insetos de solo. O clone 95041 foi o mais produtivo, com 28.048,96 kg/ha. Os clones 95009, 95010, 95014, 95020, 95033, 95042 e 95057 foram altamente resistentes a insetos de solo.A research was carried out with the objective of selecting commercial clones for weather conditions of the Triângulo Mineiro, Minas Gerais State, Brazil. Sixty of the clones evaluated were obtained by polycross and given by the Universidade Federal de Lavras, three were from the farmers of the municipalities of Araguari, Uberlândia and Machado, located in Minas Gerais State, and nine clones were used as standards (Brazlândia Branca, Brazlândia Rosada, Surpresa, Rio Doce, Morena Roxa, Coquinho, Arroba, Pira 1 and Clone 042. The experiment was installed in a spacing of 1.10 x 0.45 m, using a randomized block design, with 72 treatments, four replicates and 16 plants per plot. Among the evaluated clones, 32.8% showed high or moderate resistance to soil insects. The clone with the highest yield was the clone number 95041, which produced 28,048.96 kg/ha. The others, 95009, 95010, 95014, 95020, 95033, 95042 and 95057 were highly resistant to soil insects.

  15. Disponibilidade hídrica e germinação de sementes de cebola (Allium cepa L. Water availability and germination of onion seeds (Allium cepa L.

    Directory of Open Access Journals (Sweden)

    Z. Piana

    1994-12-01

    Full Text Available Objetivando verificar a influência do teor de água do substrato na germinação de sementes de cebola (Allium cepa L., conduziu-se um ensaio sob condições de ambiente de laboratório. Os efeitos de cinco níveis de água no substrato solo x areia (3:1, 20, 40, 60, 80 e 100% da capacidade de retenção foram avaliados através da porcentagem de emergência no 14° dia da semeadura e pesos da matéria verde e seca das plântulas normais. Para tanto, 200 sementes do cultivar Pira Ouro por tratamento, em quatro repetições de 50, foram semeadas a 1,5 cm de profundidade, mantendo-se constantes os níveis de água no substrato. Os resultados possibilitaram concluir que os níveis de umidade do solo indicados para germinação de sementes de cebola são de 40% e 60% da capacidade de retenção do substrato, por possibilitarem uma melhor emergência, peso da matéria verde e seca das plântulas.One essay was conducted under laboratory conditions, in order to verify the influence of substrate water content on the germination of onion (Allium cepa L. seeds. The effect of five water levels in the medium soil x sand (3:1 - 20, 40, 60, 80 and 100% retention capacity-were evaluated through the emergence percentage 14 days after seedling and the weight of fresh and dry matters of normal seedlings. For that purpose, 200 treated seeds of Pira Ouro cultivar were sown 1.5 cm deep in four replicátions of 50, with a constant water content in the medium. The best results showed that the soil moisture levels suggested for the germination of onion seeds were 40% to 60% of the substrate retention capacity, once they provide better emergence, weight of the fresh and dry matters of seedlings.

  16. Comparison of metering mechanisms of corn seed Comparação entre mecanismos dosadores de sementes de milho

    Directory of Open Access Journals (Sweden)

    Pedro H. Weirich Neto

    2012-10-01

    Full Text Available It was compared the performance of the metering mechanism of corn seeds (Zea mays in direct seeding in an area of ​​200 ha, a property in Piraí do Sul, State of Paraná - PR, in Brazil. It was seeded 4 maize hybrids, 50 ha of each, with seeds of different sieves. The experiment was conducted in a randomized block design (RBD, with 3 treatments and 9 repetitions for each corn hybrid. The treatments were the pneumatic seed of metering mechanisms, horizontal perforated disc with and without ramp®. The plots were 40 m² and were distributed at the early, middle and late sowing. The variables analyzed in each corn hybrid were initial population, faulty spacing, multiple spacing, acceptable spacing, and yield components. As there were no significant differences in the variables, it was concluded that the quality of seeding with different systems of distribution was similar in the different sieves of distributed corn seeds.Comparou-se o desempenho dos mecanismos dosadores de sementes de milho (Zea mays em semeadura direta, numa área de 200 ha, numa propriedade do município de Piraí do Sul - PR. Semearam-se quatro híbridos de milho, 50 ha cada, com sementes de peneiras distintas. O experimento foi conduzido no delineamento em blocos ao acaso (DBC, sendo três tratamentos e nove repetições para cada híbrido de milho. Os tratamentos consistiram nos mecanismos dosadores de sementes pneumáticos, disco perfurado horizontal com e sem rampa®. As parcelas tinham 40 m² e foram distribuídas no início, meio e final da semeadura. As variáveis analisadas em cada híbrido de milho foram: população inicial, espaçamentos falhos, espaçamentos múltiplos, espaçamentos aceitáveis e os componentes de rendimento. Como não houve diferenças significativas nas variáveis analisadas, concluiu-se que a qualidade de semeadura com diferentes sistemas de distribuição foi semelhante nas distintas peneiras de sementes de milho distribuídas.

  17. Vírus da doença de Newcastle em aves não vacinadas no Estado do Rio de Janeiro Serology for the Newcastle disease virus in non vaccinated birds in the State of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Jorge Granja de Oliveira Junior

    2003-04-01

    Full Text Available O vírus da doença de Newcastle (VDN tem sido isolado na maioria das espécies de aves de vida livre e doméstica em todo o mundo. O comércio internacional de aves deve ser considerado como um fator importante na disseminação da doença. Infecções naturais e experimentais já foram demonstradas em, pelo menos, 236 espécies de aves. Portanto, aves silvestres livres ou cativas, e aves domésticas não vacinadas, podem atuar como reservatório para o VDN. Para analisar esta hipótese, aves do Zoológico Municipal do Rio de Janeiro e de propriedades particulares nos municípios de Seropédica, Japeri, Paulo de Frontin, Paracambi, Valença, Barra do Piraí, Rio de Janeiro e Nova Friburgo tiveram sangue coletado para detecção de anticorpos para VDN. Um painel de 837 plasmas foi obtido, no período de agosto de 1998 a julho de 2001, e analisado pelo teste de inibição da hemaglutinação (HI, dos quais 12 foram soropositivas (1,43% para o VDN, indicando prévio contato das aves com o patógeno.The Newcastle disease virus (NDV has been isolated in most of the species of free and domestic life all over the world. The international trade of birds should be considered as an important factor of disease spread. Natural and experimental infections were already demonstrated in, at least, 236 species of birds. Therefore, wild, free or captive, and non vaccinated domestic birds can act as reservoir for VDN. To analyze this hypothesis, birds from the municipal Zoo of Rio de Janeiro and from private properties in the municipal districts of Seropédica, Japeri, Paulo de Frontin, Paracambi, Valença, Barra do Piraí, Rio de Janeiro and Nova Friburgo, RJ, Brazil had their blood collected and plasmas stored for detection of antibodies levels for VDN. A panel of 837 plasmas was obtained, in the period of August of 1998 to July of 2001, and analyzed by the hemaglutination inhibition (HI test, from which 12 were soropositives (1.43% for NDV, indicating the

  18. Esputos de papel. La historieta ‘underground’ española

    Directory of Open Access Journals (Sweden)

    Dopico, Pablo

    2011-09-01

    Full Text Available To know the origin and development of contemporary Spanish comic, we get into the suburbs of visual culture to discover the history of Spanish underground comics. A comic with which, thanks to the relative freedom of expression offered, the counterculture found a versatile vehicle that could express themselves without problems, becoming a new form of social protest and claim it offers an invaluable testimony to the Spanish reality, superior to that afforded other contemporary arts. The text examines the main features, aesthetic aspects and new language of Spanish comix, discovering the main authors (Ceesepe, Gallardo, Mariscal, Max and Nazario, series (Makoki, The Garriris, Gustavo, Anarcoma,... and magazines (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, and showing its connection with other arts, as painting, cinema and photography, not to mention its relationship to the world of drugs and rock music.

    Para conocer el origen y desarrollo de la historieta española contemporánea, debemos adentrarnos en los suburbios de la cultura visual. Así descubriremos la historia del cómic underground español. Un cómic donde, gracias a la relativa libertad de expresión que ofrecía, la contracultura encontró un vehículo versátil con el que podía expresarse sin trabas, convirtiéndose en una nueva forma de protesta y reivindicación social que ofreció un impagable testimonio de la realidad española, superior al que ofrecen otras artes coetáneas. El artículo analiza las principales características, aspectos estéticos y novedades lingüísticas del comix español, descubriendo sus principales autores (Ceesepe, Gallardo, Mariscal, Max y Nazario, series (Makoki, Los Garriris, Gustavo, Anarcoma,… y revistas (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, y mostrando su

  19. Trabalho rural e fatores de risco associados ao regime de uso de agrotóxicos em Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Wagner Soares

    Full Text Available O objetivo deste artigo foi caracterizar o processo do trabalho rural em nove municípios de Minas Gerais, considerando indicadores sócio-demográficos, a estrutura agrária dos estabelecimentos rurais, práticas de trabalho relacionadas ao uso de agrotóxicos e, a intoxicação associada a seu uso. Os dados foram obtidos de uma pesquisa realizada pela Fundação Jorge Duprat Figueiredo, de Segurança e Medicina do Trabalho, que aplicou um questionário a 1.064 trabalhadores rurais, entre os anos de 1991 a 2000. Por meio de uma regressão logística, foram obtidos os fatores de risco associados à intoxicação por agrotóxicos dos grupos organofosforados e carbamatos. Cerca de 50% dos entrevistados se encontravam ao menos moderadamente intoxicados. Os fatores de risco encontrados foram: ter o último contato a menos de duas semanas com agrotóxicos; não usar proteção; ser orientado pelo vendedor; citar organofosforado ou carbamato como agrotóxico principal e trabalhar nos municípios de Teófoli Otoni, Guidoval ou Piraúba. Os resultados apontam para o alto grau de risco de agravos à saúde a que estão sujeitos trabalhadores rurais em contato com agrotóxicos.

  20. 我国荷斯坦种公牛CVM遗传缺陷基因的分子检测%Identification of Complex Vertebral Malformation Carriers in Chinese Holstein Bulls

    Institute of Scientific and Technical Information of China (English)

    范学华; 张毅; 公维嘉; 谢岩; 孙东晓; 王雅春; 俞英; 张沅

    2010-01-01

    研究运用引入酶切位点聚合酶链式反应(PIRA-PCR)方法检测牛脊柱畸形综合症(CVM)在我国荷斯坦种公牛中的携带情况.共检测了来自全国14个公牛站的587头种公牛,结果表明:携带者56头,携带率为9.54%.系谱分析确认40头携带者公牛是Carlin-M Ivanhoe Bell的后代.对公牛信息统计显示,2001-2007年各年度出生的种公牛都保持较高的CVM携带率(8.22%~15.56%).美国、加拿大和澳大利亚是我国引进公牛的主要来源国,进口公牛的CVM携带率分别为11.37%、3.73%和14.29%.此外,本研究还对我国荷斯坦牛CVM遗传缺陷的控制和CVM携带公牛的利用提出建议.

  1. Electrical conductivity and emerging contaminant as markers of surface freshwater contamination by wastewater.

    Science.gov (United States)

    de Sousa, Diana Nara Ribeiro; Mozeto, Antonio Aparecido; Carneiro, Renato Lajarim; Fadini, Pedro Sergio

    2014-06-15

    The use of chemical markers of undoubted anthropogenic sources for surface freshwater contamination by wastewaters was evaluated employing correlations observed between measured physico-chemical parameters as the electrical conductivity and the concentration of different emerging organic compounds. During the period from April/2011 to April/2012 spatial-temporal variations and contamination patterns of two rivers (Piraí and Jundiaí rivers), São Paulo state, Brazil were evaluated. Seven physico-chemical parameters and concentrations of different classes of emerging contaminants were determined in samples collected in seven field campaigns. The high linear correlation coefficients obtained for the compounds diclofenac (r=0.9085), propanolol (r=0.8994), ibuprofen (r=0.8720) and atenolol (r=0.7811) with electrical conductivity, also corroborated by principal component analysis (PCA), point to the potential use of these compounds as markers of investigated surface water contamination by wastewaters. Due to specific inputs, these environmental markers showed very good effectiveness for the identification and differentiation of water body contamination by discharges of treated and untreated urban sewage.

  2. UTILIZAÇÃO DE RECURSOS ERGOGÊNICOS NUTRICIONAIS E/OU FARMACOLÓGICOS EM UMA ACADEMIA DA CIDADE DE BARRA DO PIRAÍ, RJ

    Directory of Open Access Journals (Sweden)

    Luana Palmeira Pereira

    2014-02-01

    Full Text Available The habit of doing workouts combined with use of nutritional ergogenic or pharmacological has grown considerably in the last years. Whether for esthetic reasons or in order to improve some performance aspects, athletes consume a large amount of these products. In this sense, the purpose of this study is: survey the consumers profile of a nutritional ergogenic resources in Barra do Piraí gyms (RJ state, enumerate the products used by users of both sexes and verify the prescription source of these products to researched participants, ascertain if the participants achieved the expected results with use of these products and if they caused any side effects. This is an observational study, which evaluated 101 athletes of both genders and social classes. It was found that the majority of participants 75% (n = 76 reported the use of nutritional ergogenic or pharmacological, with the highest prevalence among men. Two products were the most consumed: whey protein 56.57% (n = 34 and creatine 42.10% (n = 25. The majority 45% (n = 34 reported consuming ergogenic without an expert guidance. Therefore, that the study shows the importance of each time more the professional in the field of nutrition be inserted in the sports ground for possible explanations about the effects of this product type is found between sportsman.

  3. Systems Biology Strategy Reveals PKC-delta is Key for Sensitizing TRAIL-Resistant Human Fibrosarcoma

    Directory of Open Access Journals (Sweden)

    Kentaro eHayashi

    2015-01-01

    Full Text Available Cancer cells are highly variable and resistant to therapeutic intervention. Recently, the use of the tumor necrosis factor related apoptosis-inducing ligand (TRAIL induced treatment is gaining momentum, due to TRAIL’s ability to specifically target cancers with limited effect on normal cells. However, several malignant cancer types still remain non-sensitive to TRAIL. Previously, we developed a dynamic computational model, based on perturbation-response approach, and predicted protein kinase C (PKC as the most effective target, with over 95% capacity to kill human fibrosarcoma (HT1080 in TRAIL stimulation (Piras, V. et al. 2011, Scientific Reports. Here, to validate the model prediction, which has significant implications for cancer treatment, we conducted experiments on two TRAIL-resistant cancer cell lines (HT1080 and HT29. Using PKC inhibitor Bisindolylmaleimide I, we first demonstrate, as predicted by our previous model, cell viability is significantly impaired with over 95% death of both cancer types. Next, to identify crucial PKC isoform from 10 known members, we analyzed their mRNA expressions in HT1080 cells and shortlisted 4 isoforms for siRNA knock-down (KD experiments. From these KDs, PKC-delta produced the most cancer cell death in conjunction with TRAIL. Overall, systems biology approach, combining model prediction with experimental validation, holds promise for TRAIL-based cancer therapy.

  4. International conference centre, Geneva, Switzerland

    CERN Multimedia

    PH Department

    2009-01-01

    On 16-17 March 2009 the Energy Pact Foundation will be holding the Energy Pact Conference in Geneva. The Conference is organised with the support of the Republic and Canton of Geneva and has the Financial Times as its media partner. It will address for the first time in a comprehensive and integrated manner the key issues of energy needs and environmental and developmental challenges. Some 800 stakeholders and experts on these issues are expected. These will include high-level government officials, opinion leaders and representatives from the United Nations, NGOs, industry, civil society and the academic world. Gerhard Schröder, former Chancellor of Germany, will chair the Conference. Speakers with different backgrounds and expertise will include Dr. Carlo Rubia, Nobel Prize Winner, Ali Al-Naimi, Minister of Petroleum and Mineral Resources of Saudi Arabia, Gholam Hossein Nozari, Oil Minister of Iran, Gary Ross, CEO of PIRA Energy, a world-renowned energy market specialist, Ashok Khosla, President of the In...

  5. CUIDADO FAMILIAL DE RECÉM-NASCIDOS NO DOMICÍLIO: UM ESTUDO DE CASO ETNOGRÁFICO

    Directory of Open Access Journals (Sweden)

    Julliana de Souza Leandro

    2011-01-01

    Full Text Available El presente estudio de caso etnográfico es un estudio cualitativo con el objetivo de analizar la dinámica de la atención en el hogar de las familias de los recién nacidos en la ciudad de Piraí-RJ, Brasil. Se recogieron datos de 18 familias de los recién nacidos matriculados en la Unidad de Salud Familiar. Se emplearon los siguientes instrumentos: la entrevista no estructurada, los registros de los miembros de las familias en la Estrategia de Salud Familiar y la observación participante. El análisis temático reveló tres categorías: la dimensión psicológica del cuidado familiar al recién nacido en el hogar, la dimensión biosociocultural del cuidado familiar al recién nacido; y el cuidado familiar a los recién nacidos y su interfaz con el parto y el puerperio. En este estudio las dimensiones psicológicas y biosocioculturales de la atención familiar están presentes en diferentes espacios de la atención de la salud del recién nacido. Se concluye que en el cuidado de los recién nacidos y de la familia en su totalidad es necesario repensar las culturas que se entrelazan con el cuidado familiar y el cuidado profesional

  6. Draft genome sequence of pathogenic bacteria Vibrio parahaemolyticus strain Ba94C2, associated with acute hepatopancreatic necrosis disease isolate from South America.

    Science.gov (United States)

    Restrepo, Leda; Bayot, Bonny; Betancourt, Irma; Pinzón, Andres

    2016-09-01

    Vibrio parahaemolyticus is a pathogenic bacteria which has been associated to the early mortality syndrome (EMS) also known as hepatopancreatic necrosis disease (AHPND) causing high mortality in shrimp farms. Pathogenic strains contain two homologous genes related to insecticidal toxin genes, PirA and PirB, these toxin genes are located on a plasmid contained within the bacteria. Genomic sequences have allowed the finding of two strains with a divergent structure related to the geographic region from where they were found. The isolates from the geographic collection of Southeast Asia and Mexico show variable regions on the plasmid genome, indicating that even though they are not alike they still conserve the toxin genes. In this paper, we report for the first time, a pathogenic V. parahaemolyticus strain in shrimp from South America that showed symptoms of AHPND. The genomic analysis revealed that this strain of V. parahaemolyticus found in South America appears to be more related to the Southeast Asia as compared to the Mexican strains. This finding is of major importance for the shrimp industry, especially in regards to the urgent need for disease control strategies to avoid large EMS outbreaks and economic loss, and to determine its dispersion in South America. The whole-genome shotgun project of V. parahaemolyticus strain Ba94C2 have been deposited at DDBJ/EMBL/GenBank under the accession PRJNA335761.

  7. Capitalismo y organización de los espacios ganaderos en España. El caso de la Cooperativa Agropecuaria de Guissona

    Directory of Open Access Journals (Sweden)

    José Antonio Segrelles Serrano

    1999-01-01

    Full Text Available El proceso de intensificación productiva de la ganadería espaflola se relaciona directamente con la penetración del sistema capitalista en el sector agropecuario. Las necesidades y exigencias de este modo de producción tienen una dimensión espacial que se refleja en la forma en que se produce la apropiación, gestión y organización del territorio por parte de las empresas más poderosas del sector, cuyos centros de trabajo y producción se diseminan en el espacio para realizar complejos procesos productivos que generan plusvaiias y una posterior acumulación del capital en sus sedes metropolitanas. Cataluña ha sido la región espaflola pionera en la adopción de métodos intensivos y capitalistas en la ganadería. lo que permitió una acumulación de capital más antigua y eficaz. Desde el área metrooolitana de Barcelona v sectores próximos. muchas empresas. autóctonas y extranjeras. timan las decisiones inversoras que serán determinantes pira la creación, transformación y control de los espacios agropecuarios. tanto catalanes como del resto del Estado.

  8. Photorhabdus luminescens PirAB-fusion protein exhibits both cytotoxicity and insecticidal activity.

    Science.gov (United States)

    Li, Yusheng; Hu, Xiaofeng; Zhang, Xu; Liu, Zhengqiang; Ding, Xuezhi; Xia, Liqiu; Hu, Shengbiao

    2014-07-01

    The binary toxin 'Photorhabdus insect-related' proteins (PirAB) produced by Photorhabdus luminescens have been reported to possess both injectable and oral activities against a range of insects. Here, PirAB-fusion protein was constructed by linking pirA and pirB genes with the flexible linker (Gly4 Ser)3 DNA encoding sequence and then efficiently expressed in Escherichia coli. To better understand the role of PirAB toxin played in the process of invasion, its cytotoxicity against insect midgut CF-203 cells was investigated. Application of purified PirAB-fusion protein as well as PirA/PirB mixture caused loss of viability of CF-203 cells after 24 h incubation. CF-203 cells treated by PirAB-fusion protein displayed morphological changes typical of apoptosis, such as cell shrinkage, cell membrane blebbing, nuclear condensation and DNA fragmentation. Moreover, PirAB-fusion protein also exhibited injectable insecticidal activity against Spodoptera exigua larvae. The bodies of S. exigua fourth-instar larvae injected with PirAB-fusion protein turned completely black. Thus, we concluded that PirAB-fusion protein possessed similar biological activity (cytotoxicity and insecticidal activity) to PirA/PirB mixture, which would enable it to be used as an efficient agent for pest control.

  9. Identidade, riqueza e abundãncia de pequenos mamíferos (Rodentia e Didelphimorphia de área de Floresta com Araucária no estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Grazzini

    2015-01-01

    Full Text Available Roedores e Marsupiais são componentes importantes da fauna na região Neotropical. Estudos sobre a riqueza e abundância destes animais são raros na Floresta Ombrófila Mista (FOM e aqui apresentamos um inventário conduzido na Floresta Nacional de Piraí do Sul. Esta área possui uma área aproximada de 150 ha, cercada por pastos e plantações de Pinus. A amostragem foi feita através de armadilhas de queda, Sherman e Tomahawk, dispostas nos principais tipos de vegetação encontrados. Pelo menos um casal de cada espécie foi coletado. Como resultado, durante 5.892 armadilhas.noite nós obtivemos um total de 1.049 capturas, representando 17 espécies: Akodon montensis, Bibimys labiosus, Brucepattersonius iheringi, Cryptonanus sp., Didelphis albiventris, D. aurita, Gracilinanus microtarsus, Monodelphis americana, M. scalops, Myocastor coypus, Nectomys squamipes, Oligoryzomys nigripes, Oxymycterus judex, O. nasutus, Sooretamys angouya e Thaptomys nigrita. Capturas por armadilhas de queda representaram 67% do total, e oito espécies foram registradas exclusivamente por este método. Akodon montensis, O. nigripes e T. nigrita foram as espécies mais abundantes.

  10. Registro Preliminar de Macrohongos (Ascomycetes y Basidiomycetes en el Bosque Húmedo Montano del Alto El Romeral (Municipio de Angelópolis, Departamento de Antioquia - Colombia Preliminar Report of Macrofungi (Ascomycetes and Basidiomycetes in the Romeral's Montain Humid Forest (Angelopolis, Antioquia - Colombia

    Directory of Open Access Journals (Sweden)

    José David Sierra Toro

    2011-12-01

    Full Text Available Los macrohongos desempeñan un papel importante en el ciclado de nutrientes, en especial en el del carbono, al participar activamente en los procesos de descomposición de la materia orgánica dentro de los bosques tropicales. El conocimiento de la diversidad de este grupo en Colombia está aún incompleto. Como contribución a este tema, se desarrolló durante cinco meses en cuatro hectáreas de un bosque húmedo montano del Departamento de Antioquia, el trabajo que reporta y describe un total de 40 especies de macrohongos (dos de ellas posiblemente nuevas para la ciencia pertenecientes a 34 géneros y 18 familias, creciendo sobre diferentes tipos de sustrato. La familia Marasmiaceae fue la más diversa con cinco especies, seguida por Boletaceae, Polyporacea y Russulaceae con cuatro especies cada una. Hypholoma, Lactarius y Marasmius fueron los géneros más importantes con tres especies cada uno. Las especies de mayor ocurrencia fueron Auricularia delicata (Fr. Henn., Xylaria polymorpha (Pers. Grev. y Ganoderma applanatum (Pers. Pat. La mayor cantidad de especies se registró creciendo sobre troncos caídos (19 especies y la menor sobre hojarasca (seis especies.Macrofungi play an important role in nutrient cycling. Especially, they are important drivers in the carbon cycling and in the organic matter decomposition process in tropical forests. In Colombia the knowledge on diversity of this group is still very poor. Through this work we intend to contribute to this knowledge. The macrofungi diversity was assessed on three different substrates on a 4 ha wet montane forest in the Antioquia province during five months. Forty species of macrofungi (two of them possible new species to science belonging to 34 genera and 18 families were recorded. Marasmiaceae was the most diverse family with five species followed by Boletaceae, Polyporacea and Russulaceae with four species each one. Hypholoma, Lactarius and Marasmius were the most important genera

  11. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas Evaluation of cuban hemp, nut sedge, johnson grass and herb of grace extracts in weed control

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.The objective of this work was to evaluate the effect of the extracts of the species Macrophylla furcraea Baker (cuban hemp, Cyperus rotundus L (nut sedge, Sorghum bicolor L (johnson grass and Ruta graveolens L (herb of grace on seed germination of two weeds and one crop. The extracts were obtained by the Soxhlet method, using water, ethanol and chloroform as solvents. Each extract was evaluated in three dilutions (0, 5 and 10 % v/v and was applied to Bidens pilosa L (spanish needle, Amaranthus dubius Mart (spleen amaranth and Coriandrum sativum L (coriander seeds. Three replications of 50 seeds each one were used and the control was watered only with destilled water. The results

  12. La deuda pública y sus implicaciones. Un modelo The implications of public debt. a model

    Directory of Open Access Journals (Sweden)

    Salas Gustavo

    1997-06-01

    Full Text Available La crisis de la deuda pública es generalmente un reflejo de una crisis fiscal, como lo muestra el modelo que se propone este artículo en el que el endeudamiento externo ha sido suscrito por el gobierno. Al interrumpirse el financiamiento externo, los gobiernos no pudieron reducir los déficits con tanta rapidez y tuvieron que recurrir a fuentes internas. El modelo muestra que si la economía no está creciendo, la financiación con deuda constituye un factor adicional de perturbación a la estabilidad macroeconómica.The crisis of the public debt generally is the reflect of a fiscal
    crisis. As in the model, where the external debt belongs to the
    government. when the external financing stops, the governments can not reduce its deficits at the same speed so they have to look out for internal financing. The model shows that if the economy is not growing, the financing with debt constítutes and additional factor of perturbation to the macroeconomic stability

  13. Metacognición y comunidades virtuales de soporte: implicaciones en el campo de la salud electrónica

    Directory of Open Access Journals (Sweden)

    Rodrigo Lupercio Riaño Pineda

    2013-06-01

    Full Text Available La internet ha permitido que las personas accedan a una mayor cantidad de información relacionada con la salud. El número de sitios web referidos al cuidado de la salud está creciendo diariamente. Sin embargo, gran cantidad de información no conduce necesariamente a un mejor cuidado de la salud. El objetivo de este artículo es formular el marco teórico que sustenta la inclusión del componente metacognitivo en la creación de las comunidades virtuales de salud. Asimismo, se muestra una experiencia exitosa en el campo de la educación y se proponen algunos lineamientos para el establecimiento de comunidades virtuales de soporte metacognitivo (cvsm en el ámbito de la e-salud. De la misma forma, también se señalan los beneficios que pueden tener los usuarios frente al empoderamiento sobre su condición de salud.

  14. Vigilar y castigar: crisis y disciplinamiento en la Iglesia argentina en los años setenta

    Directory of Open Access Journals (Sweden)

    Obregón, Martín

    2006-06-01

    Full Text Available Since the middle of the 60’s, Catholicism experimented in Argentina a deep internal crisis: vast secular and ecclesiastic groups radicalized and their criticisms were growing in the following years. By the second middle of the 70’s the ecclesiastical hierarchy fixed on to reorganize the Church on Conservative grounds and to discipline the more radical groups inside the Catholic ground. I attempt to analyze the theological, liturgical, and pastoral characteristics of this process during the first years of the latter Military Dictatorship.

    Desde mediados de la década de 1960, el catolicismo argentino sufrió una aguda crisis interna, caracterizada por la radicalización de vastos sectores, tanto clericales como laicos, cuyos cuestionamientos fueron creciendo con el correr de los años. Desde los años setenta, la jerarquía eclesiástica estableció como objetivo central la reorganización de la Iglesia sobre bases conservadoras, lo que implicaba disciplinar a los sectores más radicalizados del campo católico. En este trabajo se analizan las características que adoptó dicho proceso en la teología, la liturgia y la pastoral durante los primeros años de la última dictadura militar.

  15. La importancia de los activos intangibles en la sociedad del conocimiento

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-11-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  16. Prácticas musicales durante el proceso de urbanización en Bogotá (Colombia, 1900-1940

    Directory of Open Access Journals (Sweden)

    Julio Aldemar Gómez Castañeda

    2015-01-01

    Full Text Available Durante el proceso de urbanización que vivió Bogotá en las primeras décadas del siglo XX, además de los cambios demográficos, de infraestructura o de servicios, las formas de ritualizar alrededor de la música experimentaron una serie de transformaciones. En la medida en que la ciudad fue creciendo, y los tiempos para el entretenimiento y la recreación fueron aflorando, las prácticas musicales se ajustaron a nuevas influencias, espacios, escenarios y condiciones técnicas. Algunas de ellas se renovaron, como los conciertos públicos o las retretas de la banda. Otras como los cafés y los teatros tuvieron su apogeo, y unas más, como la radio y el disco, irrumpieron en la vida de los bogotanos. En este artículo se identifica y caracteriza cada una de estas prácticas, resaltando los personajes, grupos sociales, escenarios e imaginarios que las constituyeron. Desde una perspectiva cultural, y apoyado principalmente en la prensa de la época, se muestra cómo estas formas de habitar con la música, hablan de la transformación de una sociedad local; en este caso, de los cambios que experimentó la sociedad bogotana entre 1900 y 1940.

  17. Prácticas musicales durante el proceso de urbanización en Bogotá (Colombia, 1900-1940

    Directory of Open Access Journals (Sweden)

    Julio Aldemar Gómez Castañeda

    2015-07-01

    Full Text Available Durante el proceso de urbanización que vivió Bogotá en las primeras décadas del siglo XX, además de los cambios demográficos, de infraestructura o de servicios, las formas de ritualizar alrededor de la música experimentaron una serie de transformaciones. En la medida en que la ciudad fue creciendo, y los tiempos para el entretenimiento y la recreación fueron aflorando, las prácticas musicales se ajustaron a nuevas influencias, espacios, escenarios y condiciones técnicas. Algunas de ellas se renovaron, como los conciertos públicos o las retretas de la banda. Otras como los cafés y los teatros tuvieron su apogeo, y unas más, como la radio y el disco, irrumpieron en la vida de los bogotanos. En este artículo se identifica y caracteriza cada una de estas prácticas, resaltando los personajes, grupos sociales, escenarios e imaginarios que las constituyeron. Desde una perspectiva cultural, y apoyado principalmente en la prensa de la época, se muestra cómo estas formas de habitar con la música, hablan de la transformación de una sociedad local; en este caso, de los cambios que experimentó la sociedad bogotana entre 1900 y 1940.

  18. Avaliação perceptiva da imagem corporal: história, reconceituação e perspectivas para o Brasil Evaluación de la percepción de la imagen del cuerpo: historia, reconceptualization y perspectivas para el Brasil Perceptive evaluation of body image: history, reconceptualization and perspectives for Brazil

    Directory of Open Access Journals (Sweden)

    Maria da Consolação Gomes Cunha Fernandes Tavares

    2010-09-01

    Full Text Available As pesquisas em Imagem corporal têm crescido em número no Brasil, porém a avaliação da dimensão perceptiva da imagem corporal é um tema pouco explorado. O objetivo deste artigo é rever criticamente a história, as características, os fatores intervenientes da avaliação perceptiva e apresentar perspectivas para o Brasil.La investigación en imagen del cuerpo ha estado creciendo en gran número en el Brasil. Sin embargo, la evaluación de la dimensión de la percepción de la imagen corporal es área poco explorada. La finalidad de este artículo es repasar críticamente la historia, las características, los factores de intervención de evaluación de la percepción y presentar perspectivas para el Brasil.The research in Body image has been growing in number in Brazil. However, the evaluation of the perceptual dimension of Body Image is little explored area. The aim of this article is to critically review the history, the characteristics, the intervening factors of perceptual evaluation and to present perspectives for Brazil.

  19. Bogotá: metrópoli de conflictos

    Directory of Open Access Journals (Sweden)

    Adriana Patricia López Velázquez

    2009-01-01

    Full Text Available En este ensayo se presentan dos aspectos de Bogotá. Por un lado, la metrópoli que está creciendo y que reporta cifras positivas en la tendencia del periodo analizado, en referencia a indicadores como el de las necesidades básicas insatisfechas (NBI, el índice de desarrollo humano (IDH, y la inversión extranjera directa. Es la Bogotá que disfruta de la exigencia y el acceso a los mercados más dinámicos y en general a la globalización. Por otro lado, la Bogotá de los que no tienen empleo, cuya capacidad de pago es bastante limitada, y viven en el sobresalto de la inseguridad. Este trabajo pretende mostrar –desde una perspectiva holística– que en el mismo espacio existen dos comunidades mutuamente complementarias y funcionales que, dentro del articulado teórico general del proyecto de investigación de Sanabria y López (2008, se conjugan para organizar los elementos comprensivos de la calidad de la vida.

  20. INOCULACIÓN IN VITRO DE LA ROYA BLANCA (Puccinia horiana HENNINGS EN CRISANTEMO (Dendranthema grandiflora TZVELEV

    Directory of Open Access Journals (Sweden)

    C\\u00E9sar Vences-Contreras

    2008-01-01

    Full Text Available El presente estudio tuvo como finalidad el desarrollar la técnica de inoculación in vitro de la roya blanca, con el objeto de ahorrar tiempo y espacio en la caracterización de los distintos cultivares de crisantemo respecto al grado de susceptibilidad o resistencia a este patógeno. En Tenancingo, Estado de México, en el periodo 2004-2005 se colectaron hojas de crisantemo que presentaban daños por la enfermedad, se desinfectaron para posteriormente inocular las pústulas sobre plantas creciendo bajo condiciones in vitro. El recipiente de cultivo se mantuvo a una humedad relativa alrededor del 95% y temperaturas entre los 13 y 27 ºC, bajo condiciones de luz y oscuridad. Los daños por la enfermedad se manifestaron a los 20 días después de la inoculación. Los tratamientos a 17 ºC y oscuridad generaron un mayor número de pústulas (18,7. El diámetro de las pústulas fluctuó entre los 0,71 mm (tratamientos con 17 ºC y luz a los 1,79 mm en los tratamientos con 19 ºC y bajo oscuridad.

  1. Descubrimiento de conocimiento en los negocios

    Directory of Open Access Journals (Sweden)

    Johany Armando Carreño Gamboa

    2013-06-01

    Full Text Available Ante la internacionalización de la economía, las organizaciones requieren basarse en la información y el conocimiento, apoyadas en tecnologías de la información y comunicación (TIC, pensar globalmente en políticas integrales y basarse en economías en red bajo esquemas asociativos que las fortalezcan. El creciendo de empresas en los últimos años, hace prioritario tratar de obtener conocimiento útil desde los propios datos y dar un paso más allá en el apoyo a la toma de decisiones más acertada. A tal fin, se ofrece en el documento información básica acerca de la minería de datos, se reconocen sus diferentes etapas y se determina su relación con otras disciplinas. Además se da a conocer el funcionamiento del tipo de algoritmo “árboles de decisión” y, se utiliza la herramienta “Weka” para ajustar modelos a conjuntos de datos.

  2. Carcinoma verrugoso

    Directory of Open Access Journals (Sweden)

    Esteban Quesada Jiménez

    2004-09-01

    Full Text Available Se presenta el caso de un paciente masculino de 76 años, vecino de Turrialba, agricultor, que consultó por una lesión de 3 años de evolución, localizada en la palma de la mano derecha a nivel palmar y compromiso de los dedos de la misma mano, caracterizada como una neoformación exofítica verrugosa de 5 por 11 cm. aproximadamente, con material caseoso entre sus crestas. La lesión ha estado creciendo de forma acelerada en los últimos 3 meses, causándole dolor y que le imposibilita ellaborar. Se le realizaron exámenes y se descartaron varias causas infecciosas, y concluyendo luego de varias biopsias con el diagnóstico de un carcinoma verrugoso. El paciente fue tratado mediante una amputación parcial de la mano. Este tumor es una variante del carcinoma epidermoide y presentamos su clasificación, patogénesis, histopatología, manifestaciones clínicas más frecuentes y diagnóstico diferencial.

  3. El TLCAN una forma de integración económica dualista: comercio externo e inversión extranjera directa

    Directory of Open Access Journals (Sweden)

    Cuauhtémoc Calderón Villarreal

    2011-01-01

    a través del movimiento de capitales y el comercio exterior. El TLCAN por su naturaleza "dual" favoreció en su interior la especialización de los flujos de comercio y de Inversión Extranjera Directa (IED entre los tres países; fortaleció entre México y los Estados Unidos la IED vertical, complementaria del comercio exterior que busca bajos salarios Y favoreció los flujos de IED de alta tecnología entre los Estados Unidos y Canadá con altos salarios. Además, desde la vigencia del tratado, los tres países mantuvieron tasas de crecimiento diferenciadas, siendo México el que mantuvo la tasa de crecimiento más baja. La brecha económica y tecnológica entre México y sus socios, los Estados Unidos y Canadá, fue creciendo desde la firma del TLCAN. En este trabajo se estudian los límites del TLCAN, analizando la interacción de los flujos de comercio intra-regional y la inversión extranjera directa en la región, durante el periodo de 1994 al 2008. Periodo en el cual la recesión norteamericana del 2001- 2002 constituyó un punto de infleción que modificó el comportamiento del flujo de IED en la región.

  4. Control de brazo electrónico usando señales electromiográficas

    Directory of Open Access Journals (Sweden)

    Jorge Andrés García-Pinzón

    2015-05-01

    Full Text Available Los trabajos enfocados en la extracción de patrones en señales electromiográficas (SEMG han venido creciendo debido a sus múltiples aplicaciones. En este artículo se presenta una aplicación en la cual se implementa un sistema electrónico para el registro de las SEMG de la extremidad superior en un sujeto, con el fin de controlar de forma remota un brazo electrónico. Se realizó una etapa de preprocesamiento de las señales registradas, para eliminar información poco relevante, y reconocimiento de zonas de interés; enseguida se extraen los patrones y se clasifican. Las técnicas utilizadas fueron: análisis wavelet (AW, análisis de componentes principales (ACP, transformada de fourier (TF, transformada del coseno discreta (TDC, energía, máquinas de soporte vectorial (MSV o SVM y redes neuronales (RNA. En este artículo se demuestra que la metodología planteada permite realizar un proceso de clasificación con un rendimiento superior al 95%. Se registraron más de 4000 señales.

  5. Estudios culturales y cine en España Cultural Studies and film in Spain

    Directory of Open Access Journals (Sweden)

    Manuel Palacio Arranz

    2007-10-01

    Full Text Available Este trabajo presenta el uso de las metodologías de los estudios culturales por los docentes e investigadores españoles. Estas metodologías de trabajo todavía resultan periféricas en los estudios de cine en España; sin embargo, está creciendo el número de publicaciones genéricamente adscritas a planteamientos culturalistas; en especial,y lo han hecho los estudios sobre el público del cine y los de género, y en menor medida los de recepción fílmica, la representación de los estereotipos y recientemente los estudios transnacionales. This paper presents the use of the different methodologies in cultural studies by Spanish researchers and academics. These working methodologies are still peripheral in film studies in Spain, although the number of publications generically adhering to cultural studies viewpoints are increasing, above all those studies concerning film audience or gender and, to a lesser extent, those dealing with film reception, stereotype representation and more recently transnational studies.

  6. TEORÍA TRANSTEORÉTICA DE CAMBIO DE CONDUCTA: HERRAMIENTA IMPORTANTE EN LA ADOPCIÓN DE ESTILOS DE VIDA ACTIVOS

    Directory of Open Access Journals (Sweden)

    Carlos Álvarez

    2008-07-01

    Full Text Available A pesar del culto a la belleza que ha regido en esta sociedad globalizada, y a la importancia de la actividad física en relación con la prevención de las enfermedades cardiodegenerativas (US.DHHS, 1996, el sedentarismo sigue creciendo en la población. ¿Qué estrategias puede usar un profesional en movimiento humano para lograr activar a la población? Es aquí donde surge el modelo transteorético como una opción innovadora que supera con creces las intervenciones biologistas clásicas y cortoplacistas, donde ha prevalecido el centrarse en los cambios momentáneos dados por valores fisiológicos. Esta teoría muestra gran potencial, ya que ofrece los fundamentos teóricos que posibilitan la adquisición de una conducta activa. Este artículo explica los fundamentos teóricos del modelo transteorético, incluyendo la forma de valorar los estadios de cambio y de desarrollar diferentes estrategias para movilizar a la persona, usando los procesos de cambio y los conductuales.

  7. ¿Cómo planear financiera y tributariamente una pyme?

    Directory of Open Access Journals (Sweden)

    Dilia Castillo

    2008-10-01

    Full Text Available Las Pyme son las unidades económicas más pequeñas, yen ellas germinan las grandes ideas empresariales. Nacen en el núcleo familiar y van creciendo a medida que el mercado demanda sus productos o servicios. En este nivel, su capital de trabajo es igual a los aportes del dueño o dueños junto con la escasa inversión en tecnología, investigación y desarrollo, y capital intelectual entre otras. En este trabajo se han recopilado algunas de las prácticas para la implementación de la cadena valor que permita el crecimientode las Pyme. La planeación financiera y tributaria se presenta dividida en tres etapas teniendo en cuenta: el tamaño, el valor del activo y el número de empleados. De igual manera, es subdividido en los siguientes subtemas de proyección: aporte social, constitución de la empresa, objetivo de creación, estructura de capital, los ingresos, los costos y gastos, los impuestos como gasto, los impuestos como beneficio fiscal, herramientas financieras para la permanente evaluación, la toma de decisiones y continuidad de la empresa, evitando así el cierre definitivo.

  8. TELESPECTADOR MULTIMEDIA: UNA NUEVA MIRADA HACIA LAS AUDIENCIAS DESDE EL PERIODISMO PARTICIPATIVO

    Directory of Open Access Journals (Sweden)

    Lidiane Ramirez de Amorim

    2009-01-01

    Full Text Available Las tecnologías de información y comunicación han sido responsables por una infinidad de transformaciones, incluso nuevas relaciones entre los sujetos y los distintos medios. Son nuevas funciones cuya aparición coincide con el paso de una comunicación centralizada, hacia un modelo de infinitas posibilidades, que resultan del fenómeno de la mediatización. El presente artículo ofrece algunas reflexiones sobre estos cambios, desde la comprensión acerca de la evolución de los conceptos de audiencia y recepción, hasta la injerencia de estos cambios en la práctica del periodismo, especialmente en la televisión. La discusión aborda algunas posibilidades alcanzadas por este nuevo receptor, que está representada en lo que se ha llamado de periodismo ciudadano o participativo. Una modalidad periodística que está creciendo en el Brasil, pero ya ha transformado este oficio en otras partes del mundo.

  9. Las mujeres y el tabaco: características ligadas al género

    Directory of Open Access Journals (Sweden)

    Becoña Elisardo

    2000-01-01

    Full Text Available El porcentaje de mujeres fumadoras está todavía aumentando en España. Si persisten los patrones actuales de fumar entre las mujeres, el número de muertes continuará creciendo de modo acusado en el próximo siglo. Es posible que en un futuro cercano fumen más mujeres que hombres entre la población adulta española. En esta revisión se actualiza lo que se conoce sobre el impacto que tiene fumar cigarrillos en la salud de las mujeres, los patrones de consumo actuales entre las mismas, los factores especiales que influyen en que fumen y las dificultades que tienen cuando consideran e intentan dejar de fumar. También sugerimos formas en las cuales el consejo mínimo, la terapia de conducta y los productos sustitutivos de la nicotina se pueden incorporar como estrategias de tratamiento adaptadas a las necesidades especiales de las mujeres que fuman.

  10. Las mujeres y el tabaco: características ligadas al género

    Directory of Open Access Journals (Sweden)

    Elisardo Becoña Iglesias

    2000-01-01

    Full Text Available El porcentaje de mujeres fumadoras está todavía aumentando en España. Si persisten los patrones actuales de fumar entre las mujeres, el número de muertes continuari creciendo de modo acusado en el próximo siglo. Es posible que en un futuro cercano fumen más mujeres que hombres entre la población adulta española. En esta revisión se actualiza lo que se conoce sobre el impacto que tiene fumar cigarrillos en la salud de las mujeres, los patrones de consumo actuales entre las mismas, los factores especiales que influyen en que fumen y las dificultades que tienen cuando consideran e intentan dejar de fumar. También sugerimos formas en las cuales el consejo mínimo, la tempia de conducta y los productos sustitutivos de la nicotina se pueden incorporar como estrategias de tratamiento adaptadas a las necesidades especiales de las mujeres que fuman.

  11. Novedades para el género Rosellinia (Ascomycota-Xylariaceae en el noroeste de la República Argentina

    Directory of Open Access Journals (Sweden)

    Esteban B Sir

    2012-12-01

    Full Text Available Se reporta por primera vez a Rosellinia canzacotoana en el Cono Sur de América y a Rosellinia arcuata para la Argentina. Rosellinia necatrix se cita creciendo sobre árboles en descomposición de la flora autóctona de la Argentina. Se realiza una revisión de tres holotipos de Spegazzini: Rosellinia australis, Rosellinia bonaerensis, Rosellinia smilacina, detallando su estado nomenclatural y taxonómico actual. También se presenta una clave dicotómica de las especies con aspecto rosellinoide del Noroeste del país y un mapa de distribución.Novelties for the genus Rosellinia (Ascomycota-Xylariaceae from Northwest of Argentina. Rosellinia canzacotoana is reported for the first time in the southern Cone of America and Rosellinia arcuata is a new record from Argentina. Rosellinia necatrix is reported growing on a native host of the Argentine flora. Three Spegazzini's holotypes: Rosellinia australis, Rosellinia bonaerensis and Rosellinia smilacina were studied and their taxonomic and nomenclatural positions are discussed. A dichotomous key to rosellinoid taxa so far known from Northwest Argentina and distributions maps is presented.

  12. Asociaciones de pacientes alérgicos y asmáticos en Europa Associations of allergic and asthmatic patients in Europe

    Directory of Open Access Journals (Sweden)

    A. Parra

    2003-01-01

    Full Text Available Las asociaciones de pacientes son ONG que surgen como consecuencia de las necesidades de los pacientes con enfermedades crónicas que no pueden ser solucionadas en la consulta del médico. En su inicio, el papel del personal sanitario en la tutela y colaboración con las mismas es fundamental, y sus objetivos e intereses son coincidentes en gran parte. Su buen funcionamiento favorece tanto a los pacientes como, indirectamente, a los profesionales sanitarios relacionados con ellos. No obstante, debemos tener en cuenta que estos intereses no son los mismos y, en ocasiones, pueden ser netamente divergentes, por lo que la independencia de estas asociaciones es algo irrenunciable, y se va gestando conforme la asociación va creciendo de tamaño y, por lo tanto, de influencia social.Patients’ associations are NGOs that emerge as a result of the needs of patients with chronic diseases that cannot be solved in the doctor’s surgery. At the start, the role of the health personnel, in guiding and collaborating with them, was fundamental, and their aims and interests coincided to a high degree. Their healthy operation favored both the patients and, indirectly, the health professionals related to them. However, we must bear in mind that those interests are not identical and, on occasion, can be clearly divergent. This is why the independence of these associations cannot be renounced upon, and they are managed according to the growth in their size and social influence.

  13. Instrumentos de sobre-excitabilidade: uma revisão sistemática

    Directory of Open Access Journals (Sweden)

    Juliana Célia de Oliveira

    2014-01-01

    Full Text Available Los estudios demuestran que la sobre excitabilidad (SE es fuerte predictora de la superdotación. Con el fin de hacer una revisión sistemática de la literatura sobre los instrumentos que miden la SE, artículos que contienen los términos overexcitability o overexcitabilities y assessment , measure o evaluation fueron recuperados en las bases de datos Portal CAPES y Google Académico. La producción científica sobre este tema parece estar creciendo y se compone principalmente de los estudios empíricos realizados con muestras de participantes con superdotación. Sólo se identificaron cinco medidas de SE: Overexcitability Questionnaire , Overexcitability Questionnaire Two , Me Scale, ElemenOE y Adult Questionnaire . La validez de criterio y consistencia interna son las propiedades psicométricas más descritas en la literatura. Fortalezas, limitaciones, y los usos más adecuados de estos instrumentos son enfatizados. Se destaca su uso en la identificación de la superdotación.

  14. EL SISTEMA EUROPEO DE DERECHOS FUNDAMENTALES TRAS LA ENTRADA EN VIGOR DEL TRATADO DE LISBOA

    Directory of Open Access Journals (Sweden)

    Lorenzo Martín-Retortillo Baquer

    2011-07-01

    Full Text Available Resumen: En 1947 se pusieron las bases de lo que llegaría a ser la Unión Europea, a modo de organización comercial para sectores concretos, complejo que iría creciendo, ampliándose los fines y la organización, a la par que se fraguaba un complejo ordenamiento jurídico. Se hizo necesario alcanzar una declaración de derechos que incluyera los modernos derechos sociales. En el trabajo se estudia la compleja historia de la obtención de la declaración, la “Carta de Derechos Fundamentales de la Unión Europea”, que, al fin, entraría en vigor el 1.XII.2009, a la par que el último de los Tratados de la Unión, el Tratado de Lisboa.Abstract: The European Union was founded in 1947 as a concrete trade organization but it started to grown. The aims and the organization had increased and in the meantime a complex law system was set up. It was convenient to get a solid bill of rights including the modern social rights. The paper studies the complicate story of how to obtain the bill of rights –the “Carta of Fundamentals Rights of the European Union”- which formally came into effect the 1.XII.2099 at the same time that the last Treaty of the Union, the Treaty of Lison.

  15. Panamá: paraíso imperfecto Panama: Imperfect Paradise

    Directory of Open Access Journals (Sweden)

    CLARA INÉS LUNA

    2009-01-01

    Full Text Available El 2008 estuvo marcado por la continuación de un proceso electoral interno en los partidos políticos, que se prolongó largamente y que se libró sin cuartel, presagiando el tono de los comicios generales de mayo de 2009. También ha sido un año especial por la inusual inflación que movilizó a importantes sectores para exigir mejoras salariales, más subsidios e, incluso, control de precios. No obstante, el país siguió creciendo a tasas muy por encima del promedio latinoamericano y registró una importante caída en la pobreza y la indigencia. Desde afuera Panamá puede parecer un paraíso, pero su evidente imperfección corre el riesgo de profundizarse.2008 was marked by the continuation of an internal election process within political parties, which lasted long and was fought without quarter, presaging the tone of the general elections of May 2009. It has also been a special year because an unusual inflation that mobilized union members, medical associations, carriers, educators and retirees, demanding better incomes, more benefits and even price controls, to the central government. However, the country continued to grow at rates well above the average for Latin America and recorded a significant decline in poverty and indigence. Panama from the outside may seem like a paradise, but its obvious imperfection risk further.

  16. Recomposición del empleo industrial en Colombia, 1974- 1996

    Directory of Open Access Journals (Sweden)

    Luis Armando Galvis Aponte

    2000-01-01

    Full Text Available El propósito del presente artículo es analizar el comportamiento del empleo manufacturero en las principales áreas metropolitanas colombianas. Se realiza una descomposición del empleo, a partir del modelo shift-share, para describir los factores que durante el período 1974-1996 explican su crecimiento y su concentración. Los resultados indican que en el área metropolitana de Bogotá es donde se concentra el mayor aumento en el empleo, creciendo por encima de la influencia nacional y de ciudades como Medellín, Cali, Barranquilla, Cartagena, Manizales, Pereira y Bucaramanga, que por efectos de competitividad no han tenido gran capacidad de generación de empleo manufacturero. Ello ha originado un notorio dualismo entre la generación de empleo en Bogotá, frente al del resto de áreas metropolitanas, fortaleciéndose la primacía urbana de la capital.

  17. Análisis químico del extracto peciolar para evaluar el estado nutricional en la vid

    Directory of Open Access Journals (Sweden)

    Paulina Pino

    2012-01-01

    Full Text Available El objetivo de este trabajo fue evaluar la relación existente entre la concentración de N, P y K del extracto peciolar, la lámina y la raíz, para determinar el estado nutricional de la vid. El ensayo se desarrolló entre diciembre de 2006 y febrero de 2007. Se validó la metodología de extracto peciolar para Vitis vinifera 'Red Globe', en plantas de un año de edad autoenraizadas, creciendo en macetas, a partir de tres ensayos de fertilización utilizando N, P2O5 y K2O. En el extracto peciolar, se evaluó nitrato, fosfato y potasio, y en láminas y raíces, nitrógeno, fósforo y potasio. El análisis del extracto peciolar fue más sensible que el de la lámina y la raíz para determinar el estatus de nitrato y nitrógeno. Mientras que el análisis de la lámina representa mejor la respuesta de la planta a la fertilización con fósforo y potasio. El extracto peciolar puede detectar antagonismos entre elementos en altas dosis de fertilización.

  18. ¿Necesitan los proveedores de outsourcing una metodología para la provisión de servicios?

    Directory of Open Access Journals (Sweden)

    Javier Sáenz

    2014-03-01

    Full Text Available El mercado de outsourcing ha estado creciendo en los últimos años y se espera que lo siga haciendo, pero este crecimiento se ha visto limitado por el fracaso de muchos proyectos. Estos fracasos se han debido en gran parte a los problemas con los proveedores: la falta de experiencia y capacidad para asumir los proyectos, y una comunicación difícil. Se han propuesto marcos de buenas prácticas para la gestión de proyectos de outsourcing desde el punto de vista del cliente, pero no ha sido así para los proveedores, que basan la prestación de servicios en su experiencia pasada y sus capacidades técnicas. El objetivo de este trabajo es establecer la necesidad de proponer una metodología que guíe a los proveedores a lo largo de todo el ciclo de vida del outsourcing y facilite la provisión de servicios de calidad y bien gestionados

  19. Clínica y salud (1998-2008. Análisis de Diez Años de Publicaciones

    Directory of Open Access Journals (Sweden)

    Francisco Pérez Fernández

    2010-01-01

    Full Text Available Clínica y salud no sólo se ha convertido con el paso de los años en una publicación de referencia en el entorno de la psicología española sino que, a la vista de los datos que hemos podido recabar, y cuyo análisis se ofrece en este trabajo, es también una revista científica saludable y con un prometedor futuro. Ya parecía encontrarse en esta línea ascendente hace una década, momento en el que se realizó el primer estudio bibliométrico de la publicación que recogía la andadura de los siete primeros años de su existencia. En consecuencia, parecía pertinente comprobar ahora si aquellos primeros éxitos fueron un espejismo o el principio de la consolidación. Es precisamente al estudio y verificación de este hecho que dedicamos el presente trabajo de análisis bibliométrico esperando, asimismo, que sea útil para extraer conclusiones que permitan a Clínica y salud, a su equipo editorial y a sus afines, continuar creciendo en el futuro.

  20. INTERACCIÓN MICORRIZAS ARBUSCULARES- Trichoderma harzianum (Moniliaceae Y EFECTOS SOBRE EL CRECIMIENTO DE Brachiaria decumbens (Poaceae

    Directory of Open Access Journals (Sweden)

    TIFFANY SOSA RODRÍGUEZ

    2006-01-01

    Full Text Available Se efectuó un ensayo en condiciones controladas utilizando hongos formadores de micorrizas arbusculares (HFMA nativos, provenientes de un suelo rizosférico de Pennisetum clandestinum de la Universidad Nacional de Colombia (Bogotá, mante- niéndolos en plantas de Brachiaria decumbens creciendo sobre sustrato arenoso suple- mentado con solución nutritiva. Se evaluaron diferentes tratamientos: plantas con inóculo de HFMA, plantas con Trichoderma harzianum, plantas con HFMA+T. harzianum y plantas control no inoculadas, con el fin de determinar las posibles interacciones entre dichos microorganismos, así como su efecto sobre el crecimiento de B. decumbens. La presencia de T. harzianum disminuyó la colonización radicular por HFMA, aunque no afectó la cantidad de esporas de HFMA/g suelo seco, en tanto que la población de T. harzianum (UFC/g suelo seco disminuyó significativamente en presencia de HFMA. Estos resultados mostraron que existen interacciones entre HFMA y T. harzianum que afectan tanto el desarrollo de HFMA como la densidad poblacional de T. harzianum. Los valores obtenidos para los parámetros del crecimiento de la planta evaluados sugie- ren que el efecto de la interacción entre los microorganismos sobre la planta hospe- dera es de tipo neutral.

  1. Tipología socio-ambiental de las ciudades medias de Brasil: aportes para un desarrollo urbano sostenible

    Directory of Open Access Journals (Sweden)

    Fabio Angeoletto

    2016-05-01

    Full Text Available La urbanización global de los territorios, que es un fenómeno ecológico humano importante en curso, y cuyos impactos ambientales poseen niveles local, regional y mundial, presenta la característica notable de un crecimiento pronunciado de las ciudades pequeñas e intermedias, en las cuales la capacidad de planificación y gestión es usualmente ínfima, en comparación a las ciudades grandes. Es lo que se verifica en Brasil, donde las ciudades de tamaño medio, es decir, las que tienen poblaciones entre 100.000 y 500.000 habitantes están creciendo más rápidamente que las grandes ciudades, desde mediados de la década de 1990. El artículo tiene como objetivo trazar una tipología de las ciudades medias brasileñas por medio de análisis estadísticos multivariados. La tipología resultante señala dos tipos de ciudades, con demandas sociales, ambientales y de gestión diferentes. Algunas de estas ciudades se encuentran en hotspots de biodiversidad. En paralelo, hemos recopilado estadísticas sobre la gestión ambiental en marcha en estas ciudades. Nuestros resultados demuestran una baja efectividad de las acciones de gestión ambiental en estos municipios.

  2. Las Empresas Multinacionales (EMN Peruanas: una Exploración Conceptual

    Directory of Open Access Journals (Sweden)

    Oscar Malca Guaylupo

    2009-06-01

    Full Text Available Durante los últimos años (2000-2007, las exportaciones peruanas han tenido un excelente desempeño, de tal manera que el déficit constante de la balanza comercial no sólo se ha revertido, sino que además los saldos positivos vienen creciendo de manera sostenible.Sin embargo, las empresas exportadoras no son las únicas que han crecido, también las multinacionales peruanas lo han hecho. Tal es así, que algunas están actuando en diversos mercados de diferentes regiones del mundo.La EMN difiere de la empresa exportadora no solo por el hecho de actuar en destino, sino que para hacerlo debe diseñar estrategias relacionadas con la inversión directa extranjera (IDE y contar con otros atributos que le permitan competir directamente con las empresas locales en donde actúan.El presente artículo tiene por objetivo relacionar la teoría de la IDE y de las EMN con las EMN peruanas, explorar desde una base teórica el accionar de las EMN peruanas y ver en qué medida se cumplen las previsiones de las teorías disponibles sobre este punto.

  3. Manifestaciones de piritas framboidales en fumarolas de la Isla Decepción (Antártida: Implicancias genéticas Framboidal pyrite in fumaroles on Deception Island (Antarctica: Genetic implications

    Directory of Open Access Journals (Sweden)

    Mariano R. Agusto

    2004-03-01

    Full Text Available Se da a conocer el hallazgo y la posible génesis de piritas framboidales en las bocas de las fumarolas de la isla Decepción, Antártida. Los sulfuros se han depositado en las tefras, alrededor de los fragmentos tamaño lapilli. El proceso de formación de las piritas framboidales comienza con una reacción entre el vidrio de los piroclastos y el sulfuro de hidrógeno, nucleándose y creciendo inicialmente microcristales de monosulfuro de hierro. Luego, los microcristales reaccionan a greigita y se forma un agregado de microcristales de greigita (crecimiento de framboides. Finalmente, la greigita es reemplazada por pirita. En el presente estudio se observó que las piritas se formaban a 100ºC en menos de una hora.Pyrite framboids have been recognized in fumaroles on Deception Island, Antarctica. The sulphide was deposited around reworked pyroclastic tephra (lapilli. The formation process starts as a reaction between glass and hydrogen sulphide, giving rise to nucleation and growth of iron monosulfide microcrystals. The microcrystals then convert to greigite, and form aggregates of uniformly sized microcrystals (development of framboids. Finally, greigite is replaced by pyrite. In this study pyrite was observed forming at 100ºCin less than one hour.

  4. Juego exploratorio e inferencia temprana: un estudio descriptivo de las habilidades exploratorias y su relación con la edad

    Directory of Open Access Journals (Sweden)

    Mayra Alejandra Prieto

    2007-07-01

    Full Text Available La generalización del conocimiento sobre propiedades no obvias de los objetos a menudo involucra inferencia inductiva. Por ejemplo, al descubrir que un objeto particular puede producir un sonido, podríamos inferir que otros objetos de apariencia similar también lo hacen. En esta investigación, el juego exploratorio sirvió como una ventana a la capacidad inductiva temprana. A partir de los estudios realizados por Baldwin y cols. (1993, seis bebés entre los 8 y los 16 meses exploraron pares de juguetes novedosos en tres condiciones de prueba: condición de expectativa satisfecha, de expectativa violada y de control de interés. Aunque en algunas ocasiones los infantes no lograron reproducir adecuadamente la propiedad no obvia de los juguetes, mostraron un interesante despliegue de comportamientos cuando exploraban los objetos. De igual forma, los resultados señalaron que el juego exploratorio es un elemento más evidente en los bebés de menor edad, pues a medida que los infantes van creciendo despliegan un menor número de comportamientos exploratorios probablemente como consecuencia de una mayor capacidad de inferencia.

  5. exploratorias y su relación con la edad

    Directory of Open Access Journals (Sweden)

    Iván Ricardo Perdomo

    2007-01-01

    Full Text Available La generalización del conocimiento sobre propiedades no obvias de los objetos a menudo involucra inferencia inductiva. Por ejemplo, al descubrir que un objeto particular puede producir un sonido, podríamos inferir que otros objetos de apariencia similar también lo hacen. En esta investigación, el juego exploratorio sirvió como una ventana a la capacidad inductiva temprana. A partir de los estudios realizados por Baldwin y cols. (1993, seis bebés entre los8 y los 16 meses exploraron pares de juguetes novedosos en tres condiciones de prueba: condición de expectativa satisfecha, de expectativa violada y de control de interés. Aunque en algunas ocasiones los infantes no lograron reproducir adecuadamente la propiedad no obvia de los juguetes, mostraron un interesante despliegue de comportamientos cuando exploraban los objetos. De igual forma, los resultados señalaron que el juego exploratorio es un elemento más evidente en los bebés de menor edad, pues a medida que los infantes van creciendo despliegan un menor número de comportamientos exploratorios probablemente como consecuencia de una mayor capacidad de inferencia.

  6. Determinantes de la integración colombo-venezolana y perspectivas ante la dimisión de Venezuela a la CAN

    Directory of Open Access Journals (Sweden)

    Luis Nelson Beltrán Mora

    2008-01-01

    Full Text Available Este ensayo hace un balance del comercio colombovenezolano en el período 1990 - 2006, señalando que la integración aumentó los flujos de manufacturas, inversiones y puestos de trabajo para los dos países; la agenda económica se impuso a las agitadas relaciones políticas. Los logros de la integración económica están en peligro por la dimisión de Venezuela a la Comunidad Andina de Naciones – CAN en abril de 2006. A pesar de los síntomas de de intermediación privados, el comercio continúa creciendo como consecuencia de la coyuntura económica favorable para ambas naciones. La dimisión de Venezuela sólo traerá problemas en el corto plazo al comercio colombo-venezolano en la medida que el vecino país no respete el artículo 135 del Acuerdo de Cartagena; en el largo plazo el intercambio podría ser más promisorio si los dos Estados restablecen o generan nuevos acuerdos comerciales en el marco andino o bilateral.

  7. [The influence of physical exercise in the prevention of cognitive deterioration in the elderly: a systematic review].

    Science.gov (United States)

    Franco-Martín, Manuel; Parra-Vidales, Esther; González-Palau, Fátima; Bernate-Navarro, Mara; Solis, Abdel

    2013-06-01

    Introduccion. La poblacion espanola mayor de 65 anos continua creciendo, por lo que la atencion a adultos mayores se convierte en un objetivo de salud publica cada vez mas relevante. La actividad fisica esta siendo reconocida como un factor altamente protector de las funciones cognitivas en el envejecimiento, y se establece, en la actualidad, como una estrategia psicosocial prometedora para la proteccion de las facultades cognitivas. Pacientes y metodos. Mediante una busqueda bibliografica en las bases de datos PubMed, PsycINFO, Psicodoc, Scopus y SciELO, se revisaron sistematicamente los estudios relativos a la influencia del ejercicio fisico en la prevencion del deterioro cognitivo en adultos mayores sanos y en la reversion o en el mantenimiento del declive cognitivo una vez ya iniciado. Se seleccionaron y utilizaron 31 articulos como unidades de analisis. Resultados. En conjunto, estos estudios indicaron que un mayor indice de actividad fisica se relacionaria con un menor deterioro de las funciones cognitivas en adultos mayores sanos y con deterioro cognitivo ya manifiesto. Conclusiones. El ejercicio fisico constituye una estrategia psicosocial prometedora para la intervencion de adultos mayores con y sin signos de deterioro cognitivo. Serian convenientes mayores estudios que empleen una metodologia experimental, mayor homogeneidad en cuanto a los instrumentos de recogida de datos de funciones cognitivas y una profundizacion en la frecuencia e intensidad necesaria en las intervenciones.

  8. COMERCIALIZAÇÃO DE MATERIAIS RECICLÁVEIS EM AQUIDAUANA-MS

    Directory of Open Access Journals (Sweden)

    Maria do Socorro Ferreira da Silva

    2010-01-01

    Full Text Available La crisis social en el país significa que miles de personas están en la comercialización de materiales reciclables, un medio de supervivencia. El mercado de los materiales reciclables está creciendo rápidamente en Brasil. Este artículo pretende analizar la estructura del comercio de materiales reciclables en Aquidauana-MS. El ciclo de comercialización de esa ciudad se compone de colectores asociados con la Asociación de los separadores de reciclables, por cuenta propia, la recolección de materiales reciclables en el hogar y en el centro de la ciudad, los mineros recolectores, que recogen materiales sobre la descarga, por los comerciantes de chatarra locales y otras ciudades Mato Grosso do Sul El mercado de productos reciclables es dinámico y se está expandiendo rápidamente, principalmente debido a el número de colectores, el número de vendedores de chatarra y la producción de reciclables que aún no se comercializan.

  9. From the Editors: The evolution of the intellectual capital and new tendencies La evolución del capital intelectual y las nuevas corrientes

    Directory of Open Access Journals (Sweden)

    Pep Simo

    2007-07-01

    Full Text Available The volume of non tangible investments undertaken by firms has grown extraordinarily in the second half of the twentieth century, and it keeps growing in the present century. For that reason, issues related with the economic nature of intangibles, its identification and measurement are among the main interests of managers, investors, financial analysts and the rest of constituencies with interests in organizations. In this editorial, we review the evolution of the research about intellectual capital, defined as the set of intangibles of the firm, from its beginnings at the start of the nineties, to the most recent contributions, where it is defined as the difference between intangible assets and intangible liabilities.El volumen de inversiones no tangibles realizadas por las empresas en todo el mundo ha crecido extraordinariamente en la segunda mitad del siglo pasado y continúa creciendo en este siglo, por lo que conocer la naturaleza económica de los intangibles, identificarlos y medirlos se ha convertido en un foco de interés para gerentes, inversores, analistas financieros y, en general, para quienes tienen intereses comprometidos en la marcha de las empresas. En la presente editorial se analiza la evolución que ha tenido el estudio del capital intelectual definido como el conjunto de intangibles de la empresa, desde sus inicios a principios de la pasada década de los noventa, hasta las nuevas tendencias donde aparece como diferencia entre activos intangibles y pasivos intangibles.

  10. Redes sociales, políticas públicas y capital social

    Directory of Open Access Journals (Sweden)

    Lluís Ballester

    2014-04-01

    Full Text Available La comunidad, o en un espacio más amplio la propia sociedad, en cualquiera de sus dimensiones, no es un espacio cerrado sin conexiones e interconexiones; más bien puede concebirse como una red de relaciones. En este sentido, desde las Ciencias Sociales ha ido creciendo el interés por el estudio de las redes sociales; esto ha permitido comprender mejor como se construyen y mantienen las relaciones sociales entre la población. Junto al concepto de redes sociales aparece también el de capital social; un recurso creado por los propios individuos que representa un poder a la hora de ocupar espacios sociales, acceder a recursos, cubrir necesidades, resolver problemas sociales, etc. La existencia de redes sociales fuertes favorece los vínculos democráticos, el nexo entre los diversos agentes e instituciones del territorio, la coordinación de las acciones colectivas y, consecuentemente, la construcción de capital social.

  11. Insuficiencia cardíaca y diabetes

    Directory of Open Access Journals (Sweden)

    Jorge Thierer

    2006-01-01

    Full Text Available La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la enzima convertidora ejercen una influencia favorable, en tanto que el uso de glitazonas todavía es controversial. La insuficiencia cardíaca puede a su vez generar diabetes, debido a la activación del sistema nervioso simpático y al efecto del tratamiento. La comprensión adecuada de estos hechos es fundamental para tomar decisiones correctas y mejorar la suerte de los pacientes.

  12. APLICACIONES DE LA CITOMETRÍA DE FLUJO EN MICROBIOLOGÍA, VETERINARIA Y AGRICULTURA

    Directory of Open Access Journals (Sweden)

    José Laguado

    2007-12-01

    Full Text Available La citometría de flujo es un método automatizado, multiparamétrico y cuantitativo que analiza las señales dispersadas y fluorescentes producidas por una célula al pasar por un haz de luz. El potencial de los nuevos métodos de análisis en el laboratorio en el campo de la microbiología viene creciendo de manera enorme en los últimos años donde la citometría de flujo se ha consolidando como una herramienta rápida, sencilla, suficientemente sensible, económica, de fácil automatización para las crecientes necesidades de desarrollo de Colombia. La citometría permite obtener información sobre la fisiología, morfología, genética y diversidad de microorganismos, animales y plantas. Las variadas aplicaciones de la citometría en la microbiología de alimentos, la microbiología ambiental, la medicina veterinaria y la agricultura busca ahora complementar o reemplazar técnicas ya existentes adaptándonos a la continua evolución de las necesidades de los mercados globales de la ciencia y la economía.

  13. El escenario actual de la alimentación en México = The actual scene of the feeding in Mexico

    Directory of Open Access Journals (Sweden)

    Soria Sánchez, Graciela

    2014-01-01

    Full Text Available La soberanía alimentaria y la seguridad alimentaria en México son afectadas por múltiples factores, principalmente el mercado mundial. La población está creciendo y las tierras de cultivo están siendo utilizadas cada vez más para producir biocombustible, e n lugar de producir alimentos para consumo humano. Por otro lado, los acuerdos de libre comercio no han mejorado las condiciones de vida de los campesinos. Por el contrario, se ha generado mayor desigualdad económica y exclusión de la participación en el m ercado. Además, los programas de política pública diseñados para contrarrestar los problemas de abastecimiento de alimentos causados por el mercado, no han incluido estrategias de participación social. El presente trabajo analiza la situación actual de la alimentación en México y su precaria situación asociada principalmente al actual sistema económico neoliberal en donde la alimentación hoy en día representa únicamente un gran negocio

  14. ESTUDIOS EMBRIOLOGICOS Y CITOLOGICOS EN LA YERBA MATE ILEX PARAGUARIENSIS (AQUIFOLIACEAE

    Directory of Open Access Journals (Sweden)

    Cesar Otto Niklas

    2010-11-01

    Full Text Available

    La cuenta cmomosome de flex paraguariensis Saint Hil. confirmó el número 211 = 40 para todo el material estudiado. En el análisis de la meiosis se comprobó que tiene un comportamiento normal, presentando 20 II. En el polen analizado cerca de 100% de la fertilidad, se encontró. Se estableció que el saco embrionario es del tipo Polygonum. Cuando la fruta está madura, los embriones se encuentran en diferentes etapas: globulares 2,6%, 70,24% del corazón, el corazón puesto 23,3%; torpedo 2,62% y 0,96% maduros. Estos embriones seguir creciendo cuando la semilla está en condiciones para germinar, esta es la razón del lento desarrollo observado en la germinación.

  15. 天津地区荷斯坦公牛CVM、DUMPS和CN遗传缺陷检测%Identiifcation of CVM, DUMPS and CN Carriers in Chinese Holstein Bulls in Tianjin Area

    Institute of Scientific and Technical Information of China (English)

    梁若冰; 谢岩; 范学华; 张毅; 孙东晓; 张胜利; 马毅; 吴周良

    2014-01-01

    本文旨在研究天津地区中国荷斯坦公牛脊椎畸形综合征(Complexvertebralmalformation,CVM)、尿苷酸合酶缺乏症(Deficiencyofuridinemonophosphatesynthase,DUMPS)和瓜氨酸血症(Citrullinemia,CN)3种遗传缺陷的携带者比率及系谱来源。通过PIRA-PCR和PCR-RFLP方法分别对天津奶牛发展中心参加全国青年公牛联合后裔测定和国家良种补贴项目的110头荷斯坦公牛进行了CVM、DUMPS和CN三种遗传缺陷检测。共发现6头CVM隐性有害基因携带公牛,携带者比例为5.45%,隐性有害等位基因频率为2.72%。经过系谱分析,其中4头CVM携带者均为美国公牛Carlin-MIvanhoeBell的后代,另外2头因系谱不完整而无法查询。未检测到DUMPS和CN隐性有害基因携带者。基于此,我国有必要尽快建立荷斯坦牛隐性遗传缺陷监控体系并进行系谱标注,避免携带公牛进入后裔测定和良种补贴项目,以逐步降低我国奶牛群体中遗传缺陷隐性等位基因频率。%This study is aimed to detect carriers of Complex vertebral malformation (CVM), deficiency of uridine monophosphate synthase (DUMPS) and Citrullinemia (CN) in Chinese Holstein bulls in Tianjin area. Polymerase chain reaction-primer introduced restriction analysis (PIRA-PCR) and restriction fragment length polymorphism (PCR-RFLP) methods were used to detect the alleles of CVM, DUMPS and CN among 110 Holstein bullsparticipating in the national progeny test bulls program. As a result, a total of 6 CVM carriers were identiifed. The recessive allele frequency of CVM is 5.45%. After pedigree analysis, out of 6 CVM carriers, 4 bulls are found to the offspring of American Holstein bull“Carlin-M Ivanhoe Bell”, and 2 bulls’ pedigrees are incomplete. DUMPS and CN carrier didn’t be identiifed. Based on this, in our country, it is necessary to establish as soon as possible Holstein recessive genetic defect monitoring system and conduct genealogy

  16. Desempenho de cultivares de cebola em cultivo orgânico e tipos de solo no Vale do São Francisco Evaluation of onion cultivars under organic cultivation in two soil types in the São Francisco Valley, Brazil

    Directory of Open Access Journals (Sweden)

    Nivaldo D Costa

    2008-12-01

    Full Text Available Com o objetivo de avaliar a produtividade de cultivares de cebola em cultivo orgânico no Vale do São Francisco, conduziram-se dois experimentos, de maio a outubro de 2005, nos Campos Experimentais de Bebedouro, Petrolina-PE, e Mandacaru, Juazeiro-BA, em ARGISSOLO e VERTISSOLO respectivamente. O delineamento experimental utilizado foi em blocos ao acaso, utilizando-se dezoito e quatorze cultivares de cebola, respectivamente e quatro repetições. Em ARGISSOLO a produtividade total de bulbos variou de 13,52 a 39,52 t/ha. A produtividade comercial oscilou de 7,45 a 38,32 t/ha, sobressaindo-se como mais produtivas as cultivares Brisa IPA-12 (38,32 t/ha e São Paulo (35,86 t/ha que não evidenciaram diferenças significativas entre si, assim como as cultivares Botucatu-150 (26,41 t/ha e Pira Ouro (26,37 t/ha, e menos produtivas as cultivares Conquista (7,45 t/ha e Crioula Alto Vale (7,81 t/ha. Em VERTISSOLO a produtividade total de bulbos variou de 6,87 a 24,68 t/ha. Sobressairam-se com produtividade comercial as cultivares Texas Grano PRR (21,56 t/ha e IPA-10 (17,50 t/ha, que não diferiram entre si. As cultivares Crioula Alto Vale, CNPH-6348, CNPH- 6436 e CNPH-6206 não tiveram produção comercial de bulbos.In this research were evaluated the yield of onion cultivars under organic growth in the São Francisco Valley. Two field trials were evaluated, one at the Experimental Farm Station of Embrapa Tropical Semi-Arid, in Petrolina, in an ultisol type and the other at the Experimental Farm Station of Mandacaru, in Juazeiro, in a vertisol type, from February to October of 2005. The experimental design was of randomized complete blocks, with 18 and 14 cultivars, respectively, and four replications. In the ultisol, the total yield of bulbs ranged from 13.52 to 39.52 t/ha. The commercial yield ranged from 7.45 to 38.32 t/ha where the cultivars Brisa (38.32 t/ha and São Paulo (35.86 t/ha showed the highest yield without statistical difference

  17. Suscetibilidade à queda natural e caracterização dos frutos de diversos genótipos de bananeiras Different banana genotypes in relation to their susceptibility to finger drop and fruit characterization

    Directory of Open Access Journals (Sweden)

    Marlon Cristian Toledo Pereira

    2004-12-01

    Full Text Available A queda natural de frutos maduros da bananeira, resultado da separação individual de frutos da coroa da penca, também chamada despencamento, é uma característica indesejável, que pode limitar o lançamento de uma nova cultivar. O fruto destacado da penca tem vida de prateleira reduzida, além de não demonstrar boa aparência aos olhos do consumidor. Os objetivos do presente trabalho foram quantificar a suscetibilidade à queda natural dos frutos de bananeiras de grupos genômicos e ploidias diferentes, e identificar correlações entre a queda natural e diversas características físicas dos frutos. Foram utilizados 37 genótipos de bananeiras. De acordo com análise de variância e teste de Scott-Knott, os resultados evidenciaram a alta resistência ao despencamento dos genótipos pertencentes ao grupo genômico BB (Butuhan, Piraí e BB França, Terra (AAB, Poteau Nain (tipo figo (ABB e Thap Maeo (AAB, enquanto Prata-Anã (AAB, Grande Naine (AAA, Ambrósia (AAAA, Ouro (AA e FHIA 18 (AAAB obtiveram valores intermediários de resistência ao despencamento. Com relação às bananeiras suscetíveis, destacam-se os híbridos melhorados Pioneira (AAAB, YB42-21 (AAAB, Buccaneer (AAAA e Calypso (AAAA e a cultivar Ouro da Mata (AAAB. Verificou-se associação de 74% entre a firmeza do fruto e a resistência ao despencamento. Os estudos de grupos genômicos e ploidias indicaram maior resistência ao despencamento das bananeiras pertencentes ao grupo BB e dos genótipos triplóides ABB e AAB.Natural fruit dropping of ripe bananas in result of individual separation of fruits from the hand crown, is called finger drop, this characteristic is undesirable and would limit the marketing of new cultivars. Fruits that stand out in the hand have a reduced shelf life, and do not present a pleasant appearance for customers. This study was carried out in order to quantify the susceptibility to natural fruit dropping in fruits from different genomic groups and

  18. Variabilidade genética e sensibilidade de acessos de Pistia stratiotes ao herbicida glyphosate Genetic variability and sensitivity of Pistia stratiotes accesses to glyphosate

    Directory of Open Access Journals (Sweden)

    E.A.S. Cícero

    2007-09-01

    Full Text Available A alface-d'água (Pistia stratiotes é uma das principais entre as macrófitas aquáticas que causam problemas em corpos hídricos no Brasil e são consideradas como plantas daninhas. O presente trabalho foi realizado com os objetivos de conhecer melhor a variabilidade genética dessa macrófita e relacionar essa variabilidade com a resposta à aplicação do herbicida glyphosate. Para isso, foram coletados indivíduos em 12 corpos hídricos em diferentes cidades do território nacional (Americana, Cambaratiba, Curitiba, Itapura, Jaboticabal, Lagoa Santa, Piraí, Rio Grande, Rubinéia, Salto Grande, Santa Gertrudes e Três Lagoas. Os acessos foram caracterizados pelo uso de marcadores RAPD (DNA Polimórfico Amplificado ao Acaso, que permitiram, com o auxílio de iniciadores aleatórios, a caracterização dos locos polimórficos identificados por uma matriz de ausência e presença de bandas. Utilizando essa matriz, a análise de agrupamento permitiu nítida classificação dos acessos em três grupos com diferenças genéticas entre eles. Um ensaio de controle químico, com plantas mantidas em vasos plásticos (5 L e pulverizadas com o herbicida glyphosate nas concentrações de 0,0, 0,6, 1,2, 1,8 e 2,4 kg ha-1, identificou, utilizando avaliações aos 7, 14 e 21 dias após aplicação, que as duas maiores doses promoveram melhor efeito herbicida. Foi verificado também que os acessos de Curitiba e Cambaratiba apresentaram menor suscetibilidade ao herbicida glyphosate. Não houve correspondência entre a estrutura de grupos dos acessos pela análise multivariada de agrupamento com a técnica RAPD e a suscetibilidade da alface-d'água ao glyphosate.Water lettuce (Pistia stratiotes is one the most important macrophytes, classified as weed and causing serious problems in watercourses in Brazil. The aim of this research was to evaluate the genetic variability of water lettuce and its relationship with this plant's susceptibility to glyphosate

  19. Ocorrência de Commelina villosa como planta daninha em áreas agrícolas no estado do Paraná-PR, Brasil Occurence of Commelina villosa as weed in Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Dalva C. Rocha

    2000-01-01

    Full Text Available As trapoerabas pertencem à família Commelinaceae e são plantas daninhas de difícil controle em diferentes regiões do país. No Brasil, a espécie Commelina benghalensis destaca-se como a principal trapoeraba infestante nas culturas de soja, milho, café e citros. Outras duas espécies desse gênero, Commelina diffusa e Commelina erecta, também são conhecidas como infestantes de ocorrência freqüente no território nacional. Commelina villosa está registrada, até o momento, apenas para os Estados da Bahia e Goiás além do Distrito Federal. O presente trabalho teve como objetivos caracterizar e registrar a ocorrência de C. villosa no Estado do Paraná, onde pode estar sendo confundida com outras trapoerabas, principalmente C. benghalensis. Exemplares de C. villosa e C. benghalensis foram coletados, de forma aleatória, em lavouras de soja, feijão e milho, nos municípios de Ponta Grossa, Tibagi, Piraí do Sul, Guarapuava, Pato Branco, Francisco Beltrão, Cascavel, Campo Mourão e Londrina. Parte desse material foi herborizado para a confecção de exsicatas e outra parte foi mantida in vivo, cultivada no Departamento de Botânica, do Instituto de Biociências de Botucatu-UNESP. Caracteres morfológicos descritivos e quantitativos foram avaliados e as espécies comparadas entre si. C. villosa distinguiu-se de C. benghalensis por apresentar folhas maiores (9,76 x 3,26 cm, elíptica a elípticaestreita, sésseis, de coloração verde escura com manchas violáceas na face inferior, filetes translúcidos, entre outras características. A ocorrência de C. villosa no Paraná foi constatada em todos os municípios amostrados, com exceção de Campo Mourão e Londrina.Commelinaceae are weeds with unsatisfactory control in different parts of the country. Commelina benghalensis is the main Commelinaceae weed in soybean, corn, coffee and orange crops in Brazil. Commelina diffusa and Commelina erecta are also known as common weeds in national

  20. The relationship between single nucleotide polymorphisms of 1154G/A in VEGF gene and the onset risk of lung cancer of Han people population in north China%VEGF基因-1154G/A单核苷酸多态性与中国北方汉族人群肺癌发病风险的关系

    Institute of Scientific and Technical Information of China (English)

    高峰; 周雪涛; 张泽峰; 郭阳

    2011-01-01

    目的 探讨VEGF基因启动子区-1154G/A单核苷酸多态性与中国北方汉族人群肺癌发病风险的关系.方法 采用基于医院的病例-对照研究方法,采集200例肺癌患者和204例健康对照个体的静脉抗凝血,同时记录其病史和个人相关资料.以蛋白酶K消化-饱和氯化钠盐析法提取外周血白细胞DNA,采用聚合酶链反应-限制性片段长度多态性(PCR-RFLP)方法和引物介导的限制性聚合酶链反应(PIRA-PCR)方法检测VEGF-1154 G/A多态性位点的基因型.结果 VEGF-1154 G/A基因型和等位基因频率分布在肺癌组与健康对照组之间差异均无统计学意义(P>0.05).与G/G基因型相比,携带A等位基因的基因型(G/A+ A/A),可降低不吸烟个体肺癌的发病风险.未发现VEGF-1154 G/A多态性与肺鳞状细胞癌、肺腺癌及小细胞肺癌的发病风险相关.结论 VEGF-1154 G/A单核苷酸多态性可能与不吸烟个体肺癌发病风险相关.即携带A等位基因的基因型( G/A+ A/A),可降低不吸烟个体肺癌的发病风险.%Objective To investigate the correlation between single nucleotide polymorphisms (SNP) of-1154G/A in VEGF gene and the onset risk of lung cancer of Han people population in north China. Methods The case-control study based on hospital was used,and the venous anticoagulated blood specimens of 200 patients with lung cancer and 204 healthy subjects were collected, meanwhile, the patients' medical history and the data about the healthy subjects were recorded. The genomic DNA was extracted by using proteinase K digestion followed by a salting out procedure. Polymorphisms of VEGF gene were analyzed by PCR-restriction fragment length polymorphism analysis ( PCR-RFLP) and primer-introduced restriction analysis PCR (PIRA-PCR). Results There was no significant difference in the genotype of 1154G/A in VEGF and allele gene frequency distribution between lung cancer group and control group ( P >0.05). As compared with G/G genotype

  1. Characterization of native and oxidized starches of two varieties of Peruvian carrot (Arracacia xanthorrhiza, B. from two production areas of Paraná state, Brazil

    Directory of Open Access Journals (Sweden)

    Luciana Shizue Matsuguma

    2009-06-01

    Full Text Available Two commercial varieties of Peruvian carrot ('Amarela de Carandaí' and 'Senador Amaral' were processed into flour, starch and bagasse and chemically evaluated. The starch was extracted, modified with H2O2 and characterized by the physicochemical methods. By using the methylene blue dyeing, the granules of the modified starches showed intense blue color. The carboxyl content, the reducing power and the amount of the water liberated from the pastes after the freeze-thawing were higher for the oxidized starches and their pastes were clearer than those of the native starches of the two varieties from the two production areas. The RVA viscoamylography showed that the modified starches had lower viscosities with differences between the varieties. In the thermal analysis, the temperatures of the pyrolysis were higher for the native (310.37, 299.08, 311.18 ºC than for the modified starches (294.16, 296.65 e 293.29 ºC for both the varieties. This difference could be related with the larger surface of the granules due to the partial degradation promoted by the chemical modification. In almost all results, the differences were evident between the varieties but not for the cultivation places.No presente trabalho duas variedades comerciais de mandioquinha-salsa ('Amarela de Carandaí' e 'Senador Amaral' obtidas dos municípios de Castro e de Piraí do Sul (Paraná foram processadas para a obtenção de farinha, farelo e amido e essas três frações foram caracterizadas quimicamente. O amido foi extraído, modificado com H2O2 e caracterizado por meio de análises físico-químicas. Na coloração com azul de metileno os grânulos dos amidos oxidados apresentaram coloração azul mais intensa. O teor de carboxilas, o poder redutor e a quantidade de água liberada das pastas foram maiores para as amostras de amidos modificados. As pastas dos amidos modificados foram mais claras que as dos nativos. Na análise viscoamilográfica (RVA os amidos modificados

  2. A influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros: o caso dos Direitos Humanos na cidade Volta Redonda * La influencia de la Acción Catolica...

    Directory of Open Access Journals (Sweden)

    LUIZ FERNANDO MANGEA DA SILVA

    2014-09-01

    Full Text Available Resumo: O presente artigo faz uma análise da influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros de Novaes na Diocese de Barra do Piraí/Volta Redonda, tendo como base o contexto sociopolítico nacional e local do início da década de 1950 até 1968. Essa atuação se inicia a partir do episódio referente à violação dos direitos humanos, em que operários da Companhia Siderúrgica Nacional e intelectuais volta-redondenses foram presos após uma comemoração pelos 20 anos da Declaração Universal dos Direitos do Homem. No evento, também foram comemorados os dois anos da chegada e posse do bispo à diocese. Houve, por parte da organização do evento, a iniciativa de incluir dramatizações que simbolizavam o universo dos trabalhadores. Não podemos esquecer que Volta Redonda era uma cidade militarizada, por causa da instalação do 1º Batalhão de Infantaria Blindada em Barra Mansa, cidade vizinha. O serviço de espionagem do regime militar identificou as lideranças operárias e intelectuais, o que resultou nas prisões dos organizadores do evento. Foi nesse episódio que o bispo se declarou preso no batalhão, em protesto contra a detenção dessas lideranças.Palavras-chave: Waldyr Calheiros de Novaes – Ação Católica – Ditadura Militar e Direitos Humanos. Resumen: Este artículo analiza la influencia de la Acción Católica en el trabajo social y pastoral D. Waldyr Calheiros de Novaes en la Diócesis de Barra do Piraí/Volta Redonda, en función del contexto socio-político nacional y local de la década de 1950 hasta 1968 . Dicha acción se inicia desde el episodio relativo a la violación de los derechos humanos, en el que los trabajadores nacionales Steel Company y los intelectuales era redondenses fueron arrestados después de una celebración para el 20 aniversario de la Declaración universal de los derechos humanos. En el evento, también se celebraron dos años de la llegada e

  3. Controle pós-emergente de plantas daninhas em cenoura Post-emergence weed control in carrot crop

    Directory of Open Access Journals (Sweden)

    Jeferson Zagonel

    1999-03-01

    Full Text Available O experimento foi conduzido em Piraí do Sul-PR no ano de 1995 em solo de textura argilo arenosa, tendo como objetivo avaliar a eficiência e a seletividade do herbicida propaquizafop no controle pós-emergente de plantas daninhas na cultura da cenoura. O delineamento experimental utilizado foi de blocos ao acaso com seis tratamentos e quatro repetições, quais sejam: propaquizafop (100, 125 e 150 g i.a./ha; fluazifop-p-butil (188 g i.a./ha; testemunha capinada e testemunha sem capina. A cultivar de cenoura utilizada foi Nantes Tim Tom semeada em 15 de junho, com espaçamento de 0,25 x 0,05 m, em parcelas com área útil de 5,00 x 1,00 m. As plantas daninhas predominantes foram Brachiaria plantaginea (capim-papuã, Digitaria horizontalis (capim-milhã e Eleusine indica (capim pé-de-galinha. As avaliações foram efetuadas aos 15, 30 e 45 dias após a aplicação dos tratamentos. Observou-se que o herbicida propaquizafop, nas doses de 100, 125 e 150 g i.a./ha foi eficiente no controle sobre capim-papuã, capim-milhã e capim pé-de-galinha. O controle de plantas daninhas realizado através de herbicidas proporcionou a mesma produção obtida com o controle manual. A perda na produção ocasionada pela presença de plantas daninhas foi da ordem de 76,4%. Não foram observados efeitos fitotóxicos nas plantas de cenoura que pudessem ser atribuídos aos produtos utilizados.The presented field trial was conducted in 1995 in Piraí do Sul, Paraná State, Brazil, on a sand-clay texture soil, to evaluate the efficiency and selectivity of propaquizafop on carrot crop weed control. The experiment was laid out in a randomized block design with six treatments and four replications, and 5.00 x 1.00 m plots. The treatmens were: propaquizafop (100, 125 and 150 g a.i/ha; fluazifop-p-butil (188 g a.i/ha; control with weeding and control without weeding. The carrot cultivar Nantes Tim Tom was sown on June 15 with plants spaced 0.25 x 0.05 m. The prevalent weeds

  4. Utilização de análise multivariada e redes neurais artificiais na determinação do comportamento de colonização de populações de macrófitas aquáticas no reservatório de Santana Using multivariate statistics and artificial neural networks to determe the colonization behavior of aquatic macrophyte populations in Santana reservoir

    Directory of Open Access Journals (Sweden)

    R.L.C.M. Pitelli

    2009-01-01

    Full Text Available As análises de agrupamento e de componentes principais e as redes neurais artificiais foram utilizadas na determinação de padrões de comportamento das populações de macrófitas aquáticas que colonizaram o reservatório de Santana, Piraí-RJ, durante o ano de 2004. As análises de agrupamento dividiram o comportamento das populações durante o ano em dois grupos distintos, apresentando um padrão no primeiro semestre que difere daquele observado no segundo semestre do ano. A análise de componentes principais demonstrou que esse comportamento da comunidade (grupo de populações é influenciado principalmente pelas espécies S. montevidensis, Heteranthera reniformis, Ludwigia sp., Rhynchospora aurea, C. iria, C. ferax e Aeschynomene denticulata no primeiro grupo e por Echinochloa polystachya, Polygonum lapathifolium, Alternanthera phyloxeroides, Pistia stratiotes, Eichhornia azurea, Brachiaria arrecta e Oxyscarium cubense no segundo grupo. As redes neurais artificiais agruparam as populações de macrófitas aquáticas em nove grupos, conforme sua densidade nos diferentes meses do ano. A aplicação da análise de componentes principais (ACP nos valores de frequência das populações presentes nos primeiros três grupos de Kohonen permitiu discriminar três grupos de meses, cujas populações apresentaram características diferentes de colonização. A aplicação das redes neurais artificiais permitiu melhor discriminação dos meses e das espécies que compõem as comunidades correspondentes, quando utilizada a análise de componentes principais.Cluster analysis, principal components analysis and Kohonen artificial neural networks were tested to determine the behavior patterns of aquatic macrophyte colonization on Santana reservoir, Piraí-RJ, 2004. The colonization behavior of the populations was divided into two groups, representing the two year semesters. The principal components analysis showed that the behavior of the first group

  5. Accuracy of a self-collection kit for the microbiological study of the vaginal content

    Directory of Open Access Journals (Sweden)

    Mauro Romero L. Passos

    2007-04-01

    Full Text Available Diagnosis of vaginal discharge is frequently performed in an empirical way, leading to inadequate treatment. This study tested the accuracy of a self-collection kit for microbiological study of the vaginal content. One hundred and forty-two women of Family Health Program units in Niterói and Piraí cities were enrolled in order to have their vaginal content studied. A brief explanation and a self-collection kit were provided in order to sample the vaginal content. The self-collection kit was composed of one empty plastic tube, two glass slides, a long handle cytobrush, an identification card and guideline notes. The vaginal sample was applied on the glass slides by the women and stained by Gram technique. A second sampling was done by the medical personnel. The microbiological diagnosis in a blinded analysis was made under optical microscopy. A validation diagnosis test was done taking the medical collection results as a gold standard. A total of 106 women had followed the protocol and were included in the study. Microbiological analysis was unsatisfactory in 12 cases (6 cases of self-collection material and 6 cases of medical collection. The microbiological analyses in the self-collection and in the medical collection material were respectively: bacterial vaginosis in 21.7% and 17.9%, non bacillar flora in 10.3% and 11.3%, vaginal trichomoniasis in 5.66% and 5.6%, candidiasis in 3.78% and 2.8% and a normal microbiota in 52.8% and 56.6%. The Kappa coefficient suggested a "very good correlation" of the microbiological results between the two methods of collection (K=0.7945. The self-collection kit provides samples for microbiological analysis of the vaginal microbiota as good as medical collection.

  6. VICHADA: LA HOSPITALIDAD DEL ORINOCO. Pag. 150-157

    Directory of Open Access Journals (Sweden)

    Wilmer Velandia

    2013-03-01

    Full Text Available Donde el cielo y la sabana se unen en el infinito, se vislumbra una sola montaña en la lejanía, parece un gigante, antiguo y oscuro al final de la inmensidad un “Tepuye”, después de unas cuantas horas de camino se acerca este gran anciano que data del precámbrico, pero no está solo. Se observan algunos compañeros iguales a él, se podrían considerar como los guardianes del imponente y hermoso Orinoko, considerado en lengua Sikuani como la gran serpiente enroscada acompañada de una gran riqueza paisajística cultural y biodiversa; bosques de galería, diferentes tipos de sabana, esteros, lagunas, morichales, bosques inundables, las que recorren aguas blancas, negras y mixtas, rodeadas por diferentes etnias y grupos indígenas como Piaroas, Sikuanis – Guahibos, Cuibas y Amoruas, que viven en forma pacífica con llaneros y colonos, orgullosos de estas tierras, amables y hospitalarios que desde hace muchos años comparten este paraíso con: bagres, pirañas, anguilas, rayas, arawanas, anacondas, ranas, sapos, caimanes, babos, iguanas, tortugas, loros, búhos, guacamayas, azucareros, pavones, paujiles, águilas, zamuros, aulladores, armadillos, ocarros, chigüiros, osos hormigueros, ocelotes, jaguares, nutrias, murciélagos, cuerpo espines, zorros, venados y delfines, que pasan sus días entre; cedros, moriches, saladillos, caraños, yarumos, laureles, caimos, guaduas, guamos, alcornoques, chaparros, arepillos, palmiches y gualtes.

  7. Eph/ephrin-B-mediated cell-to-cell interactions govern MTS20(+) thymic epithelial cell development.

    Science.gov (United States)

    Montero-Herradón, Sara; García-Ceca, Javier; Sánchez Del Collado, Beatriz; Alfaro, David; Zapata, Agustín G

    2016-08-01

    Thymus development is a complex process in which cell-to-cell interactions between thymocytes and thymic epithelial cells (TECs) are essential to allow a proper maturation of both thymic cell components. Although signals that control thymocyte development are well known, mechanisms governing TEC maturation are poorly understood, especially those that regulate the maturation of immature TEC populations during early fetal thymus development. In this study, we show that EphB2-deficient, EphB2LacZ and EphB3-deficient fetal thymuses present a lower number of cells and delayed maturation of DN cell subsets compared to WT values. Moreover, deficits in the production of chemokines, known to be involved in the lymphoid seeding into the thymus, contribute in decreased proportions of intrathymic T cell progenitors (PIRA/B(+)) in the mutant thymuses from early stages of development. These features correlate with increased proportions of MTS20(+) cells but fewer MTS20(-) cells from E13.5 onward in the deficient thymuses, suggesting a delayed development of the first epithelial cells. In addition, in vitro the lack of thymocytes or the blockade of Eph/ephrin-B-mediated cell-to-cell interactions between either thymocytes-TECs or TECs-TECs in E13.5 fetal thymic lobes coursed with increased proportions of MTS20(+) TECs. This confirms, for the first time, that the presence of CD45(+) cells, corresponding at these stages to DN1 and DN2 cells, and Eph/ephrin-B-mediated heterotypic or homotypic cell interactions between thymocytes and TECs, or between TECs and themselves, contribute to the early maturation of MTS20(+) TECs.

  8. Selected Abstracts of the 11th International Workshop on Neonatology; Cagliari (Italy; October 26-31, 2015

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2015-10-01

    . Piras, A. Ravarino, R. Ambu • Cagliari and Pisa (Italy ABS 18. Pulmonary atresia: the importance of prenatal diagnosis • A.L. Costa, H. Soares, A.L. Neves, C. Moura, J.C. Areias, A.C. Fragoso, J. Estevão-Costa, H. Guimarães • Porto (Portugal ABS 19. The use of hypothermia in preterm asphyxiated neonate: new results from a metabolomics point of view • E. d’Aloja, A. Noto, E. Locci, C. Dalmazzo, G. Pomero, A. Dessì, V. Fanos, P. Gancia • Cagliari and Cuneo (Italy ABS 20. Alopecia areata in a child: case report, management and therapy • F. Farnetani, V.D. Mandel, G. Pellacani • Modena (Italy ABS 21. Physiological and therapeutic roles of mesenchymal stem cells. Is there a gap? • U. Galderisi, F. Pentimalli, A. Giordano • Philadelphia (PA, USA, Naples and Siena (Italy, Kayseri (Turkey ABS 22. Esophageal impedance baseline is correlated with exposure to reflux in newborns with GERD symptoms • F. Cresi, E. Locatelli, E. Maggiora, A. Pirra, C. Peila, E. Bertino • Turin (Italy ABS 23. Analytical pitfalls and future perspectives in the measurement of bone metabolism biomarkers • A. Fortunato • Vicenza (Italy ABS 24. Genetic analysis of surfactant proteins genes in premature newborn infants with severe respiratory distress syndrome • M. Somaschini, S. Presi, M. Ferrari P. Carrera • Milan (Italy ABS 25. Child abuse and neglect: an increasing childhood’s condition • S. Cherubini • Busto Arsizio (Italy ABS 26. When a newborn dies: European approaches to responsibility • F. Tregnaghi, R. Carter, J. Ferguson, K. Nijs • Verona (Italy, Devon (UK, and Leuven (Belgium ABS 27. NMR-based screening possibilities in the neonate and comparison to mass spectral methods • M. Spraul, C. Cannet, H. Schäfer • Rheinstetten (Germany ABS 28. Our team project: learning from mistakes • M. Susi, E.M. Padovani, A. Bertolini, M. Lavarini, S. Tardivo • Verona (Italy ABS 29. Peripheral intravenous catheters in neonates • M. Zicchi, A. Farbo • Sassari

  9. Museos regionales en el Sudeste de la Provincia de Buenos Aires: Una aproximación a la problemática del patrimonio arqueológico Regional museums in southeast Buenos Aires province: an approach to the archaeological heritage issue

    Directory of Open Access Journals (Sweden)

    Irene Elena Brichetti

    2009-06-01

    Full Text Available Los museos nacionales en Argentina surgen conforme al influjo ejercido por la moderna idea de progreso y el imperialismo inscripto en el discurso museológico a través de la justificación de la superioridad occidental. El mundo postcolonial ha abierto otras perspectivas y nuevas voces pugnan por ser incluidas en la historia a través de su incorporación en el debate patrimonial. En este contexto mundial y desde hace tres décadas están creciendo los localismos justamente cuando una incipiente cultura común o global parece elevarse por sobre las singularidades. Es en este marco donde han surgido pequeños museos captados por el ámbito municipal en localidades bonaerenses. Aquí analizaremos cómo esos museos regionales del sudeste de la provincia de Buenos Aires (Miramar, Santa Clara del Mar, Balcarce se inscriben en la problemática del patrimonio arqueológico a partir de la relación entre lo local y lo global, la multivocalidad y el turismo.National museums in Argentina emerged with the influence of the idea of progress and imperialism inscribed in a museological discourse that served to justify western superiority. The postcolonial world has introduced other perspectives and new voices which struggle to be included in history through inclusion in the debate around patrimony. In this worldwide context for the past three decades localism has been growing at the same time that a global and common culture has been rising out of the singularities. Consequently, small museums were opened by local governments in Buenos Aires Province. Our objective is to analyze how the regional museums in southeast Buenos Aires Province (Miramar, Santa Clara del Mar, Balcarce are included in the current heritage debate on the basis of the relationship between the local and the global contexts, multivocality and tourism.

  10. Valoraciones y representaciones que guían las acciones de los cuadros de dirección y gerencia en microempresas y empresas pymes

    Directory of Open Access Journals (Sweden)

    Olga Lucía Anzola Morales

    2008-07-01

    Full Text Available Las pymes como estructura económica han venido creciendo y dominando el panorama empresarial; de forma paralela el Estado colombiano, como estrategia de crecimiento económico, renovó y fortaleció los programas de apoyo orientados a estas empresas. En consecuencia, hacia ellas se encamina la labor de algunas instituciones y centros de investigación, que pretenden aportar conocimiento tendiente a garantizar su perdurabilidad y desarrollo. Los análisis de los esquemas de competitividad de estas empresas han demostrado que los problemas centrales que las aquejan están relacionados con las valoraciones y las representaciones y de quienes las lideran. Debido a esto, el Grupo de Investigación Culturas Corporativas y Perdurabilidad Organizacional estableció un sub-proyecto de investigación tendiente al conocimiento de estos elementos. Participaron en esta investigación de tipo exploratorio y de carácter descriptivo los gerentes de 49 empresas legalmente constituidas, con antigüedad igual o mayor a 5 años y catalogadas como micro o empresas pymes. Para la recolección de la información se utilizó una entrevista semi-estructurada con 8 categorías de análisis: actividades gremiales y formas de relación con otras empresas, relaciones con el Estado, prácticas e imágenes con relación a los trabajadores y sus procesos de organización, actitudes hacia la innovación técnica y administrativa, formas de relación intraempresarial, relación con el exterior, visión prospectiva y dinámica entre empresas y consumidores. El objetivo del presente documento es presentar los hallazgos relacionados exclusivamente con la primera categoría de análisis.

  11. Especies del género Tamarix (Tamaricaceae invadiendo ambientes naturales y seminaturales en Argentina Tamarix species (Tamaricaceae invading natural and seminatural habitats in Argentina

    Directory of Open Access Journals (Sweden)

    E. S. Natale

    2008-07-01

    Full Text Available El género Tamarix incluye especies con antecedentes como invasores agresivos en ambientes naturales de Estados Unidos, México y Australia. Su presencia en Argentina es conocida desde hace mucho tiempo, cultivado como ornamental, cortina corta-vientos o para sombra o creciendo de manera espontánea. Estudios previos citan un número variable de especies del género como cultivadas en el país, este trabajo aclara confusiones relacionadas con sinonimias, confirmando la presencia de cuatro especies en el país: T. gallica, T. ramosissima, T. chinensis y T. parviflora, las tres primeras registradas colonizando ambientes naturales o seminaturales. Se describen las especies del género citadas para Argentina y se provee una clave para su identificación. Se presenta la distribución conocida hasta el momento del género y se incluyen mapas con la ubicación de poblaciones establecidas e invasoras de cada especie a nivel nacional.The genus Tamarix includes species behaving as aggressive invaders in the USA, México and Australia. Previous studies report a variable number of species of this genus cultivated in Argentina as ornamentals, wind-break or for shadow, or growing spontaneously. This work makes clear some confusion related to synonyms and confirms the presence of four species in our country: T. gallica, T. ramosissima, T. chinensis and T. parviflora, the former three recorded colonizing natural and semi-natural habitats. A description of these species is given, together with a key for their identification, and information of their geographical distribution in Argentina, including maps showing the occurrence of established and invasive populations.

  12. El problema de la salud en los Estados Unidos

    Directory of Open Access Journals (Sweden)

    Elsie L. Montiel Ziegler

    1990-05-01

    Full Text Available El alto costo de la atención a la salud es uno de los principales problemas internos que ha enfrentado la sociedad norteamericana en los últimos meses. Existe un acuerdo general acerca de la necesidad de reducir los costos sin afectar el derecho de todos los norteamericanos a la atención de sus necesidades de salud.La crisis que afecta al sistema de salud de los Estados Unidos involucra varios aspectos: los costos han ido creciendo rápidamente, de manera que la nación gasta más del 12% de su producto interno bruto en salud (más que cualquier otra nación industrializada; hay un número cada vez más grande de ciudadanos que carecen de seguro de salud; casi todos los estados de la unión americana se quejan de déficits presupuestales causados por su participación en los programas federales MEDICAID y MEDICARE, que atienden las necesidades de atención médica de los pobres y los ancianos. Ante los urgentes llamados a una reestructuración del sistema varias propuestas han sido elaboradas. Sin embargo, todavía no se logra un consenso acerca de cómo reestructurar el sistemaEste artículo analiza los principales problemas que ocupan el debate sobre la salud, así corno sus principales consecuencias, menciona algunas de las distintas propuestas de solución, y por último, hace un comentario acerca de la factibilidad y de los obstáculos que enfrentaría una refonna global al sistema de salud.

  13. ¿Tecnología inapropiada? Experiencias de vivienda social en gran Bretaña

    Directory of Open Access Journals (Sweden)

    Kellett, Peter

    1990-10-01

    Full Text Available During the 1960's and early 1970's heavy prefabricated construction systems were employed on a large scale to attempt to solve the acute shortage of public housing in Britain. Subsequently a high percentage of these multi-storey blocks experienced severe problems: some because of serious technical faults, whilst others for largely social reasons. The problems worsened and during the 1980's large numbers of these blocks were demolished barely 20 years after their construction. This paper assesses the effects of technological choice in housing, discusses the interrelationship between technology design and social factors, and explores the explanations and implications of these failures.

    Durante los años sesenta y años setenta se implantó un programa a gran escala de conjuntos en altura utilizando sistemas de prefabricación pesada para superar el agudo déficit de vivienda social en Gran Bretaña. Un alto porcentaje de estos conjuntos han resultado problemáticos; algunos por serias fallas técnicas y otros por razones sociales. En los últimos años los problemas han venido creciendo hasta que se ha empezado a demoler miles de estas viviendas, la mayoría de las cuales apenas tienen 20 años de vida. Este artículo evalúa los efectos de decisiones sobre tecnología en vivienda, habla de la interrelación entre tecnología, diseño y factores sociales, y explora las explicaciones e implicaciones de estos problemas.

  14. Ocupación urbana de espacios litorales: gestión del riesgo e iniciativas de manejo en una comunidad patagónica automotivada (Playa Magagna, Chubut, Argentina

    Directory of Open Access Journals (Sweden)

    Alejandro Monti

    2008-01-01

    Full Text Available Playa Magagna es un pequeño asentamiento urbano para recreación estival y de fin de semana, instalado en una típica planicie de acumulación marina de la costa patagónica, sujeta a fuerte influencia de la erosión marina y remoción en masa. Este artículo describe el modo en que los habitantes han procurado mitigar el efecto de ambas funciones forzantes sobre sus casas y otros bienes del entorno doméstico, y muestra que las respuestas individuales han tenido que ser progresivamente complementadas por acciones colectivas y gestiones intersectoriales, a medida que el uso local y regional del espacio fue creciendo. Nuestro trabajo reconstruye la historia socio ambiental a lo largo de 40-50 años, y la interpreta en términos de gestión del riesgo, y del manejo costero, mostrando que la vulnerabilidad física de los contextos expuestos al peligro fue reducida mediante medidas estructurales, y que la vulnerabilidad social, política e institucional fue disminuida incrementando la cohesión interna y el liderazgo. Esta secuencia de eventos es esperable únicamente bajo dos condiciones específicas: espacios habitables con limitada capacidad portante, y una comunidad local automotivada. De no existir una comunidad local con capacidad de autoajuste, deberán esperarse resultados muy diferentes, aun con similares restricciones del medio físico.

  15. Auxilium et consilium dans la Chronica regum Castellae

    Directory of Open Access Journals (Sweden)

    Patricia ROCHWERT-ZUILI

    2006-03-01

    Full Text Available La Chronica regum Castellae présente un modèle de dépendance personnelle fondé sur les devoirs d’auxilium et de consilium, auxquels sont associées des valeurs telles que la strenuitas, la fidelitas et la prudentia. Mais elle dénonce aussi les faiblesses de cette relation pour rehausser la figure du monarque. Elle valorise alors l’aide et le conseil divins et donne de Ferdinand III l’image d’un roi exemplaire, éclairé par l’Esprit saint et libéré de toute pression sociale. Ainsi, dans un contexte où la noblesse a vu son pouvoir s’accroître, Jean d’Osma oeuvre au renforcement du pouvoir royal.La Chronica regum Castellae presenta un señorío feudal modélico basado en los deberes de auxilium y consilium a los que se asocian unos valores como la strenuitas, la fidelitas y la prudentia. Pero también denuncia los defectos de dicho señorío para realzar la figura del monarca. De hecho, la crónica valora la ayuda y el consejo divinos, dando de Fernando III la imagen de un rey ejemplar, guiado por el Espíritu santo y librado de cualquier presión social. Así, en un contexto en que el poder de la nobleza fue creciendo, Juan de Osma contribuye a la consolidación del poder real.

  16. Presentación de caso de un Lipoma Calcificado

    Directory of Open Access Journals (Sweden)

    Pedro Rafael Casado Méndez

    2015-12-01

    Full Text Available El adipoma o lipoma es el tumor de partes blandas más frecuente en la población, pero sus complicaciones resultan ser de tal rareza que apenas el dos porciento de ellos las sufre. Se presentó el caso de un paciente masculino, de 53 años de edad, con antecedentes de una masa tumoral en la región mamilar derecha de más o menos seis años de evolución, que se mostró asintomático, pero que le preocupaba el tumor que le ha estado creciendo. Se le realizó examen físico completo y radiografía de tórax en dos vistas, resultando sugestivo de proceso tumoral de carácter neoplásico. El caso fue  remitido a la consulta de cirugía general, donde se le practicó Tomografía Axial Computarizada, no conclusiva, pero que sugirió proceso oncoproliferativo del tipo rabdomiosarcoma. El paciente fue intervenido quirúrgicamente mediante incisión losángica y se logró la exéresis total del tumor, que se envió para estudio anatomopatológico. Se envió pieza quirúrgica que, al ser seccionada a la mitad, se mostró de color blanco-nácar y consistencia dura y firme. El estudio reveló un lipoma calcificado. El pacientes fue dado de alta con reconsulta al mes, donde se le dio alta definitiva.

  17. VARIACIONES MONETARIAS, IMPULSO URBANO Y SALARIOS EN SANTIAGO EN LA SEGUNDA MITAD DEL SIGLO XVIII

    Directory of Open Access Journals (Sweden)

    ENRIQUETA QUIROZ

    2012-06-01

    Full Text Available El propósito del artículo es demostrar que en la segunda mitad del siglo XVIII, en Santiago de Chile, la circulación monetaria fue mucho más activa de lo que hasta ahora se ha aceptado. Con este propósito se han revisado los niveles de acuñación, especialmente los de moneda menuda, porque esta era la que circulaba en los mercados cotidianamente y se usaba para fijar los precios de los comestibles, así como para pagar los jornales de los trabajadores en la ciudad de Santiago a fines del siglo XVIII y comienzos del siglo XIX. Esto quiere decir que la gente común conocía el dinero y lo utilizaba para pagar sus transacciones cotidianas, lo que a su vez implicaría que la economía chilena estaba creciendo y conformando un mercado con sus propias características.The object of this article is to illustrate that during the second half of the eighteenth century monetary circulation was much more active in Santiago than had been previously thought. To that end minting levels have been analyzed especially the volume of small change as this was the currency that circulated in the daily market and was used to fix the price of foodstuffs as well as to pay daily wages in the city of Santiago during the late eighteenth and the early nineteenth century. This means that common people knew about and used money in their daily transactions and also implies that the Chilean economy was growing and forming a market of its own.

  18. Estrategias de salud electrónica en la región de Las Américas: Situación actual y perspectivas

    Directory of Open Access Journals (Sweden)

    Marcelo D’ Agostino

    2015-06-01

    Full Text Available El objetivo principal de la Estrategia y Plan de Acción Sobre eSalud (2012-2017 es contribuir al desarrollo sostenible de los sistemas de salud de los estados miembros. Con su adopción se busca mejorar el acceso a los servicios de salud y su calidad a través de la utilización de las tecnologías de la información y de las comunicaciones (TIC, la implementación de programas de alfabetización digital y el acceso a información de calidad que permita avanzar hacia sociedades más informadas, equitativas, competitivas y democráticas. La OPS/OMS considera que sociedades con acceso libre y equitativo a la información sobre salud debe ser un derecho fundamental de las personas. El acceso a información, intercambio de conocimientos y uso de las tecnologías de la información y la comunicación en el sector de la salud sigue creciendo y está impulsando cambios significativos en la manera en que la población interactúa con los servicios de salud y entre sí misma en las redes sociales y mediante el uso de dispositivos móviles (mSalud. Esta sociedad hiperconectada, o sociedad de la información, nos trae nuevos desafíos y oportunidades relacionadas con el uso de datos masivos (Big data que nos obliga a repensar nuestra relaciones con la realidad y la forma tradicional de manejo de información en salud

  19. GRAVITATIONAL WAVE DETECTION: WHAT IS NEW

    Directory of Open Access Journals (Sweden)

    O. D. Aguiar

    2011-01-01

    Full Text Available La búsqueda de la detección de ondas gravitacionales ha sido uno de los desafíos tecnológicos más difíciles a los que se han enfrentado jamás los físicos experimentales y los ingenieros. A pesar de los resultados nulos obtenidos hasta la fecha después de cuatro años de búsqueda, la comunidad involucrada en ésta área ha ido creciendo. Una de las principales razones de esto es que la primera detección de ondas gravitacionales y la observación regular de ellas son de las metas más importantes para el comienzo de este milenio. Ellas probarán uno de los fundamentos de la física, la teoría de la relatividad general de Einstein y abrirá una nueva ventana para la observación del universo, lo cual, seguramente causará una revolución en nuestra comprensión de la física y la astrofísica. En esta charla daré un reporte actualizado acerca de todos los detectores relevantes (interferómetros, barras, esferas, radio telescopios y satélites CMB en operación, ó actualización y los que están en construcción o en proyecto. En particular hablaré con más detalle acerca del detector brasileiro Schenberg.

  20. SOIL-PLANT NUTRIENT INTERACTIONS IN TWO MANGROVE AREAS AT SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Ana Paula LANG MARTINS MADI

    2016-01-01

    Full Text Available Los manglares son bosques de arquitectura simple que albergan pocas especies arbóreas, creciendo en un ambiente salino sometido a la influencia de las mareas. El objetivo de este trabajo fue evaluar las posibles interacciones entre las propiedades fisicoquímicas del suelo y la concentración de nutrientes en hojas de diferentes especies de mangle. Se investigó si las diferentes especies que se desarrollan en la misma clase de suelo tienen concentraciones de nutrientes foliares similares, y si las plantas de mangles de la misma especie que se desarrollan en diferentes tipos de suelos tienen concentraciones foliares similares. El estudio se desarrolló en manglares del Estado de Paraná, sur de Brasil, en dos tipos de suelos diferentes (HISTOSOL TIÓNICO Salino sódico y GLEYSOL TIÓNICO Salino sódico. Se analizaron tres especies vegetales diferentes (Avicennia schaueriana, Laguncularia racemosa y Rhizophora mangle. En cada área se delimitaron dos subáreas para recolectar el suelo y las hojas de cada una de las especies. Se tomaron cinco individuos de cada especie del dosel dominante para recoger hojas y muestras de suelo de 0-10 cm, en la proyección de la copa de los árboles seleccionados. Se realizaron análisis univariados y multivariados para probar si las especies de mangle tienen perfiles nutricionales diferentes, y si existe alguna correlación entre las propiedades del suelo con la composición química de las hojas. Los resultados mostraron que el estado nutricional de las especies de mangle es distinto e independiente de los atributos de los suelos en los que se encuentran. Las concentraciones de elementos en las hojas presentan poca correlación con los nutrientes del suelo, lo que sugiere que la absorción de nutrientes por las plantas es selectiva.

  1. Los efectos de la política de liberalización del comercio exterior en el Perú durante el período 1990–1994

    Directory of Open Access Journals (Sweden)

    Jorge Vega

    2007-12-01

    Full Text Available El primer lustro de la década de 1990 fue una etapa de profundos cambios de política económica en el Perú. En este artículo se analizan las principales medidas adoptadas en materia de comercio exterior entre 1990 y 1994, y se miden sus impactos. Endicho período se abolieron los controles de precios y el control de cambios, se alentó la inversión privada nacional y extranjera, se liquidaron los monopoliosestatales de comercio exterior, se decretó la libertad de comercio interno y externo, se suprimieron las prohibiciones de importación, se redujeron los aranceles, se uniformizó la estructura arancelaria y se eliminaron los subsidios a las exportaciones.Las actividades de sustitución de importaciones, anteriormente protegidas, se vieron obligadas a adecuarse al nuevo contexto de protecciones efectivas reducidas.Varias sucumbieron, pero otras lograron estabilizarse y continuaron creciendo, aunque tuvieron que invertir en equipos nuevos y debieron reducir sus precios deventa en el mercado interno, lo cual benefició a los consumidores. En el agregado, crecieron tanto el PBI total como el del sector industrial. No se produjo el colapso industrial que muchos analistas pronosticaban. El empleo industrial se contrajo,pero fue compensado por aumentos en la productividad laboral. Las importaciones crecieron más rápidamente que las exportaciones, lo cual generó déficits comerciales, financiados por el ingreso de capitales. La apertura comercial si bien no eliminó el sesgo antiexportador pre-existente, lo redujo y sentó las bases para un posterior crecimiento del sector exportador. La reducción de aranceles ocasionó pérdidas fiscales iniciales que luego fueron compensadas por el crecimiento de las importaciones y por las mejoras en la administración tributaria.

  2. Monográfico Análisis del Discurso Digital · Presentación

    Directory of Open Access Journals (Sweden)

    Cristina Vela Delfa

    2016-04-01

    Full Text Available El interés por el estudio de los discursos digitales ha ido creciendo, hasta convertirse en un área de trabajo en completa ebullición. Desde distintas disciplinas, como la sociología, la semiología, la filosofía de la ciencia, la psicología, las ciencias de la información y de la comunicación, y la lingüística, han proliferado las investigaciones destinadas a entender este fenómeno comunicativo y discursivo. Los trabajos sobre estos entornos de interacción se multiplican en el ámbito internacional. De ello dan cuenta revistas como Journal of Computer-Mediated Communication, editado por S. Shyam Sundar (The Pennsylvania State University o Language@Internet!, editada por Susan C. Herring (Indiana University, Bloomington. Pensamos, no obstante, que todavía hay ciertas carencias en la investigación sobre el discurso digital en lengua española, a pesar de ser una de las más usadas en la red, entre la tercera y la cuarta posición, según datos recientes. Ello fue lo que nos movió a dedicar un número de la Revista Aposta al estudio del discurso digital en español, a fin de abordar la complejidad que entraña la trama de dispositivos, interfaces y plataformas que sirven de soporte a la comunicación digital.

  3. LA CALIDAD DE LA DEMOCRACIA PARAGUAYA: UN AVANCE SOBRE CAMINOS TORTUOSOS

    Directory of Open Access Journals (Sweden)

    Mikel BARREDA

    2010-01-01

    Full Text Available En el marco de una preocupación cada vez mayor por analizar la calidad de las nuevas democracias, este artículo se ocupa de examinar el caso de Paraguay. Se trata de una democracia poco atendida en la literatura especializada aunque su interés está creciendo como consecuencia de la derrota electoral del Partido Colorado (en el poder desde 1947 en las presidenciales de abril de 2008. Para llevar a cabo este trabajo, se parte de una reflexión teórica y metodológica en torno a la noción y la medición empírica de la calidad democrática. Al realizar el análisis de la democracia paraguaya se atiende a cinco dimensiones fundamentales: derechos políticos y libertades civiles, Estado de Derecho, rendición de cuentas, responsiveness y participación. La conclusión general es que es una democracia de baja calidad, distanciada del promedio latinoamericano. Para explicar este bajo nivel de calidad democrática se presta atención a tres tipos de explicaciones, que están relacionadas: unas referentes a la estructura socioeconómica del país, otras a las características de sus instituciones políticas (sobre todo, la relevancia del clientelismo y, finalmente, otras relativas a los intereses y estrategias de los partidos políticos.

  4. Características psicológicas asociadas a la incidencia de lesiones en deportistas de modalidades individuales

    Directory of Open Access Journals (Sweden)

    Rosendo Berengüí-Gil

    2013-10-01

    Full Text Available Las lesiones deportivas son una de las consecuencias más negativas que se derivan de la práctica deportiva. Son múltiples los factores que pueden estar en su origen, creciendo el interés en la búsqueda de las variables psicológicas que se encuentran asociados a su producción. En el presente estudio se evaluó a 84 deportistas de cuatro disciplinas individuales, de diferentes categorías de competición y nivel competitivo. Se registran 247 lesiones en el período de dos años, una media de 2.94 por deportista (1.47 por año, existiendo diferencias estadísticamente significativas entre las medias de lesiones de los cuatro deportes estudiados. Los deportistas de mayor edad sufren más lesiones, al igual que aquellos de mayor nivel de rendimiento. Mediante la administración del 16PF-5, IPED y SCAT, se obtiene que los deportistas con bajas puntuaciones en Estabilidad Emocional y Control de Afrontamiento Negativo, y altas en Ansiedad, presentan un mayor promedio de lesiones. Los sujetos sin lesiones se diferencian de los lesionados por mayores niveles de Estabilidad Emocional, Privacidad y Apertura al cambio, Control de Afrontamiento, y menores de Ansiedad. Existen correlaciones estadísticamente significativas entre el número de lesiones y las puntuaciones de Estabilidad Emocional, Tensión, Aprensión, Ansiedad, y ansiedad rasgo competitiva.

  5. Microprocesadores AMD: pasado, presente y futuro

    Directory of Open Access Journals (Sweden)

    Reynaldo Hernández Perdomo

    2005-01-01

    Full Text Available La evolución de la humanidad y en particular de la electrónica de los últimos años ha estado basada en los constantes avances en la fabricación de chips. Los circuitos integrados se han ido incorporando a todo los que nos rodea hasta el punto de que la vida sin ellos parece imposible. El microprocesador es uno de los logros más sobresalientes del siglo XX. Esas son palabras atrevidas, y hace un cuarto de siglo tal afirmación habría parecido absurda. Pero cada año, el microprocesador se acerca más al centro de nuestras vidas, forjándose un sitio en el núcleo de una máquina tras otra. Su presencia ha comenzado a cambiar la forma en que percibimos el mundo e incluso a nosotros mismos. Cada vez se hace más difícil pasar por alto el microprocesador como otro simple producto en una larga línea de innovaciones tecnológicas. No obstante que reconocemos la penetración del microprocesador en nuestras vidas, ya estamos creciendo indiferentes a la presencia de esos miles de máquinas diminutas que nos encontramos sin saberlo todos los días. Así que, antes de que se integre de manera demasiado imperceptible en nuestra diaria existencia, es el momento de celebrar al microprocesador y la revolución que ha originado, para apreciar el milagro que es en realidad cada uno de esos chips de silicio diminutos y meditar acerca de su significado para nuestras vidas y las de nuestros descendientes.

  6. A casual alien plant new to Mediterranean Europe: Ceiba speciosa (Malvaceae in the suburban area of Palermo (NW Sicily, Italy

    Directory of Open Access Journals (Sweden)

    Pasta, Salvatore

    2014-12-01

    Full Text Available The abiotic and biotic characteristics of the first sites where floss silk tree behaves as a casual alien plant in the Mediterranean Europe are described. The species was probably first planted in botanical gardens of southern France few decades before mid XIX century. It was introduced in Palermo in 1896, a city which appears to match very well its climatic requirements. According to the available information on its biology and ecology in both its original and secondary range, the floss silk tree should not become an invasive alien plant in the Mediterranean. Nevertheless, several gaps need to be filled in order to increase our understanding of future trends of Ceiba speciosa in southern Europe, in particular, the eventual role of pollinators and seed dispersers outside the species’ natural range.Se describen las caracteristicas abióticas y bióticas de los primeros sitios del mediterráneo europeo donde el árbol palo borracho se encuentra creciendo como especie alóctona casual. Con respecto a la historia de su introducción, esta especie fue probablemente plantada en los jardines botánicos del sur de Francia unos pocos decenios antes de la mitad del siglo XIX. En 1896, sin embargo, fue introducida en Palermo, ciudad que parece satisfacer muy bien sus requerimientos climáticos. De acuerdo con la información disponible, tanto dentro como fuera de su área de distribución natural, el palo borracho no debería convertirse en planta invasora en el mediterráneo. Sin embargo, algunos vacíos de información deben ser completados antes de establecer su potencial invasor de una manera definitiva, particularmente, el posible papel de agentes polinizadores y dispersores fuera del área de distribución natural de la especie.

  7. Análisis del sector manufacturero en las regiones españolas

    Directory of Open Access Journals (Sweden)

    Delgado Rodríguez, M. Jesús

    2007-01-01

    Full Text Available La industria manufacturera interviene de manera fundamental en la evolución económica. El modelo general de crecimiento experimentado por las economías desarrolladas ha ido acompañado, inicialmente, de determinados cambios en sus estructuras productivas: El aumento continuado de la participación de los servicios en los agregados económicos producción y empleo junto a la consolidación del incremento de la importancia de la industria en la economía; apoyados en la reducción del peso de la agricultura . En etapas posteriores la industria se ha estabilizado, mientras los servicios han continuado creciendo hasta llegar a un punto en que este crecimiento se produce a expensas de la industria. El fortalecimiento de la industria manufacturera es decisivo en todo este proceso de transformación y modernización de las estructuras productivas de las economías Por su influencia en la mejora de la competitividad de la economía y por favorecer los cambios para el progreso técnico, tiene un papel central en los procesos de crecimiento. En este trabajo se analiza trayectoria y situación de la industria manufacturera en las regiones españolas de 1995 a 2002, en relación con su grado de desarrollo económico, a través de su especialización productiva y de su eficiencia.

  8. Carcinoma verrugoso

    Directory of Open Access Journals (Sweden)

    Esteban Quesada Jiménez

    2004-09-01

    Full Text Available Se presenta el caso de un paciente masculino de 76 años, vecino de Turrialba, agricultor, que consultó por una lesión de 3 años de evolución, localizada en la palma de la mano derecha a nivel palmar y compromiso de los dedos de la misma mano, caracterizada como una neoformación exofítica verrugosa de 5 por 11 cm. aproximadamente, con material caseoso entre sus crestas. La lesión ha estado creciendo de forma acelerada en los últimos 3 meses, causándole dolor y que le imposibilita ellaborar. Se le realizaron exámenes y se descartaron varias causas infecciosas, y concluyendo luego de varias biopsias con el diagnóstico de un carcinoma verrugoso. El paciente fue tratado mediante una amputación parcial de la mano. Este tumor es una variante del carcinoma epidermoide y presentamos su clasificación, patogénesis, histopatología, manifestaciones clínicas más frecuentes y diagnóstico diferencial.A 76 year old farmer from Turrialba (Cartago, presented with a 3 year old lesion of his right pal and proximal fingers. It was exophitic, wart like, and it measured 5x11 cm, draining caseous material from its crests. The lesion had grows quickly for the last 3 months and it became tender to the point of making impossible for him to work. A series of tests were done to rule out other possible infections causes, after several biopsies the diagnosis of verrocous carcinoma was made. The patient underwent a partial amputation of his hand. This tumor is considered a from of squamous cell carcinoma, we present here its classification, pathogenesis, histopathology, clinical manifestations and diferential diagnosis.

  9. Estrategias de vida y rutas de desarrollo de jóvenes rurales en Nicaragua: los casos en Muy Muy y en Matiguás

    Directory of Open Access Journals (Sweden)

    Griet Steel

    2011-08-01

    Full Text Available Existe una preocupación creciente en la industria del desarrollo sobre la situación de hombres y mujeres jóvenes creciendo en contextos de pobreza. Sin embargo, aún hay una escasez de investigación que dé cuenta de lo que ocurre en la vida diaria de losjóvenes y la forma en que éstos experimentan y tratan de manejar las situaciones de pobreza. Los estudios de juventud generalmente consideran a las personas jóvenes como pasivos receptáculos de las decisiones y políticas definidas por los adultos, y tienden a ignorar la capacidad que tienen las personas jóvenes de generar riqueza. Enel presente artículo enfatizamos la necesidad de hacer investigación más profunda sobre las estrategias de vida de los jóvenes y su transición hacia la adultez. Sobre la base de estudios de caso de jóvenes rurales nicaragüenses, analizamos cómo los jóvenes de Muy Muy y Matiguás negocian sus estrategias de vida con sus padres, conla perspectiva de acumular recursos necesarios para lograr independizarse. En eldesenvolvimiento de sus estrategias de vida reconocemos a los jóvenes como agentes activos del desarrollo de sus hogares y localidades. En esta medida, promovemos que las instituciones de desarrollo razonen sobre las iniciativas de los jóvenes en sus intervenciones de desarrollo. En este sentido, el presente estudio tiene la perspectiva no sólo de enriquecer el debate académico alrededor de las estrategias de vida de los jóvenes sino también de proveer insumos a las organizaciones que implementanestrategias de desarrollo con jóvenes en Nicaragua y la región.

  10. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.

  11. DIVERSIDAD DE ABEJAS SIN AGUIJÓN (Hymenoptera:Meliponini UTILIZADAS EN MELIPONICULTURA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    GUIOMAR NATES-PARRA

    2013-01-01

    Full Text Available En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura, es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 departamentos de Colombia, que cultivan 25 especies de abejas sin aguijón, agrupadas en 12 géneros. Se encontraron al menos nueve especies más sin identificación completa, se reportan cuatro nuevos registros para el país y se amplía la distribución para 21 taxones. Se presenta información sobre la distribución regional y altitudinal, el cultivo urbano y las denominaciones locales para las abejas. Se revisan algunas características de los géneros cultivados más comunes (Tetragonisca, Melipona, Paratrigona, Scaptotrigona y Nannotrigona y se discute la importancia del vínculo entre diversidad biológica y cultural que se manifiesta en los nombres locales reportados. Ante un escenario mundial de expansión de la meliponicultura, se resaltan necesidades de investigación y riesgos para la conservación y manejo de la diversidad de abejas sin aguijón y los conocimientos asociados.

  12. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos

    Directory of Open Access Journals (Sweden)

    Julio CABERO ALMENARA

    2011-07-01

    Full Text Available La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previamente elaborado y validado por expertos relacionados con las Tecnologías de la Información y la Comunicación y Metodología de Investigación. Con él, fueron codificados la totalidad de los artículos publicados. Realizándose a continuación un análisis descriptivo: univariante y relacional. Los principales resultados indican una constante presencia femenina en la autoría de los artículos, que abordan formatos de publicación tanto de reflexión como de investigación. Destacando el porcentaje de artículos de investigación realizados sobre la Aplicación de las TIC en la Universidad, encontrándose a continuación la formación del profesorado y la teleformación/e-learning.

  13. Bioinfo_eXtrema : un enfoque bioinformático para integrar información ambiental, bioquímica y genómica, enfocado en bioprospección y selección de consorcios de microorganismos con aplicaciones en biorremediación

    Directory of Open Access Journals (Sweden)

    Fabián Capdevielle

    2011-05-01

    Full Text Available La identificación de componentes funcionales clave para diversos bioprocesos de interés industrial ha permitido seleccionar aislamientosadaptados a condiciones ambientales extremas en tres especies de hongos del género Penicillium. Dichos aislamientos fueron evaluados in vitro para caracterizar su potencial como componentes de un consorcio microbiano aplicable en biorremediación de efluentes industriales que contienen residuos lignocelulósicos. Los resultados de la anotación de secuencias genómicas disponibles para una de las especies identificadas apuntan a la existencia de genes con alta similaridad respecto a los existentes en diversos hongos considerados como referencia en materia dedegradación de lignina en ambientes naturales. Las anotaciones funcionales propuestas a partir de secuencias accesibles –identificadasa través de la base de datos Fungal Oxidative Lignin Enzymes– podrían contrastarse con los resultados experimentales para cepas creciendo en diferentes medios con lignina, representando ambientes industriales extremos. Mediante este trabajo se propone el ensamblado de Bioinfo_eXtrema como parte de un enfoque bioinformático centrado en la selección de consorcios de extremófilos para aplicaciones en biotecnología industrial, combinando diversas técnicas de minería de datos –integradas a través del Waikato Environment for Knowledge Analysis– para facilitar la integración de información molecular disponible e indicadores funcionales relevantes para aplicaciones en biorremediación.

  14. Atuação da enfermagem no tratamento com oxigenoterapia hiperbárica Actuación de la enfermería en el tratamiento con oxigenoterapia hiperbárica Nursing activities in hyperbaric oxygen therapy

    Directory of Open Access Journals (Sweden)

    Elias Pereira de Lacerda

    2006-02-01

    Full Text Available Através de relato de experiência desenvolvida na Clínica de Medicina Hiperbárica do Hospital Naval Marcílio Dias os autores discorrem sobre a atuação da enfermagem no tratamento com oxigenoterapia hiperbárica. Breve histórico do procedimento, efeitos terapêuticos, indicações, efeitos colaterais e complicações são apresentados. Entendem os autores que esforços devem ser envidados para que a atuação da enfermagem nesse novo papel seja conscientizada como alternativa de mercado de trabalho nesta especialidade que vem crescendo a cada dia.A través de un relato de experiencia desarrollada en la Clínica de Medicina Hiperbárica del Hospital Naval Marcílio Dias, los actores discurren sobre la actuación de la enfermería en el tratamiento con oxigenoterapia hiperbárica. Se presenta un breve histórico del procedimiento, efectos terapéuticos, indicaciones, efectos colaterales y complicaciones. Los autores consideran que son necesarios esfuerzos para que la actuación de la enfermería en ese nuevo papel sea concienciada como alternativa de mercado de trabajo en esta especialidad que viene creciendo a cada día.The authors discuss nursing activities in hyperbaric oxygen therapy through an experience report developed at the Medical Clinical of the Naval Hospital Marcílio Dias. This article presents a brief history of the procedure, its therapeutic effects, indications, collateral effects and complications. The authors believe that efforts are needed to create awareness about nursing activities in this new role as a labor market alternative in this growing specialty area.

  15. [Adverse event reporting in an intensive care unit at Tunja, Colombia].

    Science.gov (United States)

    Riveros, Efraín; Amado, Paula; Zambrano, Paula

    2013-01-01

    Introducción: La seguridad de paciente en áreas hospitalarias críticas ha sido tema de diversas investigaciones. En este sentido, en Colombia está creciendo la conciencia acerca de la gestión de eventos adversos. Este estudio explora la primera fase de dicha gestión: el reporte en la unidad de cuidado intensivo de una institución privada prototipo. Objetivo: Evaluar el reporte de eventos adversos en una clínica colombiana de tercer nivel, a través de la estimación de frecuencias y categorías de los reportes. Material y Métodos: Se hizo un estudio descriptivo sobre la tasa de reporte de eventos adversos en la Clínica de los Andes de Tunja, durante 2011, a través de la estimación de frecuencias y categorías de los reportes.La tasa de reporte se definió como el número de reportes por 1000 días cama. Reportamos las categorías de los eventos adversos comomayores y menores. Resultados: Se registraron 383 admisiones a la UCI, correspondientes a 2374 días paciente. Se presentaron un total de 54 eventos adversos reportados (tasa de 22,74 por 1000 días paciente). El tipo de evento más frecuente fue el relacionado con vías intravenosas (55%)(IC 95% 50,1-58,3), seguido por desviación de procesos (22%)(IC 95% 18,2-26,1). Conclusiones: Se encontróuna tasa de reporte de eventos adversos en el rango superior de lo publicado en la literatura. Posiblemente exista aúnuna proporción no cuantificada de subregistro, que puede atribuirse principalmente a factores culturales.

  16. La producción de leche orgánica en la región Puno: una alternativa de desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Saúl Olarte Calsina

    2013-06-01

    Full Text Available El consumo de productos orgánicos viene creciendo en todo el mundo y la leche orgánica no es la excepción. En Puno, por sus características geográficas, culturales e históricas, la producción agropecuaria aún mantiene tecnologías de producción ancestrales, buscando el equilibrio con el medio ambiente, con un uso mínimo de fertilizantes y pesticidas, con lo que se muestra un enfoque en la sostenibilidad y una tendencia a producir orgánicamente. El objetivo de este trabajo fue determinar mediante una simulación la viabilidad económica y el riesgo de producir leche orgánica como una alternativa de desarrollo sostenible. Se consideró la producción por encima de los 3.000 metros de altura, área de 6,5 has, una vaca (criolla por hectárea produciendo 10 litros de leche/día. Los indicadores económicos resultaron positivos: el VAN fue S/. 2.916,38, TIR 24%, VAE S/. 866,33, ratio B/C S/. 1,48 (se aclaro en la metodología y el período de recuperación de la inversión resultó de 5,88 años, evidenciando que la producción de leche orgánica es económicamente viable pero con riesgo elevado: la simulación de Monte Carlo mostró que existe 71,43% de probabilidad de no resultar viable.

  17. Prevalence of obesity among primary students between 2009 to 2014 in China: a meta-analysis.

    Science.gov (United States)

    Qi, Yanhong; Yu, Yang; Li, Kaisheng; Chen, Zhihong; Liu, Yuanchang; Zhang, Hongmei

    2014-09-12

    Introducción: En los últimos años, la obesidad se ha convertido en el principal problema de salud pública a nivel mundial. La tasa de detección de obesidad infantil está creciendo alarmantemente entre los niños y los adolescentes en China, cuya población de 120 millones se sitúa en el rango de obesidad. Se calculó que el 8% de los niños son obesos. Métodos: Se recopilaron publicaciones entre 2009 y 2014 sobre la prevalencia de obesidad entre los alumnos de primaria en China de PubMed, textos completos de bases de datos de periódicos chinos online de VIP, CNKI y Wanfang. Se empleó software de meta-análisis para resumir y analizar las tasas de detección incluidas en la bibliografía previamente obtenida. Resultados: Después de la evaluación de la calidad de los artículos, finalmente incluimos 18 artículos en nuestro estudio, y los tamaños de la muestra total en la investigación sobre obesidad fueron 247547, donde 26466 presentaron obesidad. Los resultados de los meta-análisis mostraron que la prevalencia de la obesidad en los alumnos de primaria es del 10,0% (IC del 95%: 7,2% - 13,5%). Conclusión: Nuestros resultados indican que la prevalencia de obesidad en China todavía supone un problema preocupante, dado que la situación será peor si no se toman medidas eficaces y prácticas.

  18. Orientaciones de Meta y Clima Motivacional Según Sexo y Edad en Educación Física

    Directory of Open Access Journals (Sweden)

    Antonio Baena - Extremera

    2014-01-01

    Full Text Available Esta investigación analizó las diferencias en función del sexo y la edad en el clima motivacional percibido y las orientaciones de meta de estudiantes en sus clases de Educación Física. Para ello, se administró un cuestionario compuesto por el Cuestionario de Percepción de Éxito en el Deporte adaptado a la Educación Física y por el Cuestionario de Orientación al Aprendizaje y al Rendimiento en las Clases de Educación Física. La muestra estuvo compuesta por un total de 846 estudiantes de secundaria de 12 a 19 años. Se realizó análisis de correlación y de varianza multivariado (MANOVA 2x3. Los resultados mostraron que existe una relación positiva y significativa entre las orientaciones de meta y el clima motivacional percibido por el alumnado. Las chicas presentan valores mayores de orientación al ego y de percepción de un clima implicante al rendimiento que los chicos. Y las únicas diferencias por edad se dan en el clima motivacional implicante al rendimiento. Como principal conclusión señalar que el docente debe prestar mucha más atención al clima motivacional creado en clase conforme el alumnado va creciendo, fomentando un clima implicante al aprendizaje. Asimismo tendrá que buscar estrategias que alejen a las chicas de estereotipos tradicionales y las refuercen socialmente.

  19. Energy in Latin America: Present and future

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, Johnny N; Sheffield, John W [University of Missouri-Rolla (United States)

    1997-07-01

    The primary focus of this paper is on the analysis of the current situation of energy production and consumption in the region as a whole, to examine the determinants of energy supply and demand growth, and to forecast the future growth of energy production, consumption, and balances. Since the growth of oil demand in Latin American countries themselves began to accelerate in the early 1990s, the lack of investment and development and the consequence shrinking base of Latin America's energy exports may pose serious challenges to North America, where dependence on the Middle Eastern oil and gas is growing. This paper attempts to present different scenarios and strategies to tackle the problem of Latin America's future net energy supply. [Spanish] El enfoque principal de este articulo es sobre la base de la situacion actual de la produccion y consumo de energia en la region como un todo, para examinar las determinantes del suministro de energia y el crecimiento de la demanda y la prediccion del crecimiento futuro de la produccion de energia, consumo y balances. Desde el crecimiento de la demanda del petroleo, en los paises latinoamericanos, ellos mismos empezaron a acelerar a principios de los 90s, la falta de inversion y desarrollo y la consecuencia del encogimiento de la base de las exportaciones de energia de Latinoamerica podrian imponer serios retos a Norte America, en donde la dependencia del petroleo y del gas del Medio-Oeste esta creciendo. Este articulo intenta presentar diferentes escenarios y estrategias para atacar el problema del suministro neto de energia de Latinoamerica.

  20. Manifestaciones muco cutáneas en anorexia nerviosa: Mucous and cutaneous manifestations of the anorexia nervosa

    Directory of Open Access Journals (Sweden)

    MB Leroux

    Full Text Available La anorexia nerviosa es una enfermedad psiquiátrica, cuya incidencia está creciendo en las últimas décadas. Afecta sobre todo a las adolescentes y mujeres jóvenes. Los signos clínicos son consecuencia de las carencias nutricionales y de los mecanismos de compensación, que el organismo implementa para conservar la vida. Las manifestaciones cutáneas y bucales son consecuencia de la desnutrición: vómitos autoprovocados, consumo de drogas o medicamentos no recetados y de la enfermedad psiquiátrica en sí misma. Se presentan diez pacientes, ocho mujeres y dos varones con signos cutáneos compatibles con anorexia nerviosa. El rango de edad es de 17 a 32 años. En orden de frecuencia se hallaron: acrocianosis, alopecia, acné, xerosis, palidez, hirsutismo, cambios en las membranas bucales y lesiones autoprovocadas. Creemos que el reconocimiento de estos signos cutáneos acompañado de un exhaustivo interrogatorio, puede colaborar en el diagnóstico de este trastorno alimentario.Anorexia nervosa is a psychiatric disease with an increasing incidence in the last decade, which affects principally adolescents and young women. Clinical signs are a consequence of malnutrition and the compensating mechanisms implemented to preserve life. Skin and oral lesions are caused by malnutrition, self-provoked vomiting, illegal drug consumption or therapeutic drugs utilization, and the psychiatric disease so far. Case reports: ten patients (eight females and two males with possible skin alterations due to anorexia nervosa, aged 17 to 32 yr. The most frequent signs, in order of priority were: acrocyanosis, alopecia, acne, xerodermia, pallor, hirsutism, oral injuries and self provoked injuries. We propose that the finding of these skin lesions plus an exhaustive questionnaire could aid to diagnose this eating disorder.

  1. Estrategias de salud electrónica en la región de Las Américas: Situación actual y perspectivas

    Directory of Open Access Journals (Sweden)

    Marcelo D’ Agostino

    Full Text Available El objetivo principal de la Estrategia y Plan de Acción Sobre eSalud (2012-2017 es contribuir al desarrollo sostenible de los sistemas de salud de los estados miembros. Con su adopción se busca mejorar el acceso a los servicios de salud y su calidad a través de la utilización de las tecnologías de la información y de las comunicaciones (TIC, la implementación de programas de alfabetización digital y el acceso a información de calidad que permita avanzar hacia sociedades más informadas, equitativas, competitivas y democráticas. La OPS/OMS considera que sociedades con acceso libre y equitativo a la información sobre salud debe ser un derecho fundamental de las personas. El acceso a información, intercambio de conocimientos y uso de las tecnologías de la información y la comunicación en el sector de la salud sigue creciendo y está impulsando cambios significativos en la manera en que la población interactúa con los servicios de salud y entre sí misma en las redes sociales y mediante el uso de dispositivos móviles (mSalud. Esta sociedad hiperconectada, o sociedad de la información, nos trae nuevos desafíos y oportunidades relacionadas con el uso de datos masivos (Big data que nos obliga a repensar nuestra relaciones con la realidad y la forma tradicional de manejo de información en salud

  2. DIVERSIDAD DE ABEJAS SIN AGUIJÓN (HYMENOPTERA:MELIPONINI UTILIZADAS EN MELIPONICULTURA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Guiomar Nates Parra

    2013-07-01

    Full Text Available En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura, es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 departamentos de Colombia, que cultivan 25 especies de abejas sin aguijón, agrupadas en 12 géneros. Se encontraron al menos nueve especies más sin identificación completa, se reportan cuatro nuevos registros para el país y se amplía la distribución para 21 taxones. Se presenta información sobre la distribución regional y altitudinal, el cultivo urbano y las denominaciones locales para las abejas. Se revisan algunas características de los géneros cultivados más comunes (Tetragonisca, Melipona, Paratrigona, Scaptotrigona, y Nannotrigona y se discute la importancia del vínculo entre diversidad biológica y cultural que se manifiesta en los nombres locales reportados. Ante un escenario mundial de expansión de la meliponicultura, se resaltan necesidades de investigación y riesgos para la conservación y manejo de la diversidad de abejas sin aguijón y los conocimientos asociados.

  3. Nurse effect in seedling establishment: facilitation and tolerance to damage in the Andes of central Chile Efecto nodriza en el establecimiento de plántulas: facilitación y tolerancia al daño en los Andes de Chile central

    Directory of Open Access Journals (Sweden)

    IAN S ACUÑA-RODRÍGUEZ

    2006-09-01

    ás relevante en ambientes estresantes. Este efecto sería particularmente importante durante el periodo de establecimiento de las plántulas debido a su alta vulnerabilidad a factores bióticos y abióticos como herbivoría y desecación. La tolerancia a la herbivoría evidencia la capacidad de las plantas de recrecer y reproducirse después del daño, pero esta capacidad es recurso-dependiente. En los Andes de Chile central, la planta en cojín Laretia acaulis (Apiaceae atenúa el efecto del estrés ambiental, aumentando la supervivencia de diversas especies de plantas asociadas. Proponemos que las plántulas que se encuentren creciendo dentro de los cojines de L. acaulis deberían evidenciar niveles mayores de tolerancia en relación a aquellas plántulas creciendo fuera de los cojines. Para probar esta hipótesis se llevó a cabo un experimento de campo con dos especies nativas perennes: Hordeum comosum (Poaceae y Haplopappus anthylloides (Asteraceae. Plántulas de ambas especies fueron sembradas dentro y fuera de los cojines de L. acaulis, y la mitad de ellas recibieron daño manual (50 % tejido foliar removido. En general, las plántulas que se encontraron creciendo dentro del cojín evidenciaron una mayor supervivencia independientemente del tratamiento de daño. A pesar de que la ubicación de las plántulas no afectó la respuesta en tolerancia por parte de H. anthylloides, sí afectó significativamente la tolerancia de H. comosum. Por lo tanto, encontramos valores similares para la supervivencia de plántulas de H. comosum dentro de los cojines, pero la supervivencia de plántulas dañadas fuera de los cojines fue significativamente menor que la de plántulas control. Se pudo evidenciar la ocurrencia de efecto nodriza por parte de L. acaulis sobre el establecimiento de ambas especies y conjuntamente un aumento en la tolerancia al daño para H. comosum en este hábitat estresante

  4. Características estruturais de ácidos húmicos isolados de solos com adição de resíduos orgânicos de origem urbana: composição elementar, análise de RMN 13C e Pi-CG/EM

    Directory of Open Access Journals (Sweden)

    L. P. Canellas

    2002-06-01

    Full Text Available Foram avaliadas as alterações nas características estruturais de ácidos húmicos (AH decorrentes da adição de matéria orgânica de resíduos urbanos. Os AH foram extraídos da camada superficial (0-20 cm de um Argissolo Vermelho-Amarelo (Seropédica, RJ e de um Latossolo Vermelho Amarelo (Piraí, RJ, ambos tratados com o equivalente a 80 t ha-1 (em base seca de composto de lixo urbano e lodo de estação de tratamento de esgotos. O tempo de incubação em laboratório foi de 24 semanas à temperatura ambiente e umidade mantida na capacidade de campo. Para caracterizar os AH, foram utilizadas a análise elementar, a ressonância magnética nuclear (RMN de 13C e Pirólise acoplada à cromatografia gasosa e a espectrometria de massas (Pi-CG/EM. A análise de RMN 13C permitiu observar alterações na composição molecular dos AH de forma clara, principalmente, pelo aumento do teor de C mono e di oxigenados (δC 50-110 e pela diminuição dos teores de grupos CH2 e CH3 (δC 50-110. O aumento no teor de carboidratos evidencia a presença de estruturas mais lábeis nos AH com adição dos resíduos. Em adição, a técnica de Pi-CG/EM permitiu verificar diferenças qualitativas significativas nos compostos orgânicos, provenientes da fragmentação térmica dos AH com incorporação de novas estruturas, sobretudo da fração lipídica e de derivados de carboidratos (furanos, nas amostras de solos tratados com ambos os resíduos orgânicos. O uso em conjunto das técnicas analíticas de RMN 13C e de Pi-CG/EM foi eficiente para avaliar as mudanças na composição molecular de ácidos húmicos decorrentes da adição de resíduos orgânicos de origem urbana.

  5. Identification of CVM and DUMPS Carriers in Chinese Holstein Bulls%中国荷斯坦公牛脊椎畸形综合征和尿苷酸合酶缺乏症遗传缺陷检测

    Institute of Scientific and Technical Information of China (English)

    梁若冰; 谢岩; 范学华; 张毅; 孙东晓; 张胜利

    2014-01-01

    本研究旨在研究中国荷斯坦公牛脊椎畸形综合征(Complex vertebral malformation,CVM)和尿苷酸合酶缺乏症(Deficiency of uridine monophosphate synthase,DUMPS)两种遗传缺陷的携带者及系谱来源.通过PIRA-PCR和PCR-RFLP方法对参加全国青年公牛联合后裔测定和国家良种补贴项目的、来自全国27个公牛站的691头荷斯坦公牛分别进行了CVM和DUMPS的遗传缺陷检测,共发现34头CVM和1头DUMPS隐性有害基因携带者公牛,携带者比例分别为4.92%和0.14%,隐性有害等位基因频率分别为2.46%和0.07%.经过系谱分析发现,其中28头CVM携带者均为美国公牛Carlin-M Ivanhoe Bell的后代,另外6头因系谱不完整而无法查询.1头DUMPS携带者为美国公牛Skokie Sensation Ned后代.因此,我国有必要尽快建立荷斯坦牛隐性遗传缺陷监控体系并进行系谱标注,通过青年公牛预选和选种选配,避免携带者公牛进入后裔测定和良种补贴项目,以逐步降低我国奶牛群体中隐性有害等位基因频率,为提高奶牛群体质量提供依据.

  6. Dot-ELISA-IgM in saliva for the diagnosis of human leptospirosis using polyester fabric-resin as support (Preliminary Report Dot-ELISA-IgM em saliva para diagnóstico da leptospirose humana, empregando como suporte tecido de poliéster-resina (Nota Prévia

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius da Silva

    1994-10-01

    Full Text Available In order to improve the diagnosis of human leptospirosis, we standardized the dot-ELISA for the search of specific IgM antibodies in saliva. Saliva and serum samples were collected simultaneously from 20 patients with the icterohemorrhagic form of the disease, from 10 patients with other pathologies and from 5 negative controls. Leptospires of serovars icterohaemorrhagiae, canicola, hebdomadis, brasiliensis and cynopteri grown in EMJH medium and mixed together in equal volumes, were used as antigen at individual protein concentration of 0.2 µg/µl. In the solid phase of the test we used polyester fabric impregnated with N-methylolacrylamide resin. The antigen volume for each test was 1µl, the saliva volume was 8 µl, and the volume of peroxidase-labelled anti-human IgM conjugate was 30 µl. A visual reading was taken after development in freshly prepared chromogen solution. In contrast to the classic nitrocellulose membrane support, the fabric support is easy to obtain and to handle. Saliva can be collected directly onto the support, a fact that facilitates the method and reduces the expenses and risks related to blood processing.Com a finalidade de melhorar o diagnóstico da leptospirose humana, padronizou-se o teste dot-ELISA para a pesquisa de anticorpos específicos da classe IgM na saliva. Empregaram-se amostras de saliva e soro coletadas simultaneamente de 20 pacientes com a forma ictero-hemorrágica da doença, de 10 pacientes com outras patologias e 5 controles negativos. Culturas de Leptos-pira em meio EMJH, dos sorovares: icterohaemorrhagiae, canicola, hebdomadis, brasiliensis e cynopteri, foram utilizadas como antígeno, na concentração proteica individual de 0,2 µg/µl, misturadas em volumes iguais. Na fase sólida do teste empregou-se tecido de po-liéster impregnado com resina de N-metilol-acrilamida. O volume do antígeno para cada teste foi de 1µl, o de saliva 8µl, o de conjugado anti-IgM humana marcada com peroxidase, de

  7. Sinopsis del mundo Piro: Ética y estética en el arte Piro. Modificaciones en las estructuras de parentesco Piro durante el auge del caucho (1885-1915. Los asentamientos Piros y la persistencia de su identidad

    Directory of Open Access Journals (Sweden)

    Luis Román Villanueva

    1985-12-01

    Full Text Available Los tres artículos que a continuación presentamos tienen como objeto detallar tres aspectos fundamentales de la cultura Piro. Este grupo etno-linguistico, pertenece a la familia Arahuaca, al igual que los Campa, Machiguenga y Amuesha, se ubica principalmente en las riberas del río Urubamba perteneciente al distrito de Echarate, Provincia de la Convención, Departamento del Cusco y el Distrito de Sepahua, Provincia de Atalaya, Departamento de Ucayali. La población estimada para este grupo es de 1600 habitantes (Wise, M.R. 1972 que se distribuye en 12 comunidades nativas, de las cuales la mitad están tituladas por el Estado peruano. Sobre este grupo existe regular bibliografía principalmente en lo referido a lingüística, relatos de viajeros y misioneros de diversas órdenes y en menor escala trabajos etnográficos y etno-históricos. En esta serie de artículos los autores pretenden una aproximación en detalle para profundizar el conocimiento que de esta etnia se tiene. Para ello utilizaremos los trabajos anteriores a los cuales sumaremos nuestras notas y apreciaciones recogidas durante cuatro años de trabajo en la zona. El primer artículo de L. Komán pretende explicar la relación entre lo ideológico y lo estético para lo cual se remite a la mitología y las manifestaciones estéticas del grupo piro. En el segundo artículo el mismo autor señala una transformación estructural en el sistema de parentesco piro durante el auge de la explotación del caucho, dando lugar a una variación del modelo original, que garantiza la reproducción biológica y cultural del grupo. El artículo final de V. de Szyzslo describe la forma cómo cada una de las familias de la comunidad pira de Miaría, en el Urubamba, dispone del espacio para la construcción de sus viviendas y locales comunales. Los tres artículos, por lo tanto son complementarios para obtener una visión en detalle de los aspectos ideológicos, socio-políticos y tecnológicos q u

  8. Detection of sdhB gene mutations in SDHI-resistant isolates of Botrytis cinerea using high resolution melting (HRM analysis

    Directory of Open Access Journals (Sweden)

    Anastasios Samaras

    2016-11-01

    Full Text Available Botrytis cinerea, is a high-risk pathogen for fungicide resistance development. Pathogen` resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM analysis for the identification of P225H/F/L//T, N230I and H272L/R/Y mutations. Based on the sequence of sdhB subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant`s DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the 4 mutations located at codon 225, the N230I mutation, the 3 mutations located in codon 272 and the non mutated isolates (isolates of wild type sensitivity. Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdhB mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate and rapid identification of several sdhB mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of antiresistance strategies implemented in

  9. Litoquímica, Geocronologia U-Pb e Geologia Isotópica (Sr-Nd-Pb das Rochas Graníticas dos Batólitos Cunhaporanga e Três Córregos na Porção Sul do Cinturão Ribeira, Estado do Paraná

    Directory of Open Access Journals (Sweden)

    Hélcio José dos Prazeres Filho

    2003-08-01

    Full Text Available Durante a evolução da porção sul do Cinturão Ribeira no Estado do Paraná, o Ciclo Brasiliano-Pan Africano foi responsávelpela geração de um grande volume de rochas graníticas com destaque para os batólitos Cunhaporanga (BCP e TrêsCórregos (BTC. Estudos litoquímicos e isotópicos revelaram a existência de tipos graníticos distintos entre dois batólitos einternamente aos mesmos, definidos por unidades graníticas. A principal diferença entre os dois batólitos está no comportamentodos álcalis com o BCP, a NW mais potássico e o BTC, a SE mais sódico. Os dados isotópicos mostram claramente aparticipação de fontes infracrustais distintas de longa residência crustal, evidenciadas pelos isótopos de Pb em K-feldspato,pelos valores negativos de eNd (–11 a –13 para o BCP e –17 a –19 para o BTC e pelas idades TDM (1,8 a 2,0 Ga para o BCPe 2,2 a 2,4 Ga para o BTC. Estas fontes estariam situadas em uma crosta continental paleoproterozóica com a participaçãode fontes mantélicas e supracrustais na gênese das rochas graníticas do BCP e BTC. A Unidade Ribeirão Butiá do BCP e asUnidades Arrieiros e Paina do BTC estão representadas predominantemente por monzogranitos e granodioritos e rarostonalitos, metaluminosos, cálcio-alcalinos de alto a médio K, formados entre 630 a 620 Ma em ambiente de margem continentalativa. As Unidades Piraí do Sul e Santa Rita do BCP são constituídas por monzogranitos fracamente peraluminosos, de altoK e as Unidades São Sebastião e Conceição do BTC são constituídas respectivamente por quartzo-monzonitos e monzo asienogranitos fracamente metaluminosos, de alto K. Estas unidades foram formadas em ambiente sin- a tardi-colisional entre620 e 590 Ma.

  10. Ocorrência de plantas aquáticas nos reservatórios da Light-RJ Ocurrence of aquatic plants in the Light-RJ reservoirs

    Directory of Open Access Journals (Sweden)

    D. Martins

    2003-01-01

    Full Text Available O objetivo do presente trabalho foi caracterizar as comunidades infestantes de plantas aquáticas presentes nos reservatórios da Light-Sistema de Eletricidade S.A., localizada no município de Piraí-RJ. Os levantamentos foram realizados no período de julho a setembro de 1998. Os reservatórios analisados foram: Vigário, Pereira Passos e Lajes, sendo as quantidades de pontos amostrados de 19, 9 e 15, respectivamente. Em cada ponto amostrado fez-se a marcação das coordenadas geográficas e avaliou-se a porcentagem de ocupação do corpo d'água pelas espécies de plantas aquáticas presentes. Depois da identificação das plantas, pôde-se verificar quais eram as espécies mais freqüentes e a sua distribuição dentro do sistema de geração de energia. As espécies encontradas nos reservatórios foram: Brachiaria arrecta (Hack. Stent.; Egeria densa Planch.; Eichhornia azurea (Sw. Kunth.; Eichhornia crassipes (Mart. Solms.; Hymenachne amplexicaulis (Rudge Nees.; Panicum rivulare Trin.; Pistia stratiotis L.; Polygonum spp.; Sagitaria montevidensis Cham. & Schlecht; Salvinia auriculata (Micheli Adans; e Thypha dominguensis L.This study aimed to describe the aquatic weeds infesting the Light-Electric System S.A. reservoirs, located in Pirai-RJ, Brazil. The survey was carried out from July to September 1998. The reservoirs analyzed were: Vigario, Pereira Passos and Lajes, with 19, 9 and 15 points being sampled, respectively. Sampled geographic coordinates were marked in each point and a visual estimate was made of the percentage of river water occupied by the aquatic plants. After plant identification, the most frequent species and their distribution were determined as follows: Brachiaria arrecta (Hack. Stent.; Egeria densa Planch.; Eichhornia azurea (Sw. Kunth.; Eichhornia crassipes (Mart. Solms.; Hymenachne amplexicaulis (Rudge Nees.; Panicum rivulare Trin.; Pistia stratiotis L.; Polygonum spp.; Sagitaria montevidensis Cham.& Schlecht

  11. Diverse Early Life-History Strategies in Migratory Amazonian Catfish: Implications for Conservation and Management.

    Directory of Open Access Journals (Sweden)

    Jens C Hegg

    Full Text Available Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii, Piramutaba (Brachyplatystoma vaillantii, and Piraíba (Brachyplatystoma filamentosum. We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87Sr/(86Sr recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87Sr/(86Sr isotope values using a regression-based approach that related

  12. Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010

    Energy Technology Data Exchange (ETDEWEB)

    Scheinost, Andreas C.; Baehtz, Carsten (eds.)

    2011-07-01

    be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.

  13. Remoção mecânica de plantas aquáticas: análise econômica e operacional Mechanical removal of aquatic weeds: operational and economic analysis

    Directory of Open Access Journals (Sweden)

    U.R. Antuniassi

    2002-01-01

    Full Text Available A remoção de plantas aquáticas tem sido utilizada como opção ao controle químico e biológico, em razão de restrições ambientais em algumas regiões brasileiras. O objetivo deste trabalho foi desenvolver um modelo para análise econômica e operacional da remoção mecânica de plantas aquáticas, visando realizar estudo econômico comparativo com o controle químico. A operação foi estudada num reservatório de uma usina de bombeamento em Barra do Piraí-RJ. O sistema consiste de retroescavadeiras instaladas em balsas, usadas para cortar as plantas e liberá-las no fluxo de água. Antes da tomada d'água existe uma barreira flutuante que intercepta as plantas, as quais são removidas por um guindaste fixo nas margens. As plantas são armazenadas por algum tempo e depois descartadas. Existe, ainda, um sistema de limpeza das grades da tomada d'água. Dados do volume total de plantas descartadas foram coletados durante 14 meses, assim como foi avaliado o volume de biomassa produzido por área das principais espécies infestantes. A empreiteira que administra o serviço forneceu planilhas de custos e outro parâmetros operacionais. Um modelo foi desenvolvido para calcular custos por hectare de plantas removidas. Os resultados mostraram custo médio mensal de US$ 17.780,28 por hectare. Apesar do alto custo, o sistema de remoção demonstrou capacidade de controlar apenas 4,1% da área infestada no reservatório, na época da coleta dos dados. Simulando dados de uma aplicação de glyphosate, o controle químico custaria apenas 0,23% do custo da remoção. Análises de sensibilidade mostraram que a compactação das plantas para transporte, o volume de plantas produzidas por área e o custo do transporte são os parâmetros principais para a otimização.Mechanical removal of aquatic weeds has been an option to biological and chemical control because of environmental restrictions in some places in Brazil. The objective of this study was to

  14. ANÁLISE SOBRE A INFLUÊNCIA DE GÊNERO NA DISTINÇÃO DOS JULGAMENTOS DE CRIMES PASSIONAIS

    Directory of Open Access Journals (Sweden)

    VASCONCELOS, R. C.

    2015-12-01

    Full Text Available O crime passional pode ser compreendido como aquele motivado por sentimentos amorosos, sendo justificado por situações diversas como ciúme, defesa da honra, sentimento de posse, entre outros. Os crimes passionais constituem uma categoria particular de delito, sendo caracterizados como aqueles crimes que envolvem uma relação amorosa real ou imaginária entre duas pessoas e que ocorrem a partir de sentimentos de abandono, rejeição ou ciúmes. Sob a justificativa da paixão, tal crime é cometido frequentemente de forma cruel, violenta e atingindo o suposto objeto de amor ou, também, alguém que lhe é muito caro – especialmente os filhos. “Os homicidas passionais trazem em si uma vontade insana de autoafirmação. Ele quer acima de tudo, mostrar-se no comando do relacionamento e causar sofrimento a outrem. Sua história de amor é egocêntrica” (Eluf, p.157, 2009. O presente trabalho busca fazer um paralelo entre o histórico dos julgamentos de crimes passionais ocorridos no Brasil em diferentes épocas: o caso da Fera da Penha, o assassinato de Ângela Diniz e os recentes casos da Fera de Barra do Piraí e o assassinato da funkeira Amanda Bueno, estabelecendo a comparação das diferentes concepções atribuídas aos criminosos a partir de seu gênero – masculino ou feminino. Metodologia utilizada envolve uma revisão de literatura. Segundo a ONU, no mínimo 5 mil mulheres são mortas por ano em nome da honra, e, apesar da escassez de dados contabilizados no Brasil, a cada 10 crimes de natureza passional, em média, 7 são cometidos contra mulheres. Esta diferença possivelmente está relacionada a posição inferiorizada em que a mulher ainda é colocada socialmente, como se fosse seu papel aceitar possíveis traições e rejeições em suas relações amorosas de forma natural, diferente do ocorre quando o homem é aquele que sofre a rejeição. Não é esperado que a mulher se comporte de maneira independente, tampouco tenha

  15. Dinâmica da comunidade de macrófitas aquáticas no reservatório de Santana, RJ Dynamics of the aquatic macrophytecommunity in the Santana reservoir in Pirai-RJ

    Directory of Open Access Journals (Sweden)

    R.L.C.M. Pitelli

    2008-01-01

    Full Text Available Apesar da importância na dinâmica dos ecossistemas aquáticos, as macrófitas podem formar densas e extensas colonizações em corpos hídricos cujos equilíbrios ecológicos foram rompidos. Nessas condições, essas plantas promovem uma série de problemas que as tornam alvos de controle. Para elaboração de planos adequados de manejo dessa vegetação, é fundamental o conhecimento das dinâmicas relativas das populações que a compõem. O objetivo deste trabalho foi realizar levantamentos mensais da composição específica da comunidade de macrófitas que coloniza o reservatório de Santana, localizado no município de Piraí/RJ, monitorando 97 pontos georreferenciados, abrangendo toda a lâmina d'água. Foram identificadas 41 espécies, inseridas em 21 famílias botânicas. As famílias Poaceae, Pontederiaceae e Cyperacae foram as que apresentaram os maiores números de espécies ao longo do ano. Salvinia herzogii e Egeria densa apresentaram as maiores notas anuais de colonização do reservatório. As populações de Eichhornia azurea, Brachiaria arrecta e Paspalum repens completaram o grupo das espécies numericamente mais relevantes. As plantas de hábito flutuante tenderam a apresentar populações com padrão de distribuição geográfica casualizado, enquanto as espécies fixadas no sedimento e as submersas apresentaram populações com padrão agregado. Não houve expressivas variações mensais dos valores dos índices de diversidade (H' e de equitabilidade (E' das comunidades de macrófitas aquáticas ao longo do ano. O dendrograma construído com o coeficiente de Odum mostrou uma seqüência lógica dos meses, evidenciando uma definida sucessão de populações divididas em dois grupos de similaridade separados pelo mês de junho. Nessa época, o nível de água do reservatório foi reduzido e o sedimento ficou exposto, favorecendo as espécies de hábito emergente.Despite the importance of aquatic ecosystem dynamics, aquatic

  16. LA ACCIÓN Y EL ENFOQUE PSICOSOCIAL DE LA INTERVENCIÓN EN CONTEXTOS SOCIALES: ¿PODEMOS PASAR DE LA MODA A LA PRECISIÓN TEÓRICA, EPISTEMOLÓGICA Y METODOLÓGICA?. THE ACTION AND THE PSYCHOSOCIAL APPROACH OF THE INTERVENTION IN SOCIAL CONTEXTS: CAN WE MOVE FROM THE FASHION TO THE THEORETICAL, EPISTEMOLOGICAL, AND METHODOLOGICAL PRECISION?.

    Directory of Open Access Journals (Sweden)

    Juan David Villa Gómez

    2012-12-01

    Full Text Available El siguiente artículo derivado de investigación, se plantea la pregunta en torno a una realidad que viene creciendo en Colombia: el incremento de los proyectos de intervención psicosocial en diversos sectores sociales, especialmente con víctimas del conflicto armado, violencia social, violencia de género e intrafamiliar, entre otras; además de población en situación de pobreza extrema, desplazamiento forzado y víctimas de catástrofes naturales. En relación con esta lógica de intervención y de acción, la reflexión académica aún sigue siendo escasa, poco clara y repetitiva de concepciones y disquisiciones internas de las disciplinas sociales, especialmente de la psicología. Por lo tanto, desde la experiencia de trabajo, desde la propia investigación y desde los procesos de acompañamiento psicosocial desarrollados por cerca de 15 años, el autor presenta una propuesta de reflexión, que implica una mirada desde el pensamiento crítico social y una postura que permita darle un marco a la acción psicosocial en una perspectiva emancipatoria.The following article, derived from research, poses the question about a growing issue in Colombia: the increase in projects of psychosocial intervention in diverse social sectors, particularly with victims of the armed conflict, social violence, violence of gender and family, etc., as well as population in a situation of extreme poverty, forced displacement and victims of natural disasters. In relation to this logic of intervention and action, the academic reflection tends to be scarce, unclear and repetitive of concepts and internal disquisitions of the social disciplines, especially of psychology. Therefore, from the work experience, from the research itself and from the processes of psychosocial accompaniment for about 15 years, the author presents a reflective proposal, which implies a look from the social critical thought and a stance that allows to give a framework for the psychosocial

  17. Tuberculosis cutánea por inoculación accidental Cutaneous tuberculosis accidental inoculation

    Directory of Open Access Journals (Sweden)

    María Ascensión Maestre Naranjo

    2009-09-01

    Full Text Available Caso clínico de una microbióloga con amplia experiencia, que sufre una inoculación accidental al manipular una cepa pura de Mycobacterium tuberculosis. Se pincha en la cara lateral externa de la falange distal del dedo índice, atravesando el guante con la aguja contaminada. (Imagen 1. La trabajadora procede de forma inmediata a la limpieza de la herida. El Servicio de Prevención, registra la inoculación como accidente de trabajo. A las tres semanas del accidente, aparece en el lugar de la inoculación una pápula eritematosa levemente dolorosa a la presión que va creciendo hasta alcanzar un tamaño de 1,5-2 cm., sin adenopatías axilares, ni clínica general. (Imagen 2 Se procede a la exéresis y biopsia de la lesión. Informe anatomopatológico: Inflamación crónica granulomatosa tuberculoide muy sugestiva de tuberculosis cutánea. Microbiología: dudosos bacilos ácido alcohol resistentes (BAAR Cultivo: positivo a Mycobacterium tuberculosis. Ambas cepas presentan la misma identidad. Diagnóstico: tuberculosis cutánea. El SPRL realiza la comunicación de Enfermedad Profesional según el RD 1299/2006, de 10 de diciembre. Se realiza valoración y seguimiento en el Servicio de Medicina Interna, iniciando tratamiento de tuberculosis.Clinical case of a microbiologist with wide experience, which is inoculated accidental when Mycobacterium's pure strain manipulates tuberculosis; it (she pricks itself in the lateral external face of the phalanx distal of the forefinger, crossing the glove with the contaminated needle. Immediate treatment of the wound. The Service of Prevention, he registers the inoculation as accident of work. To three weeks a slightly painful pápula eritematosa appears in the place of the inoculation to the pressure that is growing until a size reaches 1,5-2 cm., without adenopatías axyllaris, not general clinic. Exéresis and biopsy of the same one, pathological anatomy: chronic inflammation very suggestive granulomatosa

  18. Construcción sostenible y madera: realidades, mitos y oportunidades

    Directory of Open Access Journals (Sweden)

    Rolando Fournier Zepeda

    2008-04-01

    Full Text Available La construcción biológica sostenible se basa en el estudio de las interrelaciones entre el ser humano, el ambiente construido y su entorno. Es una filosofía de construcción que busca edificar espacios saludables, mejorar la calidad de vida, preservar la especie humana y el ambiente, conceptualizando la vivienda como nuestra tercera piel.La bioarquitectura tiene como propósito promover el estudio de materiales, elementos, componentes de construcción, viviendas y edificios que propicien el desarrollo, mejoramiento y uso de materiales compatibles con la vida, frente a otros que no lo son tanto.El avance de la tecnología y la versatilidad de los materiales, especialmente de la gama de plásticos, concreto y acero, ha hecho posible que los sistemas de construcción hayan variado mucho en pocas décadas.La disminución del uso de la madera no ha sido ajena a este hecho. Se ha olvidado casipor completo el conocimiento tradicional acerca de su uso, dando por consecuenciasu desprestigio.La madera es el material más noble, renovable, sano, sostenible, estético y confortable de la construcción. Prácticamente todas las culturas de la humanidad la han empleado en sus obrasconstructivas. En la medida en que la sensibilidad proteccionista de los bosques autóctonos y en especial, de los tropicales, vaya creciendo, también la industria de la madera irá tomando el tren de la tecnología, adaptándose a los nuevos tiempos. El conocimiento de la madera y el desarrollo de su tecnología en los aspectos de plantación, secado, técnicas de tratamiento y transformación permitirán garantizar el éxito de su utilización en el Sector de la Construcción, lo que la convertirá a corto plazo en el material del futuro. La madera es un material paradigmático en cuanto a su adecuación a los objetivos del respeto al medio ambiente.

  19. Macroeconomíc aspects of the development plan Aspectos macroeconómicos del plan de desarrollo

    Directory of Open Access Journals (Sweden)

    Lorente Luis

    1999-06-01

    Full Text Available Shortly after the economic opening, the economy began a cycle of rapid growth and accumulation of deficits, followed by another stage of monetary correctives which brake growth, but don't eliminate the causes of the disequilibrium. The Development Plan reduces the fiscal deficit and it is probable that the next expansion phase will last three years, instead of the barely one year that the previous expansion lasted. But the current account deficit of the balance of payments persists, and willgrow when privatizations slow down toward the third year of the Plan. The country needs outside capital to sustain its growth and modernize its production; thus private debt and foreign investment will continue togrow, along with foreign debt servicing and the repatriation of the profits of capital. Reducing the trade deficit to almost zero by 2002 is not enough; a surplus must be generated, that is, in addition to increasing exports we must substitute imports, but without the simplistic protectionism of the pasto instead of high tariffs, sources of risk capital must be created which are willing to finance new firms, technological innovations, and production of goods with sufficient quality and pricesto substitute for a good part of what we now import.Poco despues de la apertura, la economia inicio un ciclo de crecimiento rapido y acumulacion de deficits, seguido por otra etapa de correctivos monetarios que frenan el crecimiento, pero que no eliminan las causas del desequilibrio. El plan de desarrollo reduce el deficit fiscal y es probable que la proxima fase de expansion dure tres años, en lugar del año escaso que duro el anterior. Pero subsiste el deficit de cuenta corriente de balanza de pagos, que crecera cuando bajen las privatizaciones hacia el tercer año del plan. El pais necesita del capital externo para sostener su crecimiento y modernizar su produccion, asi que seguiran creciendo la deuda privada y la inversion extranjera y, con ellas, el

  20. Effect of citric acid and the hemihydrate amount on the properties of a calcium sulphoaluminate cement

    Directory of Open Access Journals (Sweden)

    Velazco, G.

    2014-12-01

    Full Text Available The influence of citric acid on the hydration and strength development of a calcium sulphoaluminate cement was investigated. Cement pastes were prepared by mixing calcium sulphoaluminate (C4A3Ŝ with 15, 20 and 25wt% of hemihydrate (CŜH0.5. Citric acid was added as a retarder at 0 and 0.5wt%. The samples were cured at 20 °C for periods of time from 1 to 28 days to evaluate their compressive strength and to characterize the hydration products by scanning electron microscopy and X-ray diffraction. Calorimetric curves showed that the retarding agent considerably decreases the heat release rate and the quantity of total heat released. The main product after the curing was ettringite (C6AŜ3H32. The morphology of this phase consisted of long and thin needles growing radially on the cement grains. Samples with 15wt% of hemihydrate and 0.5wt% of citric acid developed the highest compressive strength (70 MPa at 28 days of curing.Se investigó el efecto del ácido cítrico sobre la hidratación y propiedades mecánicas de un cemento de sulfoaluminato de calcio. El C4A3Ŝ se mezcló con 15, 20 y 25% e.p. de hemihidrato (CŜH0.5. Se agregó ácido cítrico como retardante en 0 y 0.5% e.p. Las muestras fueron curadas a 20 °C por periodos de 1 a 28 días para realizar mediciones de resistencia a la compresión y caracterizar los productos de hidratación mediante microscopía electrónica de barrido y difracción de rayos X. Las curvas de calorimetría mostraron ue el ácido cítrico disminuye la velocidad de liberación de calor y la cantidad de calor liberado durante la hidratación. La resistencia a la compresión alcanzó un máximo de 70 MPa en muestras con 15% e.p. de hemihidrato y 0,5% e.p de ácido cítrico. Los resultados muestran a la etringita (C6AŜ3H32 como principal producto de hidratación. Se observa a esta fase con morfología acicular creciendo sobre las partículas de cemento.

  1. Hacia las unidades de bibliometría en las universidades: modelo y funciones

    Directory of Open Access Journals (Sweden)

    Jiménez-Contreras, Evaristo

    2012-09-01

    Full Text Available In recent years, bibliometric indicators have been firmly established as a tool for research management and decision-making in the context of scientific policy. Spanish universities represent one sector that has seen signifi cant growth in the use of indicators. These institutions now find themselves in an ever more competitive environment and therefore have a greater need to have knowledge of the performance of their researchers. Against this background, this paper presents a proposal for the creation of Bibliometric Units in Spanish universities and attempts specifically to illustrate both the model and functions of these units based on three pillars: control of information sources related to research, preparing reports, and advice/training. In addition to the theoretical proposal we present different examples from the universities of Navarra and Granada. The text concludes that such units could represent an important opportunity for jobs in the fi eld of Information Science.

    En los últimos años la bibliometría evaluativa se han consolidado firmemente como herramienta en la gestión de la investigación y toma de decisiones en el ámbito de la política científica. Una de las instituciones donde más está creciendo este uso es en las universidades españolas que cada vez se encuentran en un entorno más competitivo y tienen una mayor necesidad de conocer el rendimiento de sus investigadores. Teniendo en cuenta este contexto en el presente trabajo se expone una propuesta para la creación de unidades de bibliometría en las universidades españolas. El objetivo específico es, por tanto, ilustrar el modelo y funciones de dichas unidades que han de basarse en tres pilares fundamentales: control de las fuentes de la información, realización de informes y asesoramiento y formación. Además de la propuesta teórica se presentan diferentes ejemplos llevados a cabo en las Universidades de Navarra y Granada. El texto concluye subrayando

  2. The quality of democracy in Paraguay: progress on winding roads La calidad de la democracia paraguaya: un avance sobre caminos tortuosos

    Directory of Open Access Journals (Sweden)

    Mikel BARREDA

    2011-03-01

    Full Text Available Within the framework of growing concern for analyzing the quality of young democracies, this article focuses on the Paraguayan case. A democracy sometimes neglected by the academic literature. However, Paraguay is drawing attention as a consequence of Colorado’s Party defeat (in office since 1947 in the 2008 presidential election. A theoretical and methodological thinking about the concept of the quality of democracy together with an empirical research have been done in this article. Five essential dimensions have been taken into consideration: political rights and civil liberties; rule of law; accountability; responsiveness and political participation. The main conclusion is that Paraguay has a low quality democracy, far away from the rest of Latin American countries. This statement is backed up by three different explanations that are, at the same time, interlinked. These are the following: socioeconomic factors, features of its own political institutions (above all, the widespread clientelism and, finally, political parties’ interests and strategies.En el marco de una preocupación cada vez mayor por analizar la calidad de las nuevas democracias, este artículo se ocupa de examinar el caso de Paraguay. Se trata de una democracia poco atendida en la literatura especializada aunque su interés está creciendo como consecuencia de la derrota electoral del Partido Colorado (en el poder desde 1947 en las presidenciales de abril de 2008. Para llevar a cabo este trabajo, se parte de una reflexión teórica y metodológica en torno a la noción y la medición empírica de la calidad democrática. Al realizar el análisis de la democracia paraguaya se atiende a cinco dimensiones fundamentales: derechos políticos y libertades civiles, Estado de Derecho, rendición de cuentas, responsiveness y participación. La conclusión general es que es una democracia de baja calidad, distanciada del promedio latinoamericano. Para explicar este bajo nivel de

  3. Arbuscular Mycorrhizae-Trichoderma harzianum (Moniliaceae Interaction and Effects on Brachiaria decumbens (Poaceae’s Growth Interacción micorrizas arbusculares-Trichoderma harzianum (Moniliaceae y efectos sobre el crecimiento de Brachiaria decumbens (Poaceae

    Directory of Open Access Journals (Sweden)

    Morales Gutiérrez Esperanza

    2006-06-01

    Full Text Available The laboratory trial was made using native's Arbuscular Mycorrhizal Fungi (AMF sampled in Pennisetum clandestinum's rhizospheric soil obtained from Universidad Nacional de Colombia (Bogotá. Brachiaria decumbens was used as the host plant, growing in draining pots of steamed sandy soil supplemented with a complete nutritive solution.Four different treatments were tested to determine the kind of interaction between Arbuscular Mycorrhizal Fungi and Trichoderma harzianum and the effect of AMF plus T. harzianum on B. decumbens growth: plants with AMF inoculum, plants with T. harzianum, plants with AMF plus T. harzianum and uninoculated controls. Root colonization was decreased by T. harzianum, although AMF spores/g dry soil quantity was unaffected by this fungi. On the other hand, T. harzianum's population level (CFU /g dry soil decreased in presence of AMF. These results shows an interaction between AMF and T. harzianum and this interaction affects as AMF development as population density of T. harzianum. Based in the values of the plant growth parameters studied, is possible to conclude the AMF-T. harzianum interaction has a neutral effect on B. decumbens's growth.Se efectuó un ensayo en condiciones controladas utilizando hongos formadores de micorrizas arbusculares (HFMA nativos, provenientes de un suelo rizosférico de Pennisetum clandestinum de la Universidad Nacional de Colombia (Bogotá, manteniéndolos en plantas de Brachiaria decumbens creciendo sobre sustrato arenoso suplementado con solución nutritiva. Se evaluaron diferentes tratamientos: plantas con inóculo de HFMA, plantas con Trichoderma harzianum, plantas con HFMA+T. harzianum y plantas control no inoculadas, con el fin de determinar las posibles interacciones entre dichos microorganismos, así como su efecto sobre el crecimiento de B. decumbens. La presencia de T. harzianum disminuyó la colonización radicular por HFMA, aunque no afectó la cantidad de esporas de HFMA/g suelo

  4. Comparación de algoritmos basados en la criptografía simétrica DES, AES y 3DES

    Directory of Open Access Journals (Sweden)

    Yuri Tatiana Medina Vargas

    2015-12-01

    Full Text Available RESUMEN La seguridad es uno los aspectos más desafiantes de la internet y las aplicaciones de red. Las cuales están creciendo muy rápido, por lo que la importancia y el valor de los datos intercambiados a través de Internet u otros tipos de medios están aumentando. De ahí la búsqueda de la mejor solución para ofrecer la protección necesaria contra ataques de intrusos a nuestros datos, junto con la prestación de estos servicios en el tiempo es uno de los temas más interesantes en las comunidades relacionadas con la seguridad. La criptografía es la una de las principales categorías de la seguridad informática que convierte la información de su forma normal en un formato ilegible. Las dos características principales que identifican y diferencian algoritmo de cifrado uno de otro son su capacidad para asegurar los datos protegidos contra ataques y su velocidad y eficiencia en hacerlo. Este artículo ofrece una comparación equitativa de tres algoritmos de criptografía de clave simétrica más comunes: DES, AES y 3DES. ABSTRACT Security is one of the most challenging aspects of the internet and network applications. Which are growing very quickly, so that the importance and value of the data exchanged via the Internet or other media types are increasing. Hence the search for the best solution to provide the necessary protection against attacks by intruders to our data, together with the provision of these services in the time it is one of the most interesting topics in the communities related to security. Cryptography is the one of the major categories of computer security that converts the information from its normal form in an unreadable format the two main characteristics that identify and differentiat encryption algorithm from one another are its ability to ensure the data protected against attacks and their speed and efficiency to do so. This article provides a fair comparison of three algorithms for symmetric key cryptography

  5. Consumo ilimitado, eficiencia y desigualdad urbana. Definición socioecológica del consumo urbano desde las perspectivas del marxismo y el metabolismo

    Directory of Open Access Journals (Sweden)

    Rubén Miguel Águeda

    2015-12-01

    Full Text Available Resumen Las mejoras en la eficiencia de los sistemas urbanos pueden resultar insuficientes en la búsqueda de una ciudad más respetuosa con el medio natural si el consumo en el interior de las ciudades sigue creciendo sin control y, especialmente, si este incremento no es consecuencia directa del comportamiento de los consumidores. Para explicar cómo la estructura de la ciudad interviene en el consumo se recurre a dos formas diferentes de entender el espacio urbano. Por un lado el estudio del metabolismo urbano cuantifica los componentes que intervienen en el consumo, por otro, las interpretaciones marxistas de la ciudad tratan de explicar las estructuras sociales, políticas y económicas que lo condicionan. El resultado es una teoría conjunta que permite interpretar todos los fenómenos y actividades que engloba el término consumo, aglutinando tanto la dimensión ecológica de éste como los aspectos sociales y políticos que intervienen en el mismo. Palabras clave Estructura urbana, sostenibilidad, flujos de circulación, escasez, desequilibrios sociales y ambientales Abstract Improving the efficiency of urban systems may prove insufficient in the pursuit of a friendlier city with the environment if consumption within cities continues growing out of control and, in particular, if this increase is not a direct consequence of consumers’ behavior. For explaining how the structure of the city intervenes in consumption we can use two different ways of understanding urban space. On one hand urban metabolism quantifies the components involved in consumption, on the other Marxist interpretations of the city try to explain the social, political and economic structures that condition it. The result is a joint theory that allow us to interpret every phenomenon and activity within the term consumption and that bring together both ecological, political and social dimensions involved. Keywords Urban structure, sustainability, circulation fluxes

  6. ANÁLISIS DE LA PRODUCCIÓN CIENTÍFICA EN BALONMANO EN LAS REVISTAS DE LA WEB OF SCIENCE [Analysis of scientific production in handball in journals of web of science

    Directory of Open Access Journals (Sweden)

    Óscar Gutiérrez Aguilar

    2014-10-01

    Full Text Available ResumenEl objetivo de esta investigación fue analizar las contribuciones científicas cuyo objeto de estudio era el balonmano publicadas en revistas indexadas en la Web of Science. La búsqueda se realizó durante el mes de mayo de 2014. Las variables analizadas fueron: a Año de publicación; b Área de investigación; c Categorías de Web Science; d Revista dónde se publica; e Países de origen de los autores; y f Instituciones a las que pertenece al autor. Se recogieron 366 artículos. La producción en balonmano ha ido creciendo anualmente. España es el país que más aportaciones realiza, sitúa a dos Universidades nacionales entre las más productivas y una revista de edición española está entre la que más artículos ha publicado. La orientación de las revistas que más publican está diversificada, existiendo publicaciones con un carácter médico y otras más específicas en deporte.AbstractThe aim of this research was to analyze the scientific contributions whose subject of study was handball and which were published in journals index-linked in Web of Science. The search was conducted in May 2014. The variables analyzed were: a year of publication; b research area; c Web Science categories; d Journal in which it is published; e authors' country of origin; and f Institutions to which the authors belong. 366 articles were compiled. The handball research publication has been growing yearly. Spain is the country which contributes the most and two of their universities are among the most productive ones. A Spanish journal is among the ones which have published most of the articles. The standpoint of the journals which publish the most is diversified: there are journals that have a medical approach and others that are more sport-focused.

  7. La Teoría Fundamentada: un estudio bibliométrico de la enfermería brasileña The Grounded Theory: a bibliometric study of Brasilian nursing

    Directory of Open Access Journals (Sweden)

    Gabriela Marcellino de Melo Lanzoni

    2011-09-01

    Full Text Available El objetivo fue identificar las disertaciones y tesis en enfermería brasileña que usaron el método Teoría Fundamentada en Dados (TFD. Estudio bibliométrico de tesis y disertaciones de enfermería defendidas hasta 2009, disponible en: Banco de las tesis de la Coordinación de Perfeccionamiento de la Educación Superior, Colección de la Asociación Brasileña de Enfermería, Biblioteca Digital Brasileña de Tesis y Disertaciones y sitios institucionales. Para la búsqueda de los datos se utilizaron las palabras clave: "Grounded Theory" y "Teoría fundamentada" de forma individual junto a la "Enfermería". Se encontraron 124 estudios, 63 de maestría y 61 de doctorado, provenientes principalmente del sur y sureste del Brasil. El referencial teórico utilizado predominantemente fue el Interaccionismo Simbólico (71,77%. El uso de la TFD en las tesis y disertaciones de enfermería está creciendo y se demuestra que se puede aplicar en el nivel stricto senso de la formación para la elaboración de constructos teóricos.The aim of this study was to identify brazilian nursing dissertations and theses who used the methodological Grounded Theory (GT. The metodology used was bibliometric study of nursing theses and dissertations defended until 2009, available on theses database of the Coordination of Improvement of Higher Education (CAPES, the achievements of the Brazilian Nursing Association (CEPEn, the Brazilian Digital Library of Theses and Dissertations (BDTD and institutional sites. For search of the data we used the keywords: "Grounded Theory" and "Grounded Theory" coupled individually to "Nursing". We found 124 studies, 63 (50,81% of masters and 61 (49,19% of doctors, coming mainly from South and Southeast of Brazil. The theoretical framework used was predominantly Symbolic Interaction (71,77%. The use of PDT in theses and dissertations in nursing is growing and it is shown that can be applied at both levels of training in the strict sense

  8. El paciente geriátrico en urgencias The geriatric patient and emergency care

    Directory of Open Access Journals (Sweden)

    F.J. Martín-Sánchez

    2010-01-01

    Full Text Available La demanda en la atención urgente ha ido creciendo progresivamente en los últimos años y este incremento es más acusado en la población anciana. Teniendo en consideración que el paciente anciano requiere evaluaciones más complejas con una mayor realización de pruebas complementarias y consultas a otros especialistas, estancias más prolongadas en urgencias y mayor porcentaje de ingresos, el progresivo envejecimiento poblacional puede llegar a repercutir seriamente en la presión asistencial de los servicios de urgencias hospitalarios (SUH. El paciente anciano de alto riesgo es vital detectarlo antes de asignarle una ubicación definitiva. Para ello, es importante instaurar un cribado entre los pacientes ancianos que acuden a urgencias con el fin de seleccionar a los que se van a beneficiar de una valoración geriátrica integral y así poder diseñar un plan específico de cuidados. La intervención urgente en el paciente geriátrico no debe afrontarse exclusivamente como un problema médico sino que debe tenerse en cuenta aspectos funcionales, mentales o sociales. Representa un reto para los SUH. En el presente artículo vamos a desarrollar diversos aspectos como la detección y la valoración del paciente geriátrico así como a establecer ciertas recomendaciones para el entorno de urgencias.Demand in emergency care has been growing progressively in recent years and this increase is more pronounced in the elderly population. Taking into account that the elderly patient requires more complex evaluations with a greater requirement for complementary tests and consultations with other specialists, longer stays in the emergency ward and a greater percentage of admissions, the progressive ageing of the population might come to have a serious repercussion on hospital emergency departments. It is vital to detect high risk elderly patients before assigning them a definitive placement. For this purpose it is important to install a sieving

  9. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos Women and research in educational technology. Analysis of its presence in the author of scientific papers

    Directory of Open Access Journals (Sweden)

    Julio CABERO ALMENARA

    2011-07-01

    Full Text Available La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previamente elaborado y validado por expertos relacionados con las Tecnologías de la Información y la Comunicación y Metodología de Investigación. Con él, fueron codificados la totalidad de los artículos publicados. Realizándose a continuación un análisis descriptivo: univariante y relacional. Los principales resultados indican una constante presencia femenina en la autoría de los artículos, que abordan formatos de publicación tanto de reflexión como de investigación. Destacando el porcentaje de artículos de investigación realizados sobre la Aplicación de las TIC en la Universidad, encontrándose a continuación la formación del profesorado y la teleformación/e-learning.The role of women in the academic field of Technology has gradually increased in the last decades. Proof of this argument is the publication of research and theoretical work carried out by women. This paper acknowledges the presence of women in published papers in the journal Píxel-Bit, Revista de Medios de Comunicación, throughout its 38 numbers. To this aim, we have employed a categorical system, previously designed and validated by experts in ICT and Research Methodology. This system was used to encode the already published papers. Then, we conducted a descriptive analysis: monovariant and relational. The analysis of results shows a constant presence of female authors in reflection and research papers. We have also found out that there is a high percentage of

  10. Enfrentando la ausencia de los padres: recursos psicosociales y construcción de bienestar

    Directory of Open Access Journals (Sweden)

    Diana Marcela Montoya Zuluaga

    2016-01-01

    Full Text Available De acuerdo con los resultados de la encuesta de Profamilia (2010 y del Mapa Mundial de la Familia (Trends, 2013 los niños y jóvenes están creciendo con la ausencia física de alguno de los padres y algunos, a pesar de la presencia física de ellos, experimentan sentimientos de ausencia, pues al parecer han cambiado las formas de acompañamiento. Se hace necesario indagar por los recursos alternativos a la familia con los que están contando las nuevas generaciones, con el fin de ofrecer otras posibilidades desde lo social, institucional, personal, familiar, comunitario, que permita la construcción de bienestar en las personas. El objetivo del presente artículo de revisión es mostrar las diferentes investigaciones de los últimos diez años relacionadas con recursos psicosociales, bienestar subjetivo y sentimientos de ausencia. La metodología utilizada fue el rastreo de fuentes bibliográficas producto de investigación y de revisión teórica. Los resultados revelan que las personas cuentan con instituciones, grupos, comunidades y recursos internos que les permiten construir un proyecto de vida que genere bienestar. Abstract According to the results found on the Profamilia survey (2010 and the World Family Map (Trends, 2013, children and young people are growing with the physical absence of either of their parents and some, in spite of their physical presence, experience feelings of absence, since it seems that forms of accompaniment have changed. It has become necessary to look into the resources, alternative to the family, new generations draw on, so that social, institutional, personal, family, and community options are available for the building of well-being among people. The purpose of the present revision paper is to show different studies carried out in the last ten years, which are related to psychosocial resources, subjective well-being and feelings of absence. The methodology used was the tracking of bibliographical references

  11. Desarrollo foliar y caulinar de las unidades de alargamiento de Nothofagus dombeyi (Nothofagaceae en condiciones de alta y baja luminosidad Leaf and stem development in extension units of Nothofagus dombeyi (Nothofagaceae under high and low light conditions

    Directory of Open Access Journals (Sweden)

    Cecilia Calabria

    2008-07-01

    Full Text Available Se analizaron el tamaño del tallo y las hojas que componen las unidades de alargamiento (UA del tronco, las ramas principales y las ramas cortas de ejemplares juveniles de Nothofagus dombeyi desarrollados en comunidades de áreas abiertas (bordes de camino y de sotobosque de Patagonia. Se evaluaron el área y la forma (ancho/longitud de las hojas a lo largo de las UA, el área foliar específica (AFE y las relaciones área foliar/volumen del tallo, longitud del tallo/peso del tallo y volumen del tallo/peso del tallo. Para igual posición en la UA, las hojas del tronco son mayores que las de las ramas principales y éstas mayores que las de las ramas cortas. En las UA del tronco el desarrollo caulinar es proporcionalmente mayor al de las hojas en comparación con las UA de las ramas principales y, en especial, de las ramas cortas. La restricción en el desarrollo caulinar y el aumento del AFE en ejemplares de N. dombeyi creciendo a la sombra permitiría su supervivencia pero con limitado desarrollo en altura y, en consecuencia, baja probabilidad de alcanzar el dosel.The size of stem and leaves was studied for trunk, main branch and short branch extension units (EU of young Nothofagus dombeyi trees growing in open areas (road verges and understory communities in Patagonia. The surface area and outline (width/length ratio of single leaves along EU, the specific leaf area, and the ratios leaf area/stem volume, stem length/stem mass and stem volume/stem mass were assessed. Trunk leaves were larger than main-branch leaves and main-branch leaves larger than short-branch leaves in similar positions on the EU. Stem developed proportionally more than leaves in trunk EU than in main-branch EU and, especially, short-branch EUs. Restrictions in stem development and increases in specific leaf area would allow N. dombeyi trees to survive under shaded conditions though limiting their height growth and, consequently, their chances to reach the canopy.

  12. Crecimiento de una ciudad dispersa: análisis y reflexiones del caso de la ciudad de Comodoro Rivadavia

    Directory of Open Access Journals (Sweden)

    Natalia Usach

    2015-04-01

    Full Text Available En diferentes contextos numerosas ciudades alrededor del mundo han experimentado, desde mediados del siglo pasado, nuevos patrones de crecimiento urbano. Bautizados estos fenómenos bajo distintas denominaciones, contraurbanización, desurbanización, difusión o dispersión urbana, han dado cuenta de un proceso de difusión poblacional por fuera de las áreas centrales tradicionales. En muchas ocasiones, las pautas de crecimiento urbano no sólo han consistido en la pérdida de población del área central y de algunas áreas suburbanas tradicionales; sino que han comportado incluso la disolución de la ciudad compacta tradicional por la ocupación discontinua del territorio.Estos fenómenos de crecimiento disperso no resultan novedosos para el caso de ciudades que, como Comodoro Rivadavia en la Patagonia argentina, han crecido históricamente a partir de la localización y consolidación de los asentamientos de trabajadores en torno a las extensas áreas de explotación petrolera a importantes distancias del casco central. En efecto, en esta ciudad puede reconocerse un territorio urbano disperso y fragmentado, atravesado por numerosos conflictos urbanísticos, sociales, económicos y ambientales; cuya impronta ha venido marcada por el devenir de la actividad extractiva.El presente trabajo tiene por objetivo analizar y caracterizar la dinámica reciente del crecimiento urbano en Comodoro Rivadavia. Nos preguntamos hacia dónde está creciendo la ciudad, cuáles son las zonas que evidencian un mayor dinamismo poblacional y cuáles son las características de este crecimiento en función no sólo a los cambios morfológicos sino también a las particularidades de la población implicada en este crecimiento.

  13. Gestión del conocimiento: mayor producción y competitividad. Perspectivas para los sistemas de producción ovino-caprinos

    Directory of Open Access Journals (Sweden)

    Óscar Ospina

    2011-12-01

    Full Text Available Los ovinos se presentan hoy día en Colombia como una de las especies promisorias para el sector pecuario, con un despertar en la actividad que se manifiesta con un incremento del inventario, que según Faostat (datos debatibles, ha pasado de 2’400.000 cabezas en el año 2000 a 3’400.000 para el 2008; por su lado, las cabras han pasado de 1’200.000 a 1’300.000 cabezas en el mismo periodo, creciendo, aunque con un ritmo menor que el de las ovejas. Según esta base de datos, la misma tendencia se observa en el consumo per cápita de carne ovino-caprina que partiendo de 270 g/persona/año para el 2000 llega a 370 g/persona/año para el 2008. Este crecimiento en el inventario y el consumo per cápita del ovino-caprino impulsa la necesidad de aprovechar no solo las ventajas comparativas, sino también la generación de ventajas competitivas que lleven a la ovino-cultura y la caprino-cultura colombiana por el camino de la competitividad y la globalización, aprovechando las oportunidades en el mercado nacional y de exportación. El eficaz aprovechamiento de dichas ventajas implica la incorporación de los datos, la información y el conocimiento como factores de producción dentro de un proceso ordenado, bajo el marco de un sistema de “gestión de conocimiento”. El presente documento trata los fundamentos teóricos sobre los cuales se discute la manera como los datos, la información y el conocimiento se transforman en productividad y competitividad; se tratan los temas del “Big-Bang”, la entropía y neguentropía, la complejidad, la teoría de sistemas, la teoría del conocimiento, la epistemología, el management, la economía del conocimiento, la planeación estratégica, la espiral del conocimiento en las organizaciones, y la gestión del conocimiento, procurando algunas aproximaciones al sector agropecuario y la contextualización de la gestión del conocimiento en la ovino-cultura y caprino-cultura colombiana.

  14. HÁBITOS ALIMENTARIOS DEL BARBUL DE PIEDRA (Ariopsis sp. EN EL RÍO SINÚ, COLOMBIA Feeding Habits of Barbul de Piedra (Ariopsis sp. in the Sinu River, Colombia

    Directory of Open Access Journals (Sweden)

    CHARLES W OLAYA-NIETO

    2012-04-01

    Full Text Available Se estudiaron los hábitos alimentarios del barbul de piedra en el río Sinú. El contenido estomacal se evaluó con el coeficiente de vacuidad, grado de digestión, frecuencia de ocurrencia, frecuencia numérica, gravimetría, índice de importancia relativa y relación longitud intestinal-longitud total. Solo 18,8% de los estómagos se encontró vacío, la mayoría de las presas estaban medio digeridas y se identificaron cinco grupos alimentarios: crustáceos, peces, material vegetal, moluscos y otros. Crustáceos fue el grupo más frecuente, abundante y con mayor composición en peso. El índice de importancia relativa indicó que crustáceos y peces son grupos de importancia relativa secundaria, mientras que restos vegetales, moluscos y otros fueron ocasionales o circunstanciales. Los resultados alcanzados en este trabajo muestran que el barbul de piedra es un pez que mantiene sus hábitos alimentarios a medida que va creciendo y a lo largo del ciclo hidrológico, aunque muestra preferencia carnívora, especialmente por los Crustáceos.The feeding habits of Barbul de piedra in the Sinu river were studied. The stomach content was analyzed using the proportion of empty stomachs, grade of digestion, frequency of occurrence, numerical frequency, gravimetry, relative importance index and the gut length-total length relationship. Only 18.8% of stomachs were empty, most of preys were half-digested and five food groups were identified: Crustaceans, fishes, vegetable rests, molluscs and others. Crustaceans were the most frequent, abundant and greater weight composition group. The relative importance index indicated that crustaceans and fishes were secondary relative importance groups and vegetable rests, molluscs and others were occasional or circumstantial groups. The results achieved in this work indicate that Barbul de piedra is a fish that keeps your feeding habits as they grow and along the hydrological cycle, although shows carnivorous

  15. Internet Use and the Political Knowledge Gap in Spain

    Directory of Open Access Journals (Sweden)

    Anduiza, Eva

    2012-04-01

    Full Text Available Media availability and fragmentation and the resulting possibilities of content selection have risen dramatically with the expansion of new digital media. Previous research has found that this may increase knowledge gaps among citizens with different resources and motivations. This article analyses how Internet use affects political knowledge gaps due to education and to political interest in Spain. As expected, frequent Internet users are more knowledgeable about politics than non-users. Furthermore, Internet use increases knowledge more for the highly educated than for citizens with lower levels of education. Thus, the political knowledge gap related to education seems to be growing with the introduction of new media. However, the knowledge gap between citizens with high and low levels of political interest is smaller for frequent Internet users than for non-users. These findings provide a complex picture and partially contradict the pessimistic theory about the impact of increasing media choice on political knowledge.

    La disponibilidad y fragmentación de medios de comunicación y las posibilidades de elegir contenidos han aumentado en gran medida a raíz de la expansión de los medios digitales. Éstos pueden, según investigaciones anteriores, incrementar las diferencias en los niveles de conocimiento entre ciudadanos con distintas características. En este artículo se analiza cómo el uso de Internet afecta a las diferencias en el conocimiento político según el nivel educativo y el interés por la política en España. Los usuarios frecuentes de Internet saben más sobre política que los no usuarios, como era de esperar. Además, el uso de Internet incrementa el conocimiento político de manera más intensa para los usuarios con niveles educativos más elevados. Por tanto, parece que las diferencias en los niveles de conocimiento pueden estar creciendo con la expansión de los medios digitales. Sin embargo, las diferencias

  16. Apps y gestión de marca ¿es indispensable ser mobile?

    Directory of Open Access Journals (Sweden)

    Zahaira González Romo

    2011-05-01

    Full Text Available La gestión estratégica de la marca a través de los medios de comunicación digital ha cobrado especial relevancia en los últimos años, y prácticamente todas las empresas que se aprecien de llevar una comunicación acorde a sus públicos han desarrollado herramientas y adaptado su comunicación de marca a los diferentes soportes, medios y entornos que han ido emergiendo, hasta el punto de que este proceso ha sufrido una metamorfosis que no todas las empresas consiguen asumir y entender. No sólo hablamos de un replanteamiento y adaptación a las nuevas tecnologías, sino una “nueva forma” de pensar las marcas y su repercusión e imagen en la mente de los consumidores. Tal es el caso de las aplicaciones para los smartphones, que se han desarrollado con una virulencia impresionante, aproximadamente 200.000 actualmente, y el número continúa creciendo. Este estudio pretende ser una primera aproximación a la aparición de las marcas en las aplicaciones para móviles, específicamente en las aplicaciones destinadas a iPhone.Gracias esta investigación sabemos que es indispensable tener en cuenta tres criterios básicos en el desarrollo de aplicaciones; el primero y más importante es que los anunciantes deben centrarse en el análisis de las necesidades de los usuarios, determinar sus objetivos, elaborar planes de integración y sobre todo preparar los medios de comunicación multicanal y de apoyo a la comercialización. Si la aplicación es correcta pero no funciona adecuadamente, deteriora la imagen de la marca de cara al cliente. En segundo lugar, la experiencia del usuario en las aplicaciones móviles debe ser complementaria y coherente con su experiencia a través de otros canales, es decir, debe mantenerse fiel a la marca y a la identidad de la empresa. Y el tercer criterio, es importante para la marca ir adaptándose a las nuevas tecnologías, pues una incorporación precaria y mal desarrollada puede ser más perjudicial que no el

  17. Detección de la expresión génica in vivo de Mycobacterium tuberculosis durante la tuberculosis pulmonar activa Mycobacterium tuberculosis in vivo-expressed genes detection during active pulmonary tuberculosis

    Directory of Open Access Journals (Sweden)

    Alejandra Otazo M

    2012-12-01

    Full Text Available El estudio de la expresión génica de Mycobacterium tuberculosis ha involucrado la experimentación "in vitro ", "ex vivo " e "in vivo " (modelos animales, pero aún sin el éxito esperado. Proponemos que revelar los factores clave de la tuberculosis humana requiere investigar la expresión génica de M. tuberculosis dentro del ser humano ("in vivo ". Para ello, aislamos el mRNA total de M. tuberculosis, desde muestras clínicas respiratorias de pacientes con diagnóstico de tuberculosis pulmonar; posteriormente, sintetizamos el dscDNA y lo analizamos mediante RT-PCR cualitativo. Detectamos la expresión de la secuencia de inserción IS6110 y de los genes "housekeeping " 16SrRNA y sigA en M. tuberculosis creciendo in vivo (tuberculosis pulmonar así como cultivado in vitro. La expresión de los genes mprA y mprB, que codifican el sistema de transducción de señales MprAB, sólo se detectó en M. tuberculosis crecido in vitro. Con nuestros resultados damos el primer paso hacia la implementación de un método no invasivo para el estudio del transcriptoma de M. tuberculosis, dentro de su único hospedero natural, con el fin de analizar la regulación "in vivo" de los determinantes genéticos requeridos para su virulencia y patogénesis.Mycobacterium tuberculosis gene expression studies have involved "in vitro", "ex vivo" and "in vivo" experiments (animal models, but without the expected success. We propose that key features of human tuberculosis could be discovered by studying the M. tuberculosis gene expression within the human host. Therefore, we isolated totalM. tuberculosis mRNA from human clinical respiratory specimens of patients diagnosed with pulmonary tuberculosis; after this, we synthesized the dscDNA and tested it by qualitative RT-PCR assays. We detected the expression of IS6110 insertion sequence and of the "housekeeping" genes 16SrRNA andsigA in M. tuberculosis grown in vivo (pulmonary tuberculosis as well as grown in vitro M

  18. Convertirse en madre durante la adolescencia: activación del rol materno en el control prenatal

    Directory of Open Access Journals (Sweden)

    Claudia Maria Moreno Mojica

    2015-07-01

    Full Text Available Introducción: Las adolescentes gestantes constituyen un grupo poblacional vulnerable,  con limitación en la construcción de la identidad personal frente a la materna e  imposibilidad de constitución  de una familia estable  que  afectan su calidad de vida y la del hijo por nacer. El objetivo del artículo es dar a conocer el alcance que tiene la aplicación de una estrategia de cuidado de enfermería que promovió el cuidado integral de la adolescente gestante en  la activación del rol materno durante el control prenatal. Materiales y Métodos: Este artículo es el resultado de la aplicación de una estrategia de cuidado de enfermería: programa de atención integral a la adolescente gestante durante el control prenatal, con base en la teoría de Mercer, y estructurado desde el marco lógico; la estrategia contó con la participación de diez adolescentes en gestación y el equipo interdisciplinario. Resultados: Adopción e implementación de la estrategia y apertura Institucional del centro de apoyo y cuidado para adolescentes gestantes “Creciendo Juntos”, que promovió el cuidado integral y permitió la activación del rol materno  durante el control prenatal. Discusión: El convertirse en madre adolescente, no se activa sin la influencia del cuidado estructurado brindado por enfermería quien lidera el equipo de salud, quienes permiten  a las gestantes, disminuir sus miedos, conocer y vivir el proceso de gestación y aprender las tareas para trascender hacia la activación del rol materno. Conclusiones: La Estrategia valida la visibilidad del cuidado sustentado en una teoría de enfermería, al dar respuesta a las necesidades humanas.Cómo citar este artículo: Moreno CM, Mesa NP, Pérez Z, Vargas DP. Convertirse en madre durante la adolescencia: activación del rol materno en el control prenatal. Rev Cuid. 2015; 6(2: 1041-53. http://dx.doi.org/10.15649/cuidarte.v6i2.162 

  19. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    Directory of Open Access Journals (Sweden)

    Oliva Marañón, Carlos

    2012-12-01

    Full Text Available En español: En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca “Universidad”. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institucional Audiovisual de las Universidades Públicas de la Comunidad de Madrid y verificar la idoneidad de YouTube como medio de comunicación de estas Instituciones. Oferta académica adaptada al Espacio Europeo de Educación Superior (EEES e instalaciones de vanguardia configuran las señas de identidad de estos centros. Los resultados confirman la consolidación de YouTube como canal audiovisual para la transmisión de los mensajes corporativos de estas Universidades a su público objetivo.In english: In recent years, marketing in Higher Education has been growing interest not only for its economic and commercial value but for its strategic and promotion, training and strengthening the brand communication "University". The platform YouTube has positioned itself as an audiovisual medium of reference in which the user decides what content you want to see, where and when. The objectives of this research are to analyze the audiovisual institutional advertising of the Public Universities of Madrid and verify the adequacy of YouTube as a communication from these Universities. Degrees adapted to the European Higher Education Area (EHEA and modern installations make up the identity of these Universities. The results confirm the consolidation of YouTube as a channel for transmitting audiovisual corporate messages of these Universities to their target audience.

  20. Boko Haram: análisis del fenómeno terrorista en Nigeria

    Directory of Open Access Journals (Sweden)

    Francisco Javier Torregrosa López

    2016-04-01

    á creciendo y mejorando sus recursos y estrategias, gracias a su relación con Daesh, para finalmente ser fagocitado por este como parte de un proceso de expansión territorial.

  1. Selected Abstracts of the 10th International Workshop on Neonatology; Cagliari (Italy; October 22-25, 2014

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2014-06-01

    (Italy ABS 9. Traffiking of thymosin beta-4 in the cellular compartments of HepG2 cells at different conditions • M. Piras, M. Piludu, G. Pichiri, P. Coni, T. Cabras, R. Ambu, M. Castagnola; Cagliari and Rome (Italy ABS 10. Thyroid carcinoma in sardinian children and adolescents is often associated with autoimmune thyroiditis • P. Coni, E. Tamponi, A. Lampis, G. Pinna, A.M. Nurchi, S. Farci, M.L. Lai; Cagliari (Italy ABS 11. Prolonging nephrogenesis in preterm infants: a new approach for the prevention of renal disease in adulthood? • A. Sanna, C. Gerosa, D. Fanni, P. Van Eyken, M. Castagnola, R. Ambu; Cagliari, Rome (Italy and Leuven (Belgium ABS 12. Human adrenal gland development: morphogenesis and molecular mechanisms • E. Obinu, V. Fanos, A. Dessì, R. Ambu; Cagliari (Italy ABS 13. Biometrics application for newborns safe identification in Neonatal Intensive Care Units • A. Casanova, S. Barra, M. De Marsico, D. Riccio, L. Barberini, M. Puddu, V. Fanos; Cagliari, Rome and Naples (Italy ABS 14. Metabolomics in neonatal hypoxic-ischemic encephalopathy (HIE: a proposal for a european multicenter study • P. Gancia, G. Pomero, A. Delogu, C. Dalmazzo, G. Palmas, V. Fanos; Cuneo and Cagliari (Italy ABS 15. Longitudinal evaluation of myocardial function in infants with Hypoxic-Ischemic Encephalopathy (HIE: preliminary data • F. Vitali, S. Galletti, A. Aceti, L. Ridolfi, G. Aquilano, M. Fabi, G. Faldella; Bologna (Italy ABS 16. Changes in podocyte number during intrauterine development • M. Desogus, A. Crobe, A. Sanna, C. Gerosa, C. Fanni, C. Loddo, M. Puddu, G. Ottonello, D. Fanni; Cagliari (Italy ABS 17. Efficacy of recombinant human erythropoietin in anemic pregnant women with heterozygous beta-thalassemia • S. Angioni, V. Mais, G.B. Melis; Cagliari (Italy ABS 18. WT1 expression in ontogenesis of human fetus • R. Ambu, L. Vinci, C. Gerosa, D. Fanni, E. Obinu, A. Faa, V. Fanos; Cagliari (Italy ABS 19. Brain hypothermia in perinatal arterial ischemic

  2. Variabilidad genética y morfológica y estructuración poblacional en Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endémica de Chile Genetic and morphological variation and population structure in Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endemic to Chile

    Directory of Open Access Journals (Sweden)

    EDUARDO RUIZ

    2010-12-01

    Full Text Available El género Alstroemeria es exclusivamente sudamericano y consta de 82 taxa distribuyéndose, principalmente en Chile y Brasil. La gran importancia económica que han adquirido las Alstroemerias chilenas como plantas ornamentales ha despertado gran interés en la variabilidad morfológica de las flores y variabilidad genética en especies con potencial valor económico. Una de ellas es Alstroemeria hookeri que posee cuatro subespecies, de las cuales, la subespecie tipo, es endémica de las regiones del Maule y Biobio. Su distribución geográfica consiste de dos rangos, separados por la Cordillera de la Costa. Así, existen poblaciones costeras, creciendo, entre los 5-20 m de altura en las provincias de Arauco, Concepción, Nuble y Cauquenes y poblaciones del interior creciendo entre los 100-150 m de altura, en las provincias de Biobio y Nuble. Evidencias preliminares señalan diferencias fenotípicas entre poblaciones costeras y del interior, relacionadas con el color y forma de los tépalos. Por esta razón, se realizó un estudio morfológico comparativo en el rango completo de distribución de esta subespecie y estudiar su genética poblacional, especialmente los niveles de estructuración poblacional. Se analizaron 33 caracteres florales, mediante métodos de ordenación. El estudio morfológico indica una tendencia a separar las poblaciones en dos grupos, coincidiendo con los extremos de la variación morfológica y con ambos rangos de distribución, existiendo caracteres que aportan a ello. Los índices de variabilidad genética fueron determinados usando 17 loci aloenzimáticos. Además, se estimaron los valores de estructuración poblacional y se realizó un análisis de AMOVA. Se estimaron valores de distancia genética de Nei, entre todos los pares de poblaciones para construir un dendrograma que refleje las relaciones de similitud genética. Los resultados indican altos valores de estructuración entre poblaciones y baja variabilidad

  3. New exposure ages for the Last Glacial Cycle in the Sanabria Lake region (northwestern Spain)

    Science.gov (United States)

    Rodríguez-Rodríguez, Laura; Jiménez-Sánchez, Montserrat; Domínguez-Cuesta, María Jose; Rinterknecht, Vincent; Pallàs, Raimon; Braucher, Régis; Bourlès, Didier; Valero-Garcés, Blas

    2013-04-01

    ., 2011. Last deglaciation in northwestern Spain: New chronological and geomorphologic evidence from the Sanabria region. Geomorphology 135, 48-65. Palacios, D., Andrés, N., Úbeda, J., Alcalá, J., Marcos, J., Vázquez-Selem, L., 2012. The importance of poligenic moraines in the paleoclimatic interpretation from cosmogenic dating. Geophysical Research Abstracts 14, EGU2012-3759-1. Pérez-Alberti, A., Valcárcel-Díaz, M., Martini, I.P., Pascucci, V., Andrucci, S., 2011. Upper Pleistocene glacial valley-junction sediments at Pias, Trevinca Mountains, NW Spain. In: Martini, I.P., French, H.M., Pérez-Alberti, A. (Eds.), Ice-Marginal and Periglacial Processes and Sediments. Geological Society (London) Special Publication 354, pp. 93-110. Research funded by the projects LIMNOCLIBER (REN2003-09130-C02-02), IBERLIMNO (CGL2005-20236-E/CLI), LIMNOCAL (CGL2006-13327-C04-01) and GRACCIE (CSD2007-00067) of the Spanish Inter-Ministry Commission of Science and Technology (CICYT). Additional funding was provided by the Fundación Patrimonio Natural de Castilla y León through the project "La investigacion en el Lago de Sanabria dentro del proyecto CALIBRE: perspectivas y posibilidades", and by the projects Consolider Ingenio 2006 (CSD2006-0041, Topo-Iberia), 2003 PIRA 00256, HF02.4, and RISKNAT (2009SGR520). L. Rodríguez-Rodríguez has developed her research under a Severo Ochoa Programme fellowship (FICYT- Asturias).

  4. Aborto em bovinos devido à intoxicação por Tetrapterys acutifolia (Malpighiaceae

    Directory of Open Access Journals (Sweden)

    Saulo A. Caldas

    2011-09-01

    Full Text Available Esse estudo teve por objetivo demonstrar experimentalmente que Tetrapterys acutifolia Cav. (fam. Malpighiaceae é capaz de provocar aborto em bovinos e caracterizar as alterações clínico-patológicas nas vacas e nos fetos. Estas plantas são responsáveis por significativo número de mortes em bovinos com mais de um ano de idade, especialmente nos Estados de Rio de Janeiro e São Paulo, mas até agora não havia sido comprovado experimentalmente seu efeito abortivo em bovinos. Os experimentos foram realizados no município de Barra do Piraí, RJ. Quatro vacas de descarte receberam brotos e folhas novas frescas de T. acutifolia, coletadas em propriedades vizinhas, nas doses de 2,5g/kg/dia, 5,0g/kg/dia (2 vacas e 10g/kg/dia, até ocorrer o abortamento. O quadro clínico nas vacas caracterizou-se por arritmia cardíaca, tremores musculares, anorexia, ascite, jugular ingurgitada, edema de peito e barbela e aborto (23-76 dias após o início da ingestão da planta; todas as vacas abortaram. Das quatro vacas apenas uma (a que recebeu 10g/kg/dia morreu 36 dias após o abortamento, com sintomas de insuficiência cardíaca. O exame necroscópico dos fetos/natimortos revelou hidrotórax, hidropericárdio, hidroperitônio e congestão hepática; ao corte do miocárdio, verificaram-se áreas pálidas. No exame histológico havia edema intersticial com fibrose incipiente. Na vaca que recebeu a maior dose e foi a óbito, bem como em outra intoxicada naturalmente, os achados de necropsia foram similares aos observados nos fetos, exceto pela dilatação dos vasos da base do coração e mais acentuada palidez do miocárdio. Observaram-se ainda edema subcutâneo nas regiões cervical e esternal, bem como veias jugulares ingurgitadas. Os achados histopatológicos foram necrose e edema intersticial com acentuada fibrose no miocárdio, espongiose da substância branca do encéfalo e, no fígado, congestão e leve fibrose. Adicionalmente, observou-se na vaca

  5. Estimación de impacto paisajístico de las carreteras

    Directory of Open Access Journals (Sweden)

    Cañas Guerrero, Igancio

    1993-08-01

    Full Text Available Perhaps one of the most important ways in which public opinion knows the landscape is through roads. The 325,000 km of roads in Spain are of great importance since they are used by 16.5 million vehicles. It seems that this importance will continue to grow in the years to come. This process goes together with the increasing sensitivity of the population where environmental issues are concerned. For this reason we constantly face confrontations between the development and the nature preservation. We believe it possible to reduce these conflicts by identifying the most problematic areas and the possible solutions in the initial stages of planning and design. In the road - landscape relation the importance of landscape studies is obvious since one of the aspects the public opinion values most directly is the integration of the road in the landscape. The aim of this paper is precisely to identify the principal stages in the analysis of the landscape issue in road projects. This is not a thorough description but a comment of various steps to be taken in the estimation of the impact on landscape which can serve as the starting point to be developed further in different projects.

    Quizá uno de ¡os medios más importantes por los cuales la opinión pública conoce el paisaje sea a través de la carretera. En España tenemos más de 325.000 km de carreteras que son utilizadas por 16,5 millones de vehículos, su interés es pues grande. Esta importancia parece que en los próximos años seguirá creciendo. Este proceso va unido a una sensibilidad cada vez mayor por parte de la población con los temas medioambientales. Esto da lugar a que nos encontremos con enfrentamientos crecientes entre el desarrollo y la conservación de la naturaleza. Estos conflictos pensamos que pueden reducirse, si ya en las primeras etapas de la planificación y diseño se identifican las áreas más problemáticas y sus posibles soluciones. Dentro de la relaci

  6. Seasonal changes in the photosynthetic performance of two evergreen Nothofagus species in south central Chile Cambios estacionales en el desempeño fotosintético de dos especies siempreverdes de Nothofagus en el centro sur de Chile

    Directory of Open Access Journals (Sweden)

    RAFAEL ZÚÑIGA

    2006-12-01

    del aparato fotosintético bajo condiciones de jardín común de estas especies podrían explicar sus contrastantes preferencias de hábitat. Se estudian algunas de estas propiedades en estas dos especies creciendo en un jardín común en el centro sur de Chile. La eficiencia fotoquímica máxima (Fv/Fm de ambas especies permanece en el rango de los valores normales (» 0,8 con excepción de un decrecimiento al mediodía y en verano en N. dombeyi, que sugiere una reducción reversible de la eficiencia fotoquímica máxima del fotosistema II (PSII. Durante el verano, la eficiencia fotoquímica efectiva del PSII (F PSII, el apagamiento fotoquímico (qP, la fotosíntesis (Amax, conductancia estomática (gs y las tasas de transpiración (E en N. dombeyi fueron mayores que en N. nitida. Los mayores incrementos en los contenidos de pigmentos fotoprotectores (zeaxantina + anteraxantina y luteína entre prealba y mediodía se obtuvieron en verano en N. dombeyi. En N. nitida se presentó en invierno una retención nocturna de zeaxantina sin decrecimiento de Fv/Fm. Los resultados sugieren que bajo condiciones de mayor intensidad lumínica, mayor temperatura y sequía, N. dombeyi mostró un mejor desempeño fotosintético que N. nitida. Los datos presentados son consistentes con la capacidad pionera de N. dombeyi y las propiedades de semitolerancia a la sombra y distribución más restringida de N. nitida. Estas características fotosintéticas, junto con las diferencias de la resistencia al congelamiento, sequía y anegamiento pueden resultar de su separación de hábitat

  7. Ecoanatomía foliar deárboles y arbustos delos distritos chaqueños occidental y serrano (Argentina Leaf ecoanatomy of trees and shrubs from Chacoan Occidental and Serrano Districts (Argentina

    Directory of Open Access Journals (Sweden)

    Ana M Arambarri

    2011-12-01

    Full Text Available El objetivo de este trabajo fue evaluar parámetros micrográficos foliares que permitan comprender mejor la relación planta-ambiente y contribuyan al desarrollo de nuevas tecnologías para el aprovechamiento sustentable y conservación de los bosques de esta región. Se empleó material de hoja de ejemplares recolectados en la región subtropical seca de la provincia chaqueña y material fresco de especies creciendo en zona templado-húmeda para comparar las variaciones de la estructura foliar. Se determinaron densidades por mm-2 de células epidérmicas, estomas y tricomas, tipos de mesofilo y tipo y distribución de los tejidos vascular y de sostén. Se encontró que estos caracteres anatómicos de la hoja son influenciados por una combinación de factores intraespecíficos y del ambiente. Los caracteres xeromórficos puestos de manifiesto fueron: presencia de ceras epicuticulares, estrías cuticulares, estomas hundidos con reborde peristomático, de epidermis bistrata o pluristrata y/o de hipodermis, mesofilo en empalizada o isolateral y abundante esclerénquima. Algunas especies tales como: Celtis ehrenbergiana, C. iguanaea, Jodina rhombifolia, Lycium cestroides y Parkinsonia aculeata, muestran desde caracteres xeromórficos (e.g. hojas anfistomáticas, equifaciales hasta caracteres mesomórficos (e.g. hojas hipostomáticas, bifaciales incluyendo algunos hidromórficos como la ausencia de esclerénquima.The objective of this work was to evaluate foliar micrographic parameters to deepen our understanding of the plant-environment relationships, contributing to new technologies to preserve the forests of this area. Leaf material of specimens collected in chacoan biogeographic province with subtropical and dry climatic conditions, and from species growing in template and humid conditions were studied to compare leaf structure variations. Epidermal cells, stomata and trichomes by unit of area (mm-2, types of mesophyll, sclerenchymatic tissue

  8. Análise dos fatores de risco relacionados à incidência de infecção do sítio cirúrgico em gastrocirurgias Análisis de los factores de riesgo relacionados a la incidencia de infección del sitio quirúrgico en gastrocirugías Analysis of risk factors related to the incidence of site infections in gastrosurgeries

    Directory of Open Access Journals (Sweden)

    Vanessa de Brito Poveda

    2003-03-01

    Full Text Available A infecção hospitalar é considerada um problema grave, crescendo tanto em incidência quanto em complexidade, gerando diversos tipos de implicações sociais e econômicas. A presente investigação teve como objetivo identificar a incidência de infecção do sítio cirúrgico (ISC e os fatores de risco de pacientes submetidos a cirurgias eletivas, na especialidade de Gastroenterologia, realizadas em um hospital público do interior paulista. Os dados foram coletados por meio de estudo retrospectivo de prontuários médicos, no período compreendido entre janeiro a dezembro de 1999. Em 134 casos estudados, detectamos a ocorrência de infecção do sítio cirúrgico em 18 situações (13,4%, ocorrendo 9 casos (50% do tipo considerado infecção incisional superficial, 8 (44.4% infecção incisional profunda e 1 (5.5% infecção de órgão/espaço. Em relação aos fatores de risco presentes nos casos de ISC detectados, os que atingiram porcentagem maior ou igual a 50% foram: idade acima de 50 anos, presença de neoplasias, duração da cirurgia maior que duas horas e tricotomia inadequada.La infección hospitalaria es considerada un problema grave, creciendo tanto en incidencia como en complejidad, generando diversos tipos de implicaciones sociales y económicas. La presente investigación tuvo como objetivo identificar la incidencia de infección del sitio quirúrgico en pacientes sometidos a cirugias electivas, en la especialidad de Gastroenterología, realizadas en un hospital público del interior del estado de São Paulo. Los datos fueron recoleccionados por medio de un estudio retrospectivo de los archivos medicos, en el periodo entre enero y diciembre de 1999. En 134 casos estudiados, detectamos la ocurrencia de infección del sitio quirúrgico en 18 situaciones (13.4%, ocurriendo 9 casos (50% del tipo considerado infección incisional superficial, 8 (44.4% infección incisional profunda y 1 (5.5% infección de órgano/espacio. Con

  9. Estimación a largo plazo de la prevalencia de obesidad en la Argentina

    Directory of Open Access Journals (Sweden)

    Erica Milin

    2010-01-01

    Full Text Available RESUMENIntroducciónLa obesidad está creciendo más aceleradamente en América latina que en los países desarrollados,sumándose a la desnutrición como factor que incide en la mortalidad. Aunque esnecesario conocer la evolución de las tasas de obesidad para implementar políticas de saludpública, en la Argentina no existen hasta el momento estudios que permitan proyectar lasituación en el futuro.ObjetivoEstimar a largo plazo la evolución de la prevalencia de obesidad en adultos en la Argentinaa través de un modelo de simulación basado en la tendencia de los últimos años.Material y métodosSe desarrollaron un modelo conceptual y un sistema de simulación estocástico en base a losdatos de obesidad publicados con anterioridad para representar el número de adultos obesosy su tasa de prevalencia a 20 años. La información para el funcionamiento del modelo seobtuvo de tres estudios poblacionales locales que incluían la prevalencia de obesidad endistintos años desde 1991. A los fines comparativos también se estimó la prevalencia deobesidad con tres ajustes estadísticos: lineal, exponencial y logarítmico.ResultadosA partir de una prevalencia actual del 20%, el modelo de simulación estimó que la prevalenciade obesidad en adultos en la Argentina será del 25,9% ± 2,75% (mediana: 26%, rango:18,0% a 32,0% para 2027, lo que representa para ese entonces 5.431.000 ± 554.000 obesos(mediana: 5.421.000 personas, rango: 3.605.000 a 6.631.000 personas. Estos resultadosfueron consistentes con los obtenidos con los métodos de ajuste y proyección estadísticos.ConclusionesEl modelo permitió estimar la tasa de obesidad a 20 años en la Argentina. Los valores deprevalencia en adultos hallados con el modelo fueron coincidentes con otros tipos de proyecciónestadística tradicionales. La validez de la estimación sólo podrá determinarse en base alas observaciones futuras de la evolución de la obesidad. Por último, el modelo podría ser

  10. Trabajo de Tesis Presentado a la Facultad Nacional de Agronomía de Medellín como Requisito Parcial para Optar al Título de Ingeniero Agrónomo.

    Directory of Open Access Journals (Sweden)

    Facultad Nacional de Agronomía Universidad Nacional de Colombia

    1956-12-01

    Full Text Available El propósito del presente estudio es obtener información acerca de la forma de heredarse la reacción a la roya amarilla, en el estado de planta madura, con particular referencia a la naturaleza genética de las variedades progenitoras. El presente estudio de planta adulta, bajo condiciones de campo, debido a la ausencia de invernadero adecuado, en donde se pueda regular la temperatura a las variantes biológicas en cuestión. Se relieva la importancia ecinomia de la roya amarilla del trigo en nuestro medio, en donde cauca serias pérdidas en el rendimiento y calidad del grano, especialmente en la variedad regional Bola Picota, constituyendo así la enfermedad más peligrosa en las zonas trigueras de Cundinamarca, Boyacá y Nariño. El objeto del presente estudio es determinar la herencia de la resistencia de la planta madura a Puccinia glumarum, por medio del estudio de la progenie híbrida F2 y F3 de dos cruces. Es importante en todo programa de mejoramiento de la planta conocer el comportamiento genético del material usado, de acuerdo con las condiciones ambientales y con la virulencia de las razas patogénicas, del medio en que se trabaja. La revisión de literatura que hace referencia a los factores que influyen en la herencia de la resistencia, ofrece datos muy disímiles, a veces opuestos, de acuerdo con las regiones, variedades empleadas y especialización fisiológica del patógeno. Se emplean dos fuentes de resistencia a p. glumarum, a saber: variedad Frontana procedente de Brasil, y Chinese 166, variedad de la China; las cuales se han comportado en nuestro medio, desde altamente resistente hasta inmune, a través de todos los años. Se cruzan con las variedades susceptibles Supremo 211 de México, y Timstein de Australia, en 1950-B; creciendo la F1 en 1951-A. La generación segregante F2 es observaday analizada durante 3 fechas de siembra, con replicaciones en la Granja de La Picota y Tibaitatá. La generación F3 se

  11. Desenvolvimento de instrumento de coleta de dados de enfermagem para pacientes com câncer de pulmão em quimioterapia ambulatorial Desarrollo de instrumento de recogida de datos de enfermería para pacientes con cáncer de pulmón en quimioterapia ambulatoria Developing a nursing data colleting instrument to patients with lung cancer treated by chemotherapy in ambulatory

    Directory of Open Access Journals (Sweden)

    Anita Moda Salvadori

    2008-03-01

    Full Text Available O câncer é um grave problema de saúde pública, e, dentre suas variedades, há o câncer de pulmão, que vem crescendo na população brasileira e mundial. A principal causa do câncer de pulmão é o tabagismo. Há três formas de tratamento: cirurgia, radioterapia e quimioterapia; para essa patologia a mais utilizada é a terceira. A enfermeira deve estar apta a lidar com as dificuldades desses pacientes, que durante o tratamento ambulatorial manifestam em seus domicílios efeitos colaterais. Os objetivos desta pesquisa são elaborar um instrumento de coleta de dados para pacientes com câncer de pulmão em quimioterapia ambulatorial e avaliar a validade de seus conteúdos e sua confiabilidade. Teve como guia a teoria do autocuidado de Dorothea Orem. Para sua validação, o instrumento foi primeiramente avaliado por juízes; após isso, foram realizados o pré-teste e o teste de confiabilidade pelo método da equivalência entre observadores. O instrumento se demonstrou confiável, considerando aquilo que se pretendia medir.El cáncer es un grave problema de salud pública y entre sus variedades existe el cáncer de pulmón, que está creciendo en la población brasileña y mundial. La principal causa de cáncer de pulmón es el tabaquismo. Existen tres formas de tratamiento, quirúrgica, por radioterapia y quimioterapia, siendo que para esta patología la más utilizada es la tercera. La enfermera debe estar habilitada para manejar dificultades de los usuarios que ante el tratamiento ambulatorio visiblemente pozo a su domicilio lado efectos. Los objetivos de esta investigación son elaborar un aparato desde colecta de datos para pacientes con cáncer de pulmón en quimioterapia en ambulatorio y evaluar la validad de sus contenidos y su confiabilidad. Tuvo como guía la teoría utilizada del auto-cuidado de Dorothea Orem.Para que sea comprobada la validez de dicho instrumento primeramente este fue evaluado por jueces, luego fue realizado un

  12. Premio Nacional de Epilepsia “Margaret Merz de Fandiño”.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    2009-07-01

    Full Text Available

    Este premio, creado con el objetivo de reconocer a los investigadores colombianos comprometidos en el estudio de lo relacionado con las ciencias epileptológicas, es también una manera de estimular al talento humano estudioso y dedicado a aportar su óptimo esfuerzo intelectual para alivio de un padecimiento que afecta directamente a una numerosa población de compatriotas y con ellos impacta a ocho millones de colombianos si contamos la influencia que sobre las familias ejerce esta patología, identificada en 800 mil personas.

    El Premio, aprobado hace dos años en la Asamblea de socios activos de la Liga Colombiana contra la Epilepsia, es una vez más fruto del esfuerzo y tenacidad del Académico Jaime Fandiño Franky, eminente científico de las neurociencias y apóstol de una de las causas que inciden en la situación de los más necesitados en Colombia.

    La labor iniciada por Fandiño Franky hace ya cuatro décadas en la ciudad de Cartagena, con el ánimo de diagnosticar, investigar, tratar, hacer seguimiento y rehabilitación de las víctimas y su entorno familiar, ha llevado a la más ambiciosa realización científica, docente y asistencial, con el montaje primero de una infraestructura física plasmada en un centro de 13.000 metros cuadrados para enfrentar este problema de salud pública, bastante relegado tradicionalmente, pero merecedor por sus proporciones, de una consideración y manejo especiales, que de no prodigarlos el estamento oficial, lo afronta una organización altruista y generosa con Fandiño Franky y Margaret Merz, su esposa, a la cabeza.

    Con el tiempo su organización fue creciendo no sólo física sino cualitativamente con el empleo de las más modernas tecnologías para diagnóstico y tratamiento hasta convertirse en un centro piloto orgullo de Colombia y pionero en Latinoamérica del manejo integral, iniciado con la identificación del paciente y culminado con la rehabilitaci

  13. Les états du roi des Ponts et Chaussées pendant l’administration des Trudaine : 1743-1777

    Directory of Open Access Journals (Sweden)

    Stéphane Blond

    2012-01-01

    Full Text Available Au cours du XVIIIe siècle, l’importante stabilité en poste des intendants des finances Trudaine rend possible l’examen, sur une longue période, des procédures comptables et des contrôles financiers au sein du département administratif des Ponts et Chaussées. Alors que le budget consacré à cette administration ne cesse de croitre, l’analyse de la correspondance entre les Trudaine et plusieurs intendants de généralités permet d’étudier la confection des états du roi et les différentes étapes de vérification/validation des opérations financières. Cet article aborde aussi la présentation des comptes financiers, les modes de calculs et les modalités de distribution des enveloppes budgétaires en fonction des généralités et des domaines d’activité.During 18th century, the administrative stability of intendants des finances Trudaine makes possible a precise description of financial procedures and controls, especially for the Department of Ponts et Chaussées. The budget of this administration knows an important growth, and the analysis of the correspondence between Trudaine and various intendants of province, allows to study the preparation of countable documents. This paper also examines the material presentation of financial documents and the distribution of the budget between each field of activity.Es posible hacer un estudio a mediano plazo de los procedimientos contables y los controles financieros en el seno del departamento de Ponts et Chaussées en el siglo XVIII, dado que los intendentes de Hacienda Trudaine permanecen mucho tiempo en su empleo. El análisis de la correspondencia entre los Trudaine y varios intendentes de généralités permite estudiar la preparación de los états du roi, los libros contables que describen la distribución prevista de los fondos de este departamento en cada provincia, en una época en que estos fondos van creciendo. Asimismo, se pueden estudiar las etapas de verificación y

  14. Pistillate Flower Abcission Symptoms of ‘Serr’ Walnut (Juglans RegiaL. Sintomatología del Aborto en flores Pistiladas de Nogal (Juglans regiaL. ‘Serr’

    Directory of Open Access Journals (Sweden)

    Cristián González R

    2008-06-01

    observación en microscopio óptico, utilizando como tinción azul de toluidina-O al 0,05%. La flor abortada por exceso de polen se deterioró rápidamente, presentó detención del crecimiento, pérdida del brillo del involucro y stigmatic necrosis. La flor abortada por falta de polinización mostró un deterioro lento que se prolongó dos semanas más que la abortada por exceso de polen. La flor cuajada siguió creciendo, sin perder su brillo. La flor abortada por exceso de polen puede caer con o sin pedúnculo adherido. Se pueden presentar dos zonas de separación: zona distal y zona proximal del pedúnculo. La cicatriz en el pedúnculo permite diferenciar el aborto por exceso de polen, falta de polen y por otras razones.

  15. El b-learning como modalidad educativa para construir conocimiento

    Directory of Open Access Journals (Sweden)

    María Elena González

    2015-01-01

    Full Text Available El propósito es presentar la modalidad b-learnig que se enmarca dentro de la modalidad de educación a distancia, como una forma de im- plementar las TICs en la educación pues éstas han ido aumentando su impacto en todas las áreas de la vida de las personas, y específicamente su auge va creciendo cada día más, en el área educativa. Con la imple- mentación de las TICs en las diferentes modalidades en educación, el proceso de enseñanza-aprendizaje mejora notablemente, ya lo señalan en sus trabajos (Salinas, 1994; Pérez y García, 2001; Cabero, 2005; La- borde, 2001, cuando se habla de modalidades, nos referimos tanto la modalidad presencial como a distancia. En la primera, el proceso educa- tivo se da en un aula, y en el proceso intervienen el profesor y el alumno. Se puede decir entonces, que es la forma academicista de enseñar. En esta modalidad, el profesor siempre está presente para orientar, informar, responder preguntas, realizar comentarios sobre uno o varios temas. En la modalidad de educación a distancia en el proceso de enseñanza apren - dizaje están presentes diversos elementos, específicamente, las tecnolo - gías, con el objetivo de promover el acto educativo sin limitaciones de edad, ubicación y tiempo. En la educación a distancia, cada estudiante guía su propio proceso de aprendizaje, y es el mismo quien organiza y planifica su tiempo, además de buscar por sí mismo el material didáctico a trabajar, para responder de esa manera a las exigencias de la asignatura que cursa. Cada una de las modalidades tiene sus ventajas y característi - cas particulares, no puede decirse que la educación a distancia puede Recibido: 01-08-2015 • Aceptado: 01-09-2015 sustituir a la educación, presencial, sino que ambas modalidades pueden enriquecerse cada una con elementos de la otra. Esto es lo que da origen al blended learning o b-learning, es una modalidad, que concentra tanto elementos de la educación presencial como de

  16. O significado da hospitalização para a criança pré-escolar: um modelo teórico El significado de la hospitalización para el niño en edad pre-escolar: un modelo teórico The meaning of hospitalization for the pre-school child: a theoretical model

    Directory of Open Access Journals (Sweden)

    Circéa Amália Ribeiro

    2005-12-01

    Full Text Available Este estudo teve como objetivo compreender o significado de estar hospitalizada, para a criança pré-escolar. Os referenciais teóricos foram o Interacionismo Simbólico e a teoria de Vygotsky sobre a brincadeira simbólica da criança e o referencial metodológico foi a Teoria Fundamentada nos Dados. Participaram do mesmo 11 crianças de três a seis anos de idade. As estratégias de coleta de dados foram: observação participante, entrevista com as crianças, mediada pelo Brinquedo Terapêutico e entrevista com as mães. A análise dos dados permitiu construir o modelo teórico Crescendo com a presença protetora da mãe, que evidencia a vulnerabilidade, a força da criança e a proteção recebida da mãe, para enfrentar o mistério e o terror da hospitalização.En este estudio se tuvo como objetivo comprender el significado que tiene para un niño pre-escolar, estar hospitalizado. Los referenciales teóricos fueron el Interaccionismo Simbólico y la teoría de Vygotsky sobre el juego simbólico del niño y el referencial metodológico fue la Teoría Fundamentada en los Datos. Participaron del mismo 11 niños de tres a seis años de edad. Las estrategias de recolección de datos fueron: observación participante, entrevista con los niños, mediado por el Juguete Terapéutico y entrevista con las madres. El análisis de los datos permitió construir el modelo teórico Creciendo con la presencia protectora de la madre, que evidencia la vulnerabilidad, la fuerza del niño y la protección recibida de la madre, para enfrentar el misterio y el terror de la hospitalización.This study was aimed at comprehending the meaning of being hospitalized for pre-school children. The theoretical references were the Symbolic Interactionism and Vygotsky's theory on the child's symbolic play. The methodological referential was the Theory Based on Data. Eleven children between the ages of 3 and 6 took part in the survey. The strategies for data collection were

  17. Profile of scientific and technological production in nursing education research groups in the south of Brazil Perfil de la producción científica y tecnológica de los grupos de investigación en educación en enfermería de la región Sur de Brasil Perfil da produção científica e tecnológica dos grupos de pesquisa em educação em enfermagem da Região Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Mônica Motta Lino

    2010-06-01

    Full Text Available This research aimed to present the profile of production of Nursing Education Research Groups’ (NERG scientific and technological production in the South of Brazil. This documentary, quantitative, exploratory-descriptive retrospective research was guided by the active search for products in the Lattes curriculum of previously selected NERG researchers, based on the 2006 Census of the Research Group Directory/CNPq, between 1995 and 2008. The results indicated that the 18 NERG from southern Brazil produced 453 papers in proceedings, 371 book chapters, 206 books, 1,437 scientific articles and 08 technological products, but no patent was registered. NERG’s scientific production in the research region has grown progressively over the past 14 years. To strengthen this structure, the establishment of collaborative networks can be used as a strategy, so that political-scientific joint actions in the sector can advance science and technology.El objetivo del estudio fue presentar el perfil de la producción científica y tecnológica de los Grupos de Investigación en Educación en Enfermería (GIEE de la región sur de Brasil. Se trata de una investigación documental, cuantitativa, exploratoria-descriptiva retrospectiva, guiada por la búsqueda activa de las producciones, en el Currículo Lattes, de los investigadores de los GIEE, preseleccionados a partir del Censo-2006 del Directorio de Grupos/CNPq, en el período de 1995-2008. Los resultados indicaron que los 18 GIEE del sur de Brasil produjeron 453 trabajos en anales, 371 capítulos de libros, 206 libros, 1437 artículos científicos y 8 productos tecnológicos, sin embargo, ninguna patente registrada. La producción científica de los GIEE de la Región investigada viene creciendo, progresivamente, en los últimos 14 años. Para que esa estructura sea fortalecida, se puede utilizar como estrategia la formación de redes colaborativas que viabilicen articulaciones político-científicas en el

  18. La vegetación como indicador de la Geomorfología Fluvial

    Directory of Open Access Journals (Sweden)

    Juan José Neiff

    2005-11-01

    Full Text Available Aguas abajo de la confluencia con el río Paraguay, el Paraná se expande en una ancha planicie lateral que, durante las inundaciones extraordinarias completa un área 2-10 veces mayor que el área ocupada por las aguas en los períodos de bajantes extraordinarias, en los que el curso queda aislado de la planicie inundable. El propósito de esta contribución es presentar las características más salientes de este tramo entrelazado del río, usando las unidades de paisaje y los tipos de vegetación, como indicadores de las formas del relieve. Imágenes satelitales Landsat TM5 y TM7 procesadas con el SIG IDRISI, de la inundación extrema de 1998 y de la sequía extrema de 2001, fueron usadas para la clasificación de los tipos de vegetación, usando el criterio propuesto por CET (Clasificación Ecológica de Tierras. Observaciones de campo fueron realizadas en ambas fases hidrológicas para obtener la posición topográfica de las unidades de vegetación y de los ensambles de comunidades vegetales. Nosotros encontramos que los albardones están ocupados por tipos de bosques, mientras que los bañados y cuerpos de aguas someros están cubiertos por plantas herbáceas y que las praderas flotantes de vegetación flotante libre, como el aguapé, crecen en lagos conectados al río una o más veces en el año. La vegetación acuática del curso principal es muy pobre como consecuencia del flujo del río y las fluctuaciones de nivel del agua. Sólo pequeñas manchas de carrizo se encontraron creciendo en barras de arena. La interrelación entre la vegetación y las formas del relieve es muy dinámica, con cambios drásticos en períodos de décadas o aún de pocos años, dependiendo del caudal y de la carga de sólidos transportados. En otro sentido, la vegetación fluvial tiene un importante rol en la fijación de depósitos fluviales y como núcleos de acreción en las barras o para entender la obstrucción de pequeños cursos de agua en la planicie

  19. Let others manufacture! Towards a new manufacturing framework ¡Qué fabriquen ellos! Hacia un nuevo modelo productivo

    Directory of Open Access Journals (Sweden)

    Carlos Rodriguez Monroy

    2009-11-01

    salida, flexibilidad geográfica, bajos costes, difusión tecnológica en la red muy rápida, alta diversificación a través de los fabricantes subcontratados y excepcionales economías de escala. Este trabajo propone un modelo teórico que analizará las causas de la formación de estas redes incluyendo sus cuatro pilares básicos: estrategia, estructura, dinámica y cultura. Para ello, se tendrán en cuenta aspectos como las alianzas estratégicas entre empresas competidoras, la naturaleza permeable y difusa de los actores de la red y el riesgo de canibalizaciones de roles, la paradoja inherente de colaborar con competidores, los aspectos culturales a nivel sistémico o las tecnologías de información y comunicación a nivel de red. El modelo teórico propuesto permitirá conocer de una manera ordenada, todos los aspectos relevantes de este tipo de redes para esclarecer y dar perspectiva a uno de los tipos de organizaciones que más ha creciendo en los últimos años.

  20. INTERACTIVE EFFECTS OF SALINITY STRESS AND NICOTINAMIDE ON PHYSIOLOGICAL AND BIOCHEMICAL PARAMETERS OF FABA BEAN PLANT

    Directory of Open Access Journals (Sweden)

    MAGDI T. ABDELHAMID

    2013-01-01

    Full Text Available Una posible estrategia de supervivencia para plantas que se desarrollan bajo condiciones de salinidad es emplear algunos compuestos que les permitan disminuir el estrés salino. Uno de estos compuestos es la nicotinamida (vitamina B3/ niacina. Se investigó el efecto de la aplicación exógena de nicotinamida en diferentes concentraciones (0, 200 o 400 mg l-1 sobre plantas de haba (Vicia faba L. creciendo a diferentes niveles de NaCl (0, 50 o 100 mM en los terrenos del National Research Centre, Cairo, Egipto. El estrés por salinidad reduce significativamente los contenidos de pigmentos fotosintéticos, polisacáridos, carbohidratos totales, nitrógeno total, peso de las plantas, número de hojas, pesos fresco y seco de tallos, rendimiento de semillas, y contenido de carbohidratos y proteina cruda total en semillas comparado con plantas control. En contraste, la salinidad induce incrementos marcados en sacarosa, azúcares solubles totales, aminoácidos libres totales, prolina, productos de peroxidación de lípidos como el malondialdehido (MDA y algunas enzimas oxidativas (polifenol oxidasa y peroxidasa. También, el estrés por salinidad incrementa el contenido de Na+ y genera disminución de otros macronutrientes y micronutrientes (P, K+, Mg2+, Ca2+, Fe2+, Mn2+, Zn2+ y Cu2+ de los tallos y el rendimiento de semillas en plantas de haba. La aspersión foliar de nicotinamida disminuye los efectos adversos del estrés salino incrementando los pigmentos fotosintéticos, polisacáridos, carbohidratos totales, concentración total de nitrógeno en tallos, peso de las plantas, número de hojas, pesos frescos y secos de tallos, y rendimiento de semillas; así como los niveles de sacarosa, azúcares solubles totales, aminoácidos libres totales y prolina, comparado con aquellos correspondientes al estrés por salinidad, mientras disminuyeron los productos de peroxidación de lípidos (MDA y las enzimas oxidativas (polifenol oxidasas y peroxidasas. La

  1. Nuevos registros de macroalgas para el Atlántico mexicano y riqueza florística del Caribe mexicano New records of macroalgae for the Mexican Atlantic and floristic richness of the Mexican Caribbean

    Directory of Open Access Journals (Sweden)

    Neidy Pauline Cetz-Navarro

    2008-03-01

    Full Text Available Se revisaron muestras de macroalgas de un hábitat pocas veces analizado (colindante a la parte basal del tejido vivo de los corales Acropora palmata y Diploria strigosa y de una zona de México poco conocida florísticamente (parte Sur del Caribe mexicano, con base a lo cual se reporta a Corallophila verongiae (Rhodophyta, Derbesia fastigiata (Chlorophyta y Hincksia onslowensis (Phaeophyta como nuevos registros de macroalgas para la costa del Atlántico mexicano. Además, se reporta a Lophosiphonia obscura (Rhodophyta como nuevo registro para la parte costera continental del Atlántico mexicano, ya que sólo se había registrado hace más de 40 años para Arrecife Alacranes, sitio alejado aproximadamente 180 km al norte de Puerto Progreso, Yucatán. Aunque las especies de macroalgas no presentaron estructuras reproductoras, probablemente por tener crecimiento clonal y estar invadiendo tejido coralino, los caracteres morfológicos permitieron su identificación con certeza. Con excepción de la primera especie, las otras no se habían registrado creciendo sobre corales. Tomando en cuenta estos nuevos registros, el total de especies de macroalgas registradas hasta este estudio para el Caribe mexicano es de 546, incluyendo 307 Rhodophyta, 171 Chlorophyta y 68 Phaeophyta. Esta zona tropical y la costa templada de Baja California conforman las dos zonas florísticas marinas más ricas de México.Macroalgae samples from a habitat uncommonly analyzed (next to the basal part of live tissue of the corals Acropora palmata and Diploria strigosa, and from a Mexican zone barely known floristically (the southern part of the Mexican Caribbean were studied. Based on those samples, Corallophila verongiae (Rhodophyta, Derbesia fastigiata (Chlorophyta, and Hincksia onslowensis (Phaeophyta are recognized as new records for the Mexican Atlantic coast. Similarly, Lophosiphonia obscura (Rhodophyta is recognized as a new record for the continental coast of the Mexican

  2. Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps con características probióticas y potencial en la degradación del pasto

    Directory of Open Access Journals (Sweden)

    Cecilia Lara Mantilla

    2013-06-01

    Full Text Available Título corto: Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps  Título en ingles:  Cellulolytic bacteria isolated from  termites’ gut (Nasutitermes nigriceps with probiotic characteristics and potential pasture degradationResumen: El objetivo de la presente investigación fue aislar bacterias celulolíticas del intestino de termitas (Nasutitermes nigriceps para determinar sus propiedades probióticas in vitro y su potencial en la degradación de pasto. Las termitas fueron tratadas con detergente antibacterial, separando y macerando luego, el intestino de las mismas en agua peptonada estéril. Diluciones de esta mezcla fueron inoculadas en cajas Petri con medio Luria Bertani (LB y Carboximetilcelulosa (CMC al 2%, incubando a 37º C por 24 horas, para luego revelar con Rojo Congo al 1%. Las bacterias que presentaron mayores halos de degradación fueron sometidas a tinción de Gram y a pruebas probióticas de temperatura, pH, salinidad y presencia de sales biliares, así como también a pruebas de antagonismo y degradación de pasto. Los resultados revelaron la presencia de 9 bacilos celulolíticos Gram (- de los cuales, los bacilos BTN7 y BTN8, presentaron los mejores halos de degradación, 12 y 14 mm de diámetro respectivamente, creciendo adecuadamente en las diferentes pruebas probióticas con densidades entre 106 y 108 UFC/ml; el porcentaje de degradación de materia seca fue de 39.73% y 36.10% en 48 y 72 horas respectivamente.  Las pruebas bioquímicas API E (bioMérieux SA revelaron que los bacilos BTN7 y BTN8 pertenecen al género Enterobacter sp. Los anteriores resultados abren la posibilidad de emplear, estos microorganismos como aditivos en la alimentación de rumiantes, a fin de contribuir con un mayor aprovechamiento de pastos, y otros sustratos vegetales lignocelulósicos.Palabras claves: Probióticos, Maralfalfa (Pennisetum sp., microorganismos ruminales, lignocelulosa, Enterobacter

  3. Tendencias de la mortalidad por cáncer de mama en México, 1980-2009 Breast cancer mortality trends in Mexico, 1980-2009

    Directory of Open Access Journals (Sweden)

    Elvia de la Vara-Salazar

    2011-10-01

    Full Text Available El cáncer de mama ha trascendido como un importante riesgo para la salud de las mujeres a escala mundial. Las muertes por cáncer de mama han tenido un destacado incremento dentro de los tumores malignos a nivel mundial al cobrar más de 460 000 vidas en 2008, convirtiéndolo en el padecimiento con más decesos alrededor del mundo.Los cambios demográficos y en estilos de vida han modificado la exposición de la población al riesgo de enfermedades como el cáncer,y desde 1980la mortalidad porcáncerdemama ha mantenido una tendencia ascendente,ubicándose por encima de las muertes por cáncer cervicouterino desde 2006. Al analizar las tasas de mortalidad en las mujeres mexicanas de 25 años de edad en adelante a lo largo de 30 años, se distinguen diferencias estatales y por grupos de edad. Aun cuando el perfil de esta causa de muerte se ha asociado con un mayor desarrollo regional, en este trabajo se puede observar que están ocurriendo cambios y las muertes también están creciendo en la población de mujeres de regiones y entidades menos desarrolladas.Queda de manifiesto el reto que México enfrenta, y la necesidad de conjuntar esfuerzos e implementar programas para educar a la población hacia el autocuidado de la salud, así como promover estilos de vida saludables, además de mejorar la infraestructura diagnóstica para lograr una detección a tiempo y garantizar un tratamiento adecuado.Breast cancer has become an important health risk for women worldwide.The important growth of breast cancer-related deaths within those caused by malign tumors throughout the globe went past the 460 000 in 2008,becoming the deadliest disease worldwide.Demographic changes and lifestyles have modified the population exposure to risk factors of maladies such as cancer, and since 1980 breast cancer mortality has remained on an upward tendency,surpassing cervical cancer in 2006. After analyzing mortality rates along 30 years in Mexican women 25 or more years

  4. Evaluación y modelización hidrológica para el diagnóstico de “desastres naturales”

    Directory of Open Access Journals (Sweden)

    Pla Sentís Ildefonso

    2012-05-01

    Full Text Available La degradación de suelos afecta negativamente sus funciones como base de la producción de alimentos, de la regulación del ciclo hidrológico y de la calidad ambiental. Está creciendo en todo el mundo, en parte debido a faltas o deficiencias en las evaluaciones de los procesos y causas de dicha degradación en cada situación específica. Los procesos de degradación física de suelos se manifiestan a través de problemas de compactación, sellado, encostrado, escorrentía, erosión hídrica y eólica, movimientos en masa, etc., con efectos colaterales "in situ" y a distancia, a menudo con consecuencias desastrosas como inundaciones, deslizamientos de tierra, sedimentaciones, sequías, etc. Estos procesos están frecuentemente asociados a cambios desfavorables en los procesos hidrológicos responsables del balance de agua y régimen hídrico de los suelos, derivados principalmente de cambios en el uso y manejo de las tierras y de cambios climáticos. La evaluación de dichos procesos bajo diferentes escenarios de cambios de clima, propiedades de los suelos y uso y manejo de las tierras con el uso de modelos de simulación sencillos y flexibles, basados en procesos hidrológicos, permitiría predecir su desarrollo, y con ello, la selección y aplicación de prácticas apropiadas de conservación de suelos para eliminar o moderar sus efectos. Estos modelos requieren, como base, información adecuada sobre clima y propiedades hidrológicas de los suelos. A pesar de que existen metodologías y equipos comerciales cada vez más sofisticados y "precisos" para medir las diferentes propiedades físicas e hidrológicas de los suelos relacionados con los procesos de degradación, la mayoría de ellos solo son aplicables bajo condiciones de laboratorio y en suelos y condiciones muy particulares. A menudo se utilizan métodos indirectos, basados en relaciones o índices empíricos sin una adecuada validación, que frecuentemente conducen a costosos

  5. LAS INCUBADORAS UNIVERSITARIAS DE ECONOMÍA SOLIDARIA EN BRASIL - UN ESTUDIO DE CASOS / THE UNIVERSITY INCUBATORS OF SOLIDARITY ECONOMY IN BRAZIL – A CASE STUDY

    Directory of Open Access Journals (Sweden)

    Ioshiaqui SHIMBO

    2011-09-01

    Full Text Available La Economía Solidaria es un término que designa un movimiento social que viene creciendo en Brasil durante los últimos 15 años e incluye un gran conjunto de actores socioeconómicos. En él se generan alternativas de inserción productiva para colectivos socialmente desfavorecidos, pero sus objetivos no son solamente los cambios económicos, sino la promoción de cambios socioculturales hacia una sociedad más igualitaria y solidaria. Para apoyar y fortalecer la economía solidaria se crearon desde algunas universidades brasileñas las Incubadoras de Cooperativas Populares. En el presente estudio se analiza la trayectoria de la Incubadora Regional de Cooperativas Populares de la Universidad Federal de São Carlos, situada en el Estado de São Paulo (Brasil, como estructura que conjuga la investigación, la docencia y la extensión universitaria dirigidas hacia los procesos de incubación de emprendimientos solidarios. Aplicando el estudio de casos se sistematizan los avances conceptuales y metodológicos que se relacionan con las dificultades encontradas por estos emprendimientos para su consolidación y la creación de redes de iniciativas económicas solidarias en el territorio estudiado. El examen de este proceso ayudó a identificar y discutir estrategias para el progreso de los argumentos conceptuales, de la metodología de asesoramiento y para la aplicación a otras iniciativas similares. / The Solidarity Economy is a social movement who is growing up in the last 15 years in Brazil and it includes a very big group of socioeconomic actors. This movement improves alternatives of productive insertion to disadvantage groups of population. However its objectives are not only the economic changes, but the promotion of social and cultural changes toward a more equal and solidarity society. To support and strengthen the solidarity economy, the Popular Cooperatives Incubators had been created in some Brazilian Universities. In this study we

  6. Diagnóstico teológico a los 50 años del Vaticano II (Theological Diagnosis 50 years after Vatican II - DOI: 10.5752/P.2175-5841.2011v9n24p1368

    Directory of Open Access Journals (Sweden)

    José Maria Vigil

    2012-01-01

    Full Text Available Resumen:Partiendo de la idea de que el Vaticano II quiso ser un diálogo con la modernidad, el autor comienza señalado (el «ver» en la medotología latinoamericana los grandes cambios de paradigma que se han sucedido en estos 50 años posteriores al Concilio: la revolución de la posmodernidad, el despertar de la conciencia política y la irrupción de la teología de la liberación, la nueva conciencia pluralista, el descubrimiento de la ecología profunda, la crisis de las «religiones agrarias» en un mundo que parece querer entrar en un mundo «post-religioso», y la transformación de la epistemología religiosa tradicional. En un segundo momento («juzgar» analiza lo que sucedió con el Vaticano II y el posconcilio: las transformaciones que propuso, la oposición que fue creciendo apoyándose en el propio poder jerárquico institucional, y el impase de la actual falta de diálogo. En una tercera parte («actuar» el autor propone unas pistas interpretativas como la mejor forma de aportar a una situación eclesial actual que parece no tener salida.Palabras clave: Diagnóstico teológico. Vaticano II. Concilio. Iglesia. Futuro. Cambio de ParadigmaAbstract:Starting from the idea that Vatican II wanted to stablish a dialogue with the modernity, the author starts pointing out (the «see», in the Latin American methodology the big changes of paradigm which have taken place in these last 50 years after the Council: the revolution of pos-modernity, the waking up of the politic conscienceand the irruption of the theology of Liberation, the new conscience of cultural and religious pluralism, the discovery of the depp ecology, the crisis of the «agrarian religions» in a world which seems to want enter into e post-religious world, and the transformation of the traditional religious epistemology.        In a second moment («judge» analizes what happened in the Vatican II and the pos-council: the transformations it proposed, the growing

  7. El transporte urbano entre la globalización y la fragmentación: El caso de la Región Metropolitana de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Susana Kralich

    1998-03-01

    Full Text Available Con la consolidación del capitalismo avanzado se deslocalizan las cadenas productivas, a la par que se internacionalizan los oligopolios del capital. Ellos florecen en el mundo subdesarrollado estimulados por la suburbanización, las políticas de ajuste, la flexibilización laboral, el desempleo, la privatización y desregulación de los servicios públicos, la hegemonía de las leyes de mercado y la gradual desaparición de la concepción keynesiana del Estado, exacerbándose la segregación y la exclusión y creciendo la violencia urbana hasta límites impensados. La concentración demográfica intensifica y complejiza las demandas, en especial las de transporte, complicándose la gestión de los servicios y dificultándose la compatibilización de intereses contradictorios. Puja en la cual indefectiblemente se ven perjudicadas las crecientes franjas de menores recursos, profundizándose las inequidades propias del modelo, cuyo resultado son ciudades cada vez más dualizadas. En este marco, la gestión de servicios urbanos requiere ser repensada y rediseñada, particularmente en las grandes aglomeraciones, ya que aparece cada vez como más acuciante la resolución de la pluralidad y superposición de administraciones que funcionan fragmentadas, dispersando la responsabilidad sobre los problemas integrales a afrontar. Tal el caso de la Región Metropolitana de Buenos Aires (RMBA, a la que nos referiremos enfocando la cuestión relativa a la gestión del transporte urbanoWith the consolidation of the advanced capitalism, the productive chains are dislocalizated, as well as the internacionalization of the capital oligopolies. They blossom in the underdeveloped world, stimulated by the suburbanization, the adjustment policies, the occupational flexibilization, the unemployment, the privatization and the desregulation of the public services, the hegemony of the market laws and the gradual disappearance of the Welfare State. All items previously

  8. Evaluation of the ORYZA2000 Rice Growth Model under Nitrogen-Limited Conditions in an Irrigated Mediterranean Environment Evaluación del Modelo de Crecimiento de Arroz ORYZA2000 bajo Condiciones Limitadas de Nitrógeno en un Ambiente Mediterráneo Regado

    Directory of Open Access Journals (Sweden)

    Pamela Artacho

    2011-03-01

    Full Text Available ORYZA2000 is a growth model for tropical lowland rice ( Oryza sativa L. developed by the International Rice Research Institute and Wageningen University. This model has been evaluated extensively in a wide range of environments. However, reports examining japonica cultivars growing in temperate climates are scarce. In this study, ORYZA2000 was calibrated and evaluated using data from experiments carried out in the South-Central area of Chile. These experiments were performed on a japonica rice cultivar growing under an irrigated Mediterranean environment at various N rates. ORYZA2000 was then applied to explore potential yield and grain yield response to N fertilization under likely weather conditions in the major rice-producing area in Chile. ORYZA2000 was sufficiently accurate to simulate grain yield and crop N uptake at the end of the season. Final crop N uptake was simulated with a root mean squared error (RMSE of 20 kg ha-1 (15% and grain yield with a RMSE of 1666 kg ha-1 (19%. However, the prediction of biomass and N uptake of individual organs throughout the season was poor. A long-term simulation study confirmed a potential yield as high as 12 000 kg ha-1 in the Parral area, as well as the existence of a scope for yield increase. The yield response to N fertilization was predicted even at rates of 300 kg ha-1, although a significant probability of low yields was also observed. This trend supports the need to incorporate dynamic N management in Chilean rice production.ORYZA2000 es un modelo para arroz tropical regado desarrollado por el Instituto Internacional de Investigación en Arroz y Universidad de Wageningen, que ha sido evaluado en un amplio rango de ambientes. Sin embargo, los reportes para cultivares japónica creciendo en ambientes templados son escasos. En este estudio, ORYZA2000 fue calibrado y evaluado usando datos de experimentos realizados en el centro-sur de Chile, que incluyeron una variedad japónica cultivada bajo un

  9. Cambios anatómicos y morfológicos en plántulas de Eucalyptus sp. en respuesta a diferentes niveles de luz Anatomical and morphological changes in Eucalyptus sp. seedlings in response to different levels of light

    Directory of Open Access Journals (Sweden)

    Ana B. Guarnaschelli

    2009-12-01

    Full Text Available Se evaluaron respuestas en la anatomía y morfología de plántulas de Eucalyptus globulus subesp. globulus, Eucalyptus grandis y Eucalyptus camaldulensis creciendo bajo diferentes niveles de luz. Las plantas fueron expuestas a tres regímenes de iluminación: pleno sol (C, 50 % (S50 y 75% de restricción lumínica (S75 y regadas diariamente. Se midieron características morfológicas y anatómicas del follaje, se calcularon coeficientes foliares e índices de plasticidad. Al disminuir la disponibilidad lumínica, las plantas mostraron cambios asociados a la aclimatación a la sombra. Se observaron aumentos en el área foliar y en los coeficientes foliares. Paralelamente se detectaron disminuciones en el espesor de las hojas, de la epidermis, del parénquima en empalizada y en la densidad de estomas. La biomasa foliar y la biomasa total diminuyeron significativamente bajo el nivel S75. El aumento en el nivel de restricción lumínica produjo cambios proporcionales en el espesor de hojas y en el coeficiente de área foliar. Independientemente del nivel de sombra, se detectaron diferencias entre especies, que podrían asociarse a las condiciones ambientales de sus áreas de origen. Si bien se observaron algunas diferencias en los índices de plasticidad, los valores promedio de las tres especies fueron similares. Esto sugiere que, para los caracteres considerados en este estudio, el grado de aclimatación a la sombra fue similar.Responses in the anatomy and morphology of Eucalyptus globulus subsp. globulus, Eucalyptus grandis and Eucalyptus camaldulensis seedlings, growing under different levels of light were evaluated. Seedlings were submitted to three levels of irradiance: full sun (C, 50% (S50 and 75% of light restriction (S75 and irrigated daily. Morphological and anatomical characteristics were measured; foliar coefficients and indexes of plasticity were calculated. As light availability diminished, plants showed changes associated with shade

  10. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama The role of estrogen receptor alpha in breast cancer cell proliferation mediated by progestins

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.In C4-HD murine mammary carcinomas and in human breast cancer T47D cells, we showed that medroxyprogesterone acetate (MPA induces a nuclear physical association between estrogen receptor alpha (ERa and progesterone receptors (PR. The blockade of ERa inhibits cell proliferation mediated by progestins. We hypothesized that this nuclear association between ERa/PR is necessary to trigger progestin-induced cell proliferation and tumor growth. We demonstrated that fulvestrant (FUL, ICI182.780 induced complete regression of C4-HD tumors growing with progestins. MPA treatment induced an early increase in both CCND1 and MYC expression in T47D cells. The blockade of ERa

  11. INCENDIARIOS "Es preferible morir por el fuego, en combate, que morir en casa, por el hambre: Fidel Castro" Arson

    Directory of Open Access Journals (Sweden)

    Lisieux Elaine de BorbaTelles

    2012-09-01

    Full Text Available Antecedentes. El concepto de fuego siempre ha atraído la atención del hombre. En la literatura abundan referencias a este término, que tanto puede representar poder y pasión como terror y destrucción. El incendio es un delito de fácil ejecución, pero de difícil investigación. La prevalencia de este delito es de 1,13%. La incidencia de este crimen está creciendo alrededor del mundo, provocando un impacto social importante por las pérdidas financieras, muertes, lesiones físicas y secuelas emocionales dejadas en sus víctimas. El comportamiento incendiario puede ser observado desde la infancia, siendo que cerca de la mitad de los individuos presos por incendios se encuentran en la adolescencia. El consumo de alcohol está asociado a la conducta incendiaria, en la mitad de individuos que cometieron tal delito motivados por venganza. Objetivo. Revisar los estudios más recientes sobre el perfil de los incendiarios, las características diagnósticas, los factores de riesgo, la neurobiología, el tratamiento, la reincidencia y el pronóstico. Material y métodos. Revisión de la literatura. En la revisión de la literatura se encuentran que los incendiarios son una categoría heterogénea de criminales. Se torna interesante el desarrollo de una clasificación para los mismos, considerando las características del agresor, la presencia de eventual enfermedad mental, los aspectos del crimen y las motivaciones. Conclusión. Hasta el presente, la población de incendiarios estudiada es subrepresentada, pues apenas un pequeño porcentaje es enviado para evaluación diagnóstica y tratamiento. Se expone, así, una incongruencia entre los grandes daños emocionales y financieros, causadas por este delito, y la atención que él recibe de la comunidad científica.Background. The concept of fire has always attracted human attention. There are abundant references to the term in worldwide literature, representing power and passion as well as terror

  12. Técnica de mineração de dados: uma revisão da literatura Técnica de mineración de datos: una revisión de la literatura Data mining: a literature review

    Directory of Open Access Journals (Sweden)

    Noemi Dreyer Galvão

    2009-10-01

    Full Text Available Este artigo teve como objetivo realizar uma revisão da literatura sobre a técnica de mineração de dados (Data Mining - DM nas bases de dados abrangendo o Literatura Latino-Americana e do Caribe em Ciências da Saúde (LILACS, Scientific Eletronic Library Online (SCIELO e alguns livros sobre o tema. Buscou-se uma coleta ampla utilizando as palavras data mining e mineração de dados, abrangendo o período de 1999 a 2008. Como critérios de exclusão foram utilizados os descritores: indústria mineira, minas, mineralogia; foram excluídos artigos que não esclareciam o método e as tarefas relacionadas à mineração de dados. Dos 123 artigos encontrados, 32 foram selecionados. Observou-se que o volume de dados armazenados é gigantesco e continua crescendo exponencialmente. Com isso o processo de Descoberta do Conhecimento em Bases de Dados e DM inclui tarefas e métodos para extração de conhecimento útil, interessante e indispensável na tomada de decisões rápidas nas mais diversas áreas de conhecimento.En este artículo se tuvo como objetivo realizar una revisión de la literatura sobre la técnica de mineración de datos (Data Mining - DM en las bases de datos que abarcaban la Literatura Latino-Americana y del Caribe en Ciencias de la Salud (LILACS, Scientific Eletronic Library Online (SCIELO y algunos libros sobre el tema. Se buscó una recolección amplia utilizando las palabras data mining y mineración de datos, en el período comprendido entre 1999 a 2008. Como criterios de exclusión fueron utilizados los descriptores: industria minera, minas, mineralogía; se excluyeron artículos que no aclaraban el método y las tareas relacionadas a la mineración de dados. De los 123 artículos encontrados, 32 fueron seleccionados. Se observó que el volumen de datos almacenados es gigantesco y continúa creciendo exponencialmente. Con eso el proceso de Descubrimiento del Conocimiento en Bases de Datos y DM incluye tareas y métodos para

  13. Precios y oferta para el culantro castilla (Coriandrum sativum L. entre los principales mercados mayoristas de Costa Rica y Panama

    Directory of Open Access Journals (Sweden)

    Alexis Villalobos Monge

    2012-05-01

    Full Text Available Este artículo muestra los resultados del análisis compa- rativo de precios y volúmenes ofertados del culantro de castilla en los principales mercados mayoristas de Costa Rica y Panamá. Como antecedente se tiene la ejecución de una gira de prospección realizada en el 2009 a Ciudad de Panamá por parte de los colaboradores del proyecto “Investigación de mercados agrícolas” de la Estación Ex- perimental Fabio Baudrit de la Universidad de Costa Rica. En esta gira se detectó que el culantro castilla presentaba interesantes oportunidades de mercado gracias al precio y a la calidad del producto ofertado, razón por la cual se definió, como línea de trabajo, profundizar en aspectos de esta índole para determinar las particularidades de los principales mercados mayoristas de cada país en el caso de este alimento. Se llevó a cabo una revisión de series de tiempo para datos de precio y oferta emitidos por las fuentes encargadas de cada mercado, con los que se reali- zaron comparaciones de estadísticos y análisis de tenden- cia por regresión lineal, los cuales permitieron dimensionar las diferencias entre ambos sitios para enmarcar el com- portamiento del culantro castilla como potencial agrone- gocio, relacionado con el consumo a nivel de cada país. Entre los principales hallazgos, se puede mencionar que en Costa Rica históricamente ha existido un mayor con- sumo de esta hortaliza en comparación con Panamá, sin embargo, la tendencia detectada en Panamá, en cuanto a precios y volúmenes ofertados, está creciendo a mayor velocidad en este último mercado. Las diferencias prome- dio de precios pagados en Panamá superan por más del 100% a los pagados en Costa Rica por la misma unidad de comercialización según series mensuales para un periodo de 4 años, razón por la que se afinó la observación y se analizaron las plazas de comercialización para un total de 246 plazas mayoristas, donde se encontró que en el 94% de las veces

  14. Selected Abstracts of the 12th International Workshop on Neonatology; Cagliari (Italy; October 19-22, 2016

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2016-10-01

    . Neroni, P.P. Bassareo, G. Ottonello, M. PudduABS 23. KAWASAKI DISEASE IN SARDINIA: A SINGLE-CENTER EXPERIENCE • M.G. Clemente, G. Taras, P. Omeo, M. Pes, M. Pala, R. Mannazzu, R. AntonucciABS 24. COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT (CAVSD AND DOWN'S SYNDROME (DS: WHEN CARDIAC SURGERY IS NOT CORRECTIVE, BUT PALLIATIVE • D. Congiu, E. Aru, M. Furno, P. Neroni, P.P. Bassareo, S. Floris, M. Puddu, G. OttonelloABS 25. CONGENITAL ATRIOVENTRICULAR BLOCK: A CASE REPORT • F. Ayari, H. Chourou, H. Mannai, M. Cheour, I. Ksibi, M. Ben Amara, S. KacemABS 26. MISDIAGNOSED IDIOPATHIC SEVERE DILATED CARDIOMYOPATHY IN A 3-YEAR-OLD BOY • G. Passarella, S. Rossin, C. Santagati, F. Rigon, V. Rametta, M. Berardi, E. Michelin, C. Lorenzetto, F. Rimondi, F. Marino, S. Innaurato, S. Malengo, M. Leopardi, M.A. Padalino, O. Milanesi, S. RugolottoABS 27. DEVELOPING A TOOL FOR THE MANAGEMENT OF PEDIATRIC EMERGENCIES • G. Piras, G. Iasiello, P. Isoni, S. Marongiu, G. Cuna, A. Anedda, I. PirasABS 28. TRAINING IN NEONATAL INTENSIVE CARE UNITS: A THREE-YEAR INNOVATIVE EXPERIENCE IN NEONATAL INTENSIVE CARE UNITS IN ROME (ITALY • M.G. Torrioli, M.F. Coletti, M. D'Agata, M. Marconi, G. Riccio, C. Rogora, G. Seganti, M. Sergo, F. VallettiABS 29. HEPATIC HEMATOPOIESIS: A COMPLEX STEM CELL NICHE AND A DYNAMIC PROCESS • F. Angotzi, C. Gerosa, F. Lai, P. Van Eyken, Y. Gibo, D. FanniABS 30. INTRAOSSEOUS LINE FOR ADENOSINE ADMINISTRATION IN THE NEWBORN: A CASE REPORT • A. Lai, V. Masile, M. MarrasABS 31. CONGENITAL DACRYOCYSTOCELE: CASE REPORT • A. Culurgioni, F. Carta, A. Olla, E. Gioia, N. Chuchueva, R. PuxedduABS 32. HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS: THE GREAT DECEIVER • F. Lucca, A. Cappelleri, M. Guarnieri, M. Mauro, S. Spaggiari, L. Andaloro, S. Cesaro, P. BibanABS 33. SUBCLAVIAN VEIN CANNULATION IN NEONATES • D. Gaffo, R. Irmesi, N. Zadra, Z. Merchaoui, P. TissieresABS 34. IS "NARRATIVOMICS" AN OMICS SCIENCE? • K.S. McGreevy, G. DonzelliABS 35

  15. A AMBIGUIDADE DO AFETO: CRIMES PASSIONAIS E SUAS DIFERENTES MANIFESTAÇÕES

    Directory of Open Access Journals (Sweden)

    ALMEIDA, C.C.

    2015-12-01

    atingir e ferir o suposto objeto de amor começa a tomar características próprias, com o desejo de ferir este indivíduo da mesma forma que se está sofrendo. Essa reação nem sempre atinge o parceiro diretamente, mas pode atingir alguém que seja extremamente importante para a vítima, fato que teria força suficiente para causar imenso sofrimento. Essas duas características podem ser observadas em dois eventos: o conhecido caso da “Fera da Penha” e o recente caso da manicure de Barra do Piraí. Ambos são casos de crimes planejados sistematicamente que tiveram por principal objetivo atingir seu objeto de suposto amor através da agressão a quem lhe é mais caro – os filhos. É notório, em ambos os casos, a premeditação dos crimes e os atos de barbárie em nome do que os criminosos tinham como idealização de amor, porém, também houve a garantia de que a dor sentida fosse a do luto, causando assim o mesmo sentimento de perda vivenciado pelo autor do crime. Conclusões: O crime passional apresenta aspectos próprios e seu intento é sempre causar dor e profundo sofrimento no objeto de amor, seja sob a forma do assassinato e/ou tortura do mesmo, ou de alguém ou algo de extrema importância na vida do indivíduo, fato que, por si só, possui força suficiente para gerar infinita dor. Tal ato pode ser cometido impulsivamente, porém a literatura vem sistematicamente apontando para crimes que são planejados e executados com requintes de crueldade.

  16. A strategic learner for a new society Un aprendiz estratégico para una nueva sociedad

    Directory of Open Access Journals (Sweden)

    Bernardo Gargallo López

    2012-07-01

    1246 12.0 0 false 18 pt 18 pt 0 0 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:12.0pt; font-family:"Times New Roman"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Nuevos tiempos precisan de nuevos aprendices. En una escuela inmersa en la sociedad de la información, que queremos que sea del conocimiento, hace falta desarrollar nuevas actitudes y habilidades para el aprendizaje. El estudiante ha de aprender a desarrollar su autonomía y responsabilidad en un mundo abierto en que hay sobreabundancia de información y estímulos. Para ello hace falta que el estudiante llegue a ser “aprendiz estratégico”, una persona autónoma que quiere aprender para crecer, para sí y para los demás, teniendo como referente los valores, alguien que aprende a movilizar, observar, evaluar, planificar y controlar sus propios procesos de aprendizaje. Estamos hablando de aprendizaje autorregulado, de “aprender a aprender” Y, si bien es cierto que la escuela ha perdido su papel clave en la transmisión de la información, también lo es que se constituye en el espacio privilegiado para enseñar a aprender a aprender. La autorregulación, el pensamiento crítico, el compromiso cívico, etc. han de asentarse en la escuela para continuar creciendo luego, y se pueden y deben trabajar desde edades tempranas. En este trabajo presentamos claves para el desarrollo del aprendizaje estratégico en el sistema educativo.

  17. Uses of heritage, social action and tourism: towards a needed consensus - doi: 10.4025/dialogos.v12i1.34 Usos del patrimonio, acción social y turismo: hacia un necesario consenso* Usos do patrimônio, ação social e turismo: em busca de um necessário consenso - doi: 10.4025/dialogos.v12i1.34

    Directory of Open Access Journals (Sweden)

    Josep Ballart Hernández

    2010-05-01

    és del turismo. Este fenómeno, que constituye la industria cultural más importante de muchos países del mundo, está llamado a seguir creciendo en los próximos años, especialmente en Iberoamérica. En tanto que manifestación del dinamismo social que caracteriza en diversos campos a nuestras sociedades, el turismo cultural contribuye a su vez al progreso de la conciencia conservacionista y estimula la mejora de las prácticas conservacionistas y por ende de la gestión del patrimonio en su conjunto. Por tanto, en este contexto de cambio y desarrollo es muy pertinente la reflexión especializada sobre cómo utilizar de forma ventajosa el patrimonio, cómo encauzar su consumo individual (en términos turísticos y demás y qué nuevos equilibrios y consensos habrá que forjar al respecto, para que el tipo de desarrollo que buscamos se fundamente y se sustente en un desarrollo cultural real, participativo y equilibrado.A teoria do patrimônio nos adverte da contradição real que existe entre conservação e uso do patrimônio como se se tratasse de expressões excludentes. Porém, a chave de uma boa gestão do patrimônio consiste, precisamente, em encontrar saídas viáveis para este problema e em superar a dita contradição desfazendo esse nó gordiano da cultura material. O desafio é mais exigente nos tempos atuais e nos países com rápido desenvolvimento devido a que a forma mais usual e expansiva de dar um uso aos recursos culturais patrimoniais se produz através do turismo. Este fenômeno, que constitui a indústria cultural mais importante de muitos países do mundo, continuará crescendo nos próximos anos, especialmente na América Ibérica. O turismo cultural, enquanto manifestação do dinamismo social que caracteriza às nossas sociedades em diferentes âmbitos, também contribui para o progresso da consciência conservacionista e estimula a melhora das práticas conservacionistas e, por tanto, da gestão do patrimônio em seu conjunto. Por isto, neste

  18. Influencias de las variaciones en el clima y en la concentración de C0(2 sobre el crecimiento de Nothofagus pumilio en la Patagonia Influences of climatic and C0(2 concentration changes on radial growth oí Nothofagus pumilio in Patagonia

    Directory of Open Access Journals (Sweden)

    ANA M SRUR

    2008-06-01

    Full Text Available El objetivo de este trabajo fue evaluar las relaciones entre las variaciones en el clima y en la concentración de C0(2 durante el siglo XX con el crecimiento radial y la eficiencia en el uso del agua en los bosques de Nothofagus pumilio a lo largo de un gradiente altitudinal, en El Chaltén (49°22' S, Santa Cruz, Argentina. Se empleó una combinación de técnicas dendrocronológicas e isotópicas. Los patrones de crecimiento radial a lo largo del gradiente altitudinal reflejan las tendencias climáticas registradas en la zona durante el siglo XX. El crecimiento de los árboles ubicados en el límite superior muestra una tendencia positiva en respuesta al incremento regional de las temperaturas. Por el contrario, los bosques en contacto con la estepa patagónica presentan, en respuesta a una intensificación del déficit hídrico, una tendencia negativa de crecimiento durante el siglo pasado. Los árboles creciendo en bosques mésicos ubicados en alturas intermedias muestran una tendencia levemente negativa no significativa. Los valores de 6(13C reflejan en qué medida el contenido de humedad en el suelo regula en forma diferencial los procesos de conductancia estomática y tasa fotosintética a lo largo del gradiente altitudinal. En sitios donde el déficit hídrico varía desde leve a muy marcado, la eficiencia intrínseca en el uso del agua (EIUA parece estar influenciada por la disponibilidad de agua en el suelo. La relación entre la EIUA y las variables climáticas es más clara en sitios con reducido estrés hídrico. En sitios secos, el estrés hídrico muy marcado reduciría la tasa fotosintética en grado tal que el crecimiento no podría ser compensado por el aumento en EIUA. En contraste con el concepto tradicional en dendrocronología que postula una relación más estrecha entre el crecimiento radial y las variaciones climáticas en los bosques ecotonales, los valores isotópicos de 6(13C representan más claramente las

  19. SOIL-PLANT NUTRIENT INTERACTIONS IN TWO MANGROVE AREAS AT SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Ana Paula Lang Martins Madi

    2015-11-01

    Full Text Available ABSTRACTMangrove forests have a simple architecture. They shelter a few number of arboreal species that grow in a saline environment subject to tidal activity. The research objective was to evaluate possible interactions between physical-chemical soil attributes and plant-leaf nutrient concentrations of different mangrove species. Different mangrove species growing in the same soil, and the same mangrove species growing in two different soil classes were evaluated as to their leaf nutrient concentration patterns. The study was carried out in mangrove areas of the State of Paraná, southern Brazil, in two distinct soil classes: HISTOSOL THIOMORPHIC Salic sodic and GLEYSOL THIOMORPHIC Salic sodic; and three different species: Avicennia schaueriana, Laguncularia racemosa and Rhizophora mangle. Two subareas were delimited within each area from which soil and leaf samples were collected. Samplings from five individuals of each dominant mangrove species were taken from the soil (0-10 cm deep under each tree crown projection. The data was submitted to statistical analysis using a set of simple and multivariate analysis in order to determine possible differences among mangrove species leaf nutrient concentrations, and whether these differences might be correlated with the soil attributes or not. The results exposed that the nutritional state of the mangrove species is different and independent form the soil attributes in which they grow. Few correlations were found among leaf nutrient concentrations and soil attributes, suggesting differential selective nutrient uptake among species.RESUMENLos manglares son bosques de arquitectura simple que albergan pocas especies arbóreas, creciendo en un ambiente salino sometido a la influencia de las mareas. El objetivo de este trabajo fue evaluar las posibles interacciones entre las propiedades fisicoquímicas del suelo y la concentración de nutrientes en hojas de diferentes especies de mangle. Se investigó si

  20. Photosynthetic responses to temperature and light of Antarctic and Andean populations of Colobanthus quitensis (Caryophyllaceae Respuestas fotosintéticas a la temperatura y a la luz de poblaciones antarticas y andinas de Colobanthus quitensis (Caryophyllaceae

    Directory of Open Access Journals (Sweden)

    ÁNGELA SIERRA-ALMEIDA

    2007-09-01

    ínsula Antartica. A pesar de que ambos habitats se caracterizan por ser fríos y con temperaturas congelantes, existen importantes diferencias microclimáticas entre estos habitats durante el período de crecimiento. Por ello, sería esperable encontrar importantes diferencias en la respuesta del aparato fotosintético a factores abióticos entre poblaciones antarticas y andinas de C. quitensis. Estudiamos la relación de la fotosíntesis neta con la temperatura foliar y la intensidad lumínica en dos poblaciones de C. quitensis, una proveniente de La Parva en Los Andes de Chile central y la otra de la Isla Rey Jorge, en la Antartica marítima. Plantas de ambas poblaciones fueron crecidas en laboratorio a 15 °C y 250 μmol fotones m-2 s-1, con un fotoperíodo de 16/8 h luz/oscuridad. Veinte plantas de cada población fueron transferidas a una cámara a 4 °C, con las mismas condiciones de luz y fotoperíodo antes mencionadas, de modo de evaluar la capacidad de aclimatación de la fotosíntesis. A 15 °C, las poblaciones presentaron diferencias en su temperatura foliar óptima para la fotosíntesis. Estos óptimos fueron 24,0 °C en individuos provenientes de los Andes y 18,6 °C en individuos de la Antártida. En contraste, los individuos antarticos mostraron la más alta tasa de fotosíntesis neta bajo ambos tratamientos de temperatura, con puntos de compensación y saturación más bajos. Los individuos antarticos tuvieron mayor capacidad fotosintética a menores temperaturas que los individuos andinos. Nuestros resultados sugieren que C. quitensis ha adaptado el desempeño fotosintético de individuos creciendo en diferentes localidades a las condiciones climáticas predominantes en dichas localidades. Las diferencias en las respuestas fotosintéticas a la temperatura y a la luz son discutidas en relación a la diferenciación ecotípica entre las dos poblaciones estudiadas

  1. Analysis of the re-colonization of San Benito Archipelago by Guadalupe fur seals (Arctocephalus townsendi Análisis de la recolonización del archipiélago de San Benito por el lobo fino de Guadalupe (Arctocephalus townsendi

    Directory of Open Access Journals (Sweden)

    Manuel Esperón-Rodríguez

    2012-03-01

    -colonización y el estado actual del LFG en el ASB. También se informan los primeros nacimientos y la ocupación de la isla del Oeste del ASB. Con base en los censos de 1997 a 2007, la población creció con una tasa de incremento anual de 21,6%. Se estudió el tamaño de la población, la tendencia de crecimiento de la colonia, biología reproductiva y preferencias alimentarias. Se contaron 2,227 individuos en el ASB. Tres especies de calamar se encontraron como el principal componente de la dieta (Loligo opalescens, Onychoteuthis banksii y Dosidicus gigas. La territorialidad, los patrones de actividad y el comportamiento reproductivo, muestran una conducta similar entre los individuos de isla Guadalupe y ASB. Se calculó la tasa de crecimiento promedio de las crías del ASB y se comparó con la tasa de crecimiento de las crías de isla Guadalupe (ASB: 6.7 ± 1.4 kg y 68,9 ± 2.64 cm; isla Guadalupe 5.9 ± 0.5 kg, y 67.29 ± 4.3 cm. Se midió la duración de los viajes de alimentación de las hembras, indicando que la colonia de San Benito probablemente se encuentra cerca de una importante zona de alimentación. En cuanto a los patrones de asistencia materna, estos podrían indicar una estrategia de lactancia-viajes de alimentación diferente entre SBA e isla Guadalupe. Se puede esperar que la población de lobos finos en San Benito siga creciendo, ya que no hay limitantes en cuanto al espacio reproductivo y los recursos alimenticios disponibles en la zona.

  2. Pobreza urbana e degradação ambiental: algumas reflexões sobre Curitiba, Brasil. Urban poverty and environmental degradation:considerations on Curitiba, Brasil Pobreza urbana y deterioro ambiental: algunas reflexiones sobre Curitiba, Brasil.

    Directory of Open Access Journals (Sweden)

    Madianita Nunes da Silva

    2011-06-01

    the analysis of the city of Curitiba, Parana, Brazil, the text discusses the relationship between illegal occupations, urban poverty and environmental degradation. It seeks to demonstrate that, despite being a reference in urban planning, Curitiba is no exception to the pattern of most Latin American cities, where predominate the socio-spatial segregation and environmental degradation. This pattern is due to the production of the city according to the logic of capitalism, which expels to inappropriate areas that portion of the population whose income does not allow to pay the costs of a good location. Given that in Latin American urban poverty is rising, and the city being structured based on market laws, it seeks to demonstrate that there is a trend of risk urbanism to consolidate itself as a prevailing practice.Este trabajo reflexiona sobre el concepto de urbanismo de riesgo. Al mirar la ciudad de Curitiba, en Paraná, Brasil, el texto analiza la relación entre las ocupaciones irregulares, la pobreza urbana y la degradación del medio ambiente. A pesar de constituirse en referencia de planificación urbana, Curitiba no es una excepción al patrón de las ciudades de América Latina, dominadas por la segregación socioespacial y la degradación del medio ambiente. Este patrón es resultado de la producción de la ciudad según la lógica capitalista, que expulsa para zonas inadecuadas a la población cuyos ingresos no cubren los costos de una buena ubicación. Dado que en América Latina la pobreza urbana está creciendo y la ciudad se estructura a partir de las leyes del mercado, el trabajo pretende demostrar que existe una tendencia hacia la consolidación del urbanismo de riesgo como práctica predominante.Abstract:Curitiba, Parana, Brazil, the text discusses the relationship between irregular occupations, urbanpoverty and environmental degradation. It seeks to demonstrate that, despite being a reference in urban planning, Curitiba is no exception to the pattern

  3. Risk factor control in hypertensive and diabetic subjects attended by the Family Health Strategy in the State of Pernambuco, Brazil: the SERVIDIAH study Control de los factores de riesgo en hipertensos y diabéticos seguidos por la Estrategia Salud de la Familia en el estado de Pernambuco, Brasil: estudio SERVIDIAH Controle dos fatores de risco em hipertensos e diabéticos acompanhados pela Estratégia Saúde da Família no Estado de Pernambuco, Brasil: estudo SERVIDIAH

    Directory of Open Access Journals (Sweden)

    Adriana Falangola Benjamin Bezerra

    2013-06-01

    sobrepeso u obesidad, pocos informaron estar siguiendo una dieta para perder peso. El estudio, en esta muestra representativa de hipertensos y diabéticos registrados en la ESF de Pernambuco, muestra qué mejorías se deben buscar a fin de perfeccionar la prevención de las complicaciones de esos problemas, cuya incidencia está creciendo.O estudo SERVIDIAH (Avaliação de Serviços de Atenção Básica à Saúde para Diabéticos e Hipertensos foi realizado em 2010 no Estado de Pernambuco, Brasil. Foi constituída uma amostra aleatória de 785 hipertensos e 823 diabéticos oriunda dos cadastros de 208 equipes da Estratégia Saúde da Família (ESF sorteadas em 35 municípios do estado. Os usuários foram entrevistados por meio de formulário padronizado, e tiveram aferição de peso, altura e pressão arterial e, para os diabéticos, da hemoglobina glicada (HbA1c. A idade média foi em torno de 60 anos, com sobrerrepresentação de mulheres (70%. A pressão arterial foi controlada em 43,7% dos hipertensos e 25,8% dos diabéticos; 30,5% dos diabéticos apresentaram HbA1c abaixo de 7%. Apesar de 70% apresentarem sobrepeso ou obesidade, poucos referiram estar seguindo dieta para perder peso. O estudo, nesta amostra representativa de hipertensos e diabéticos cadastrados na ESF de Pernambuco, mostra que melhorias devem ser buscadas a fim de aprimorar a prevenção das complicações desses agravos, cuja incidência está crescente.

  4. (GEHO Grupo español del hormigón

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1986-12-01

    by its inscription at the Madrid Provincial Registry of Associations, N.P. 6.771 of July 4th 1985.

    El Comité Europeo del Hormigón (CEB fue fundado en 1957 con el objeto de desarrollar, a nivel internacional, el estudio de toda cuestión científica y técnica susceptible de hacer progresar la construcción en hormigón. Entre sus seis miembros fundadores figuraba el profesor español Eduardo Torroja. Desde esa fecha, el prestigio alcanzado por el CEB ha ido creciendo continuamente, gracias a los trabajos y publicaciones realizados. Por otra parte, desde 1976 en que se reformaron sus Estatutos, el CEB ha pasado a denominarse Comité Euro-Internacional del Hormigón, con lo que admite en su seno a cualquier país del mundo. En la actualidad, los países miembros pasan de cuarenta. En España, la vinculación con el CEB ha venido siendo asegurada tradicionalmente por el Instituto de la Construcción y del Cemento "Eduardo Torroja" (lETcc, perteneciente al Consejo Superior de Investigaciones Científicas, quien centralizaba las relaciones tanto técnicas como administrativas. Esta labor del Instituto ha sido muy positiva y de ella se han beneficiado, directa o indirectamente, gran número de expertos y profesionales españoles del sector de la construcción. En particular, la normativa técnica española del sector del hormigón está basada en los trabajos del CEB. El desarrollo creciente de la técnica del hormigón en nuestro país, en sus distintas vertientes de investigación, docencia, proyecto, cálculo, construcción, control de calidad, etc., ha traído consigo que el número de profesionales interesados en el CEB sea hoy considerable. Ello aconseja la creación de una Asociación, al amparo de la Ley de 24 de Diciembre de 1964, que pueda servir de cauce a todas las actividades que se derivan de la pertenencia al CEB, potenciando con ello la participación de los expertos españoles en tan prestigiosa organización. A esta idea de participaci

  5. Estudo comparativo entre ultrassom e neuroestimulação no bloqueio do plexo braquial pela via axilar Estudio comparativo entre ultrasonido y neuroestimulación en el bloqueo del plexo braquial por la vía axilar A comparative study between ultrasound and neurostimulation guided axillary brachial plexus block

    Directory of Open Access Journals (Sweden)

    Diogo Brüggemann da Conceição

    2009-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O uso do ultrassom em Anestesia Regional vem crescendo. Existem poucos estudos comparando o uso do ultrassom com a neuroestimulação. O objetivo deste estudo foi comparar a execução do bloqueio do plexo braquial pela via axilar guiado por neuroestimulação com dupla injeção e guiado por ultrassonografia em procedimentos cirúrgicos na mão. Para isto, foram comparados o tempo de realização, a taxa de sucesso e complicações. MÉTODO: Após a aprovação do Comitê de Ética em Pesquisa do Hospital Governador Celso Ramos foram selecionados 40 pacientes escalados para operações eletivas na mão com bloqueio de plexo braquial via axilar. Os pacientes foram distribuídos aleatoriamente eletronicamente em dois grupos de 20 pacientes: Grupo Neuroestimulação (NE e Grupo Ultrassonografia (US. Foram comparados tempo de realização, taxa de sucesso e taxa de complicações. RESULTADOS: As taxas de bloqueio completo, falha parcial e falha total não apresentaram diferença estatística significativa entre os grupos US e NE. O tempo médio para realização do procedimento no grupo US (354 segundos não apresentou diferença estatística significativa quando comparado ao grupo NE (381 segundos. Pacientes do grupo NE apresentaram maior taxa de punção vascular (40% quando comparados ao grupo US (10%, p JUSTIFICATIVA Y OBJETIVOS: El uso del ultrasonido en Anestesia Regional ha venido creciendo. Existen pocos estudios comparando el uso del ultrasonido con la neuroestimulación. El objetivo de este estudio, fue comparar la ejecución del bloqueo del plexo braquial por la vía axilar, guiado por neuroestimulación con doble inyección y guiado por ultrasonido en procedimientos quirúrgicos en la mano. Para eso, se compararon el tiempo de realización, la tasa de éxito y las complicaciones. MÉTODO: Después de la aprobación por parte del Comité de Ética en Investigación del Hospital Governador Celso Ramos, se

  6. Uso de software libre en las empresas colombianas

    Directory of Open Access Journals (Sweden)

    Carlos Nelson Henrìquez Miranda

    2009-01-01

    Full Text Available ResumenActualmente las empresas usan la tecnología de punta para apoyar sus procesos comerciales, sin embargo en elámbito local podemos darnos cuenta que existen muchas empresas que no tienen conocimiento de la existenciade herramientas informáticas (software que les ayuden en sus labores empresariales. Algunos empresarios pordesconocimiento adquieren aplicaciones de software (propietario que son muy costosas y las cuales usan en unporcentaje muy bajo de sus verdaderas funcionalidades. Entonces hacen una gran inversión que no es redimibleen el futuro porque necesitan demasiadas asesorías y consultorías de estas empresas que comercializan la herramienta.Además si las empresas van creciendo e incluyen nuevas estaciones de trabajo, se necesita comprarmás software, porque este tipo de producto se vende normalmente bajo el término de licencia propietaria. Entoncesencontramos dos situaciones, aquellas empresas que no invierten en software porque es muy costoso, y aquellasque lo hacen pero a la inversión hecha, que a veces es muy alta, no le sacan provecho real por desconocimiento, odebido a una mala asesoría. Ante esta situación hay que buscar nuevas alternativas para lograr que las empresaspequeñas y medianas logren tener en sus manos todas las bondades que trae el uso de la computación (rapidez,eficiencia, organización entre otras. Una opción para este problema es la adopción de programas que no tienencosto o su costo es relativamente bajo, estos programas están enmarcados en el movimiento conocido como “SoftwareLibre”. Este nace como alternativa para uso de productos de una buena calidad a un bajo costo que permitala sistematización parcial o total de las empresas, además de usar programas ofimáticos para el manejo de lainformación de las oficinas.El uso de Software Libre en las empresas colombianas permitirá aumentar sus nivelesde competitividad, bajando un poco la inversión en software y mantenimiento, logrando una

  7. Incorporación de elementos traza en conchas de Melanopsis durante el crecimiento: posibilidades de aplicación en paleoecología

    Directory of Open Access Journals (Sweden)

    Alonso, J. J.

    1988-12-01

    stas tienen que ver, o no, con la fluctuación de una serie de parámetros ambientales. La importancia del trabajo radica en la posibilidad de la aplicación paleoecológica de sus resultados, ya que el género Melanopsis tiene un abundante registro fósil durante todo el Cenozoico. La incorporación de oligoelementos se efectúa a medida que la concha va creciendo por acreción; lo ideal sería que tal crecimiento fuera circadiano, ya que se podría seguir día a día, sobre la concha, la fluctuación de sus componentes químicos. Sin embargo, nuestro trabajo muestra que, para esta especie, ello no es así. La tasa de acreción, tanto si se mide en función de los incrementos segregados por unidad de tiempo como del espesor segregado durante un período fijo, es función del tamaño de la concha para la misma población. Una primera campaña, de un mes de duración, ha revelado que en aquellas conchas, cuya tasa de acreción coincide con el número de días, las composiciones químicas de cada línea de crecimiento no parecen tener una relación de carácter fijo con las variaciones diarias de los parámetros del medio. Parece haber unos organismos más sensibles que otros a tal variación. Ello, pues, probablemente sea atribuible a variabilidad genética en cuanto a la capacidad de filtrado de los distintos iones. Durante un período de siete meses, en que la variación más significativa corresponde a la temperatura, uno de los morfotipos presenta variaciones de composición química correlacionadas con las variaciones de los parámetros del medio, mientras que el otro no muestra tendencias claras al respecto. La posibilidad de ritmos circadianos de acreción en caparazones de invertebrados está en contradicción con los resultados obtenidos en este estudio. Sería interesante analizar casos dados como válidos desde las perspectivas que aquí se abren. Las posibilidades de aplicación paleoecológica son también bajas, al menos para el género aquí estudiado.

  8. BAELO CLAUDIA Y POLLENTIA: NUEVAS EVIDENCIAS SOBRE LAS FLUCTUACIONES ECONÓMICAS EN LA HISPANIA ROMANA DE LOS SIGLOS I-II D. C. (Baelo Claudia and Pollentia: new evidence on the economic fluctuations in Roman Spain during the first and second centuries AD

    Directory of Open Access Journals (Sweden)

    Pascual Izquierdo-Egea

    2012-06-01

    Full Text Available La revisión cronológica de la necrópolis sureste de Baelo Claudia (Bolonia-Tarifa, Cádiz y la de Can Fanals, en Pollentia (Alcudia, Mallorca, ha permitido ampliar el conocimiento sobre las fluctuaciones económicas en la Hispania romana de los siglos I y II de nuestra era y los cambios sociales asociados a las mismas. Se ha obtenido una nueva confirmación del impacto de la gran crisis de tiempos de Tiberio en los registros funerarios de Baelo Claudia y Pollentia, detectada previamente en Ampurias o Emporiae (Gerona. La bonanza de la época de Claudio se puede comprobar en Baelo Claudia de forma más elocuente que en Emporiae. Ahora bien, esta coincidencia en el devenir económico se rompe a lo largo de la segunda mitad del siglo I d. C., en concreto durante el periodo comprendido entre Nerón y principios de los Flavios. Es entonces cuando, frente a la decadente Ampurias, una pujante Pollentia sigue los pasos de la opulenta Baelo mostrando su mayor prosperidad. Sin embargo, esas tres ciudades romanas de Hispania mantienen un claro nexo basado en la exhibición durante ese periodo de su máxima complejidad social. Siempre se da una proporción directa entre la acumulación económica amortizada en los ajuares y la diferenciación entre los individuos, salvo en dos casos excepcionales. Uno, ya conocido, se refiere a la Ampurias de la segunda mitad del siglo I d. C., donde el empobrecimiento que la caracteriza se asocia con un incremento de la distancia social. Y, el otro, corresponde al extraño fenómeno documentado en la Pollentia del siglo II d. C. En esta sigue creciendo el gasto funerario, pero la diferenciación social medida desciende durante la primera mitad hasta caer abruptamente a lo largo de la segunda parte de dicha centuria. No obstante, lo más importante es que, por ahora, se detecta la misma evolución de la diferenciación social en Emporiae, Baelo Claudia y Pollentia desde la época de Tiberio hasta la primera mitad del

  9. Carta al Editor

    Directory of Open Access Journals (Sweden)

    Darío Maldonado Romero

    1991-03-01

    establecidos estalló la Primera Guerra Mundial y en su calidad de Alsacianos fueron internados en un campo de concentración y el Doctor empezó a escribir su Filosofía de la Civilización. El Respeto a la Vida infundióle ánimo para soportar las dificultades que los abrumaron al ser remitidos a Europa al Campo de Concentración de Sr. Remy. Cuando se firmó el Armisticio habían almacenado fortaleza física y espiritual.

    Estaba más decidido que nunca a ir a donde mas lo necesitaran yen 1924 volvió al África a su hospital haciéndose a fondos con recitales de órgano y dando conferencias para proseguir su obra en Lambarené. Tendría que pasar largos períodos reclutando dineros, dando conferencias y recibiendo distinciones en diversos países.

    La ciudad de Francfort le confirió un premio en dinero, en memoria de Goethe, por “servicios a la comunidad” y la Reina Isabel lo honró con la Insignia de Miembro Honorario de la Orden del Mérito, que solamente había sido concedida a otro, no británico, el Presidente Eisenhower.

    En 1939 se declaró la Segunda Guerra Mundial y las dos fuerzas, la de Vichy y la de Francia Libre, sobrevolaron con sus aviones sobre el pueblito de Lambarené, quedando los alsacianos como franceses; el trabajo en el hospital había disminuido mucho pero después de algún tiempo llegó como visitante distinguida la esposa del Doctor a quien éste le había agradecido mucho que le hubiera dejado volver solo. En mayo de 1945 terminó la guerra.

    El hospital nuevamente iba creciendo. El Doctor trataba de escribir un poco cada noche, pero, si había enfermos graves, prefería atenderlos; en una sala se celebraban oficios religiosos y el doctor predicaba con dos intérpretes, que repetían sus palabras en las dos lenguas nativa” principales, sobre temas sencillos como las parábolas del hijo pródigo y el buen samaritano.

    La nauseabunda medicación chalmúgrica oral y la dolorosa ineficacia de los esteres inyectados

  10. Historia del tratamiento de la Sífilis The history of Syphilis´ treatment

    Directory of Open Access Journals (Sweden)

    R M C Leitner

    2007-03-01

    Full Text Available El nombre sífilis proviene del griego siph: cerdo y philus: amor. Recuerda al personaje de una obra, llamado Syphilo, que fue castigado por los dioses a sufrir una terrible enfermedad. Se analizan los datos sobre la sífilis en la antigüedad (que difieren según su fuente. Su mención en la Edad Media, su controversial origen, la ayuda de los paleopatólogos para encontrarlo. Luego de la Revolución Francesa y el inicio de la Edad Contemporánea, el porcentaje de enfermos fue creciendo y se acentuó la segregación de los mismos por la sociedad. Desde el año 1500 hasta principios del siglo XX el tratamiento de la sífilis dependía del mercurio. Tenía una gran variedad de formas de aplicación. La vía tópica: el ungüento gris, en calomelano o tabletas, en inyecciones, en fricciones y fumigaciones en donde el mercurio se introducía en el cuerpo por lo pulmones. Se adjudicó a la madera del guayaco pretendidas características curativas, que no poseía. Los ioduros se utilizaron para el terciarismo. Ehrlich en 1907, patentó el compuesto 606 o Salvarsan y en 1910, el Neo-Salvarsan o Arsfenamina (compuesto 914. Por estos descubrimientos recibió el Premio Nobel. En 1887, Julios Wagner Jauregg sugirió que la fiebre terapéuticamente inducida era útil en el tratamiento de enfermos psicóticos. En 1912 publicó sus satisfactorios resultados al tratar la paresias con una combinación de mercurio-iodo y tuberculina de Koch. En 1917 ingresó a su servicio un enfermo de malaria, con cuya sangre escarificaron la piel palúdica de tres paréticos, en lugar de darle inmediatamente quinina. Por ello fue galardona con el Premio Nobel. Se utilizó luego el bismuto, a partir de 1922, pero posteriormente fue sustituido por las sulfamidas, de aplicación dificultosa. El avance terapéutico más importante ocurrió en 1943, año en que se comenzó a utilizar la penicilina por Mahoney y colaboradores. Luego se confirmó la eficacia de la tetraciclina para

  11. Leaf phenology and its associated traits in the wintergreen species Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae Fenología foliar y sus caracteres asociados en la especie invierno-verde Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae

    Directory of Open Access Journals (Sweden)

    MARÍA ANGÉLICA DAMASCOS

    2001-12-01

    Full Text Available The post-summer leaf demography of the wintergreen species Aristotelia chilensis growing near San Carlos de Bariloche, Argentina, is described. Its specific leaf mass (SLM, g m-2 is compared to that of the deciduous and evergreen species of the Andean-Patagonian forests and to that of other communities abroad. The pattern of leaf emergence is intermediate, with leaf flush in spring (basal cohort, BC, followed by successive unfolding of the remaining leaves (distal cohort, DC during summer. The senescence of the BC occurs mainly in autumn, with a loss of 11-31 % of its SLM. The DC falls synchronously in mid-spring and the SLM loss in winter is 10-13 %. The SLM of A. chilensis (103.6 ± 6.2 g m-2 is intermediate when compared to the general mean values of deciduous (73.7 ± 15.9 g m-2 and evergreen species (154.8 ± 45.8 g m-2. The SLM of deciduous and evergreen species of three different forests near San Carlos de Bariloche varied significantly at the end of the growing season while that of A. chilensis showed more constant values. The periodicity of leaf production and senescence in A. chilensis allows the maintenance of one leaf cohort throughout the year, covering the carbon demand for flowering and leaf production in spring. This differentiates the deciduous from the wintergreen species, despite their similar mean leaf life span values, while the evergreen species have a longer leaf turnover. Considering the conditions for growth in each studied forest, the leaf life span was not the only factor determining the SLM value. This variable would also depend on multiple stresses that may act during the ontogenesis and evolution of the leaves in each phenological groupSe describe la demografía foliar después del verano de la especie invierno-verde Aristotelia chilensis, creciendo cerca de la ciudad de San Carlos de Bariloche, Argentina. Se compara su peso específico foliar (SLM, g m-2 con los valores de especies deciduas y siempreverdes de los

  12. Alergia ao látex em paciente com síndrome de Kabuki: relato de caso Alergia al látex en paciente con síndrome de Kabuki: relato de caso Latex allergy in a patient with Kabuki syndrome: case report

    Directory of Open Access Journals (Sweden)

    Vera Coelho Teixeira

    2010-10-01

    conocimiento del profesional de Anestesiología sobre los aspectos específicos de pacientes portadores de síndromes raros, es una necesidad que ha venido creciendo, pues cada vez más, esos pacientes son derivados a los quirófanos. Nuestro objetivo es describir un caso de alergia al látex que ocurrió en uno de esos pacientes con diagnóstico del Síndrome de Kabuki, y cuyos aspectos todavía no fueron completamente aclarados, alertando a los anestesiólogos en cuanto a la posibilidad de esa asociación. RELATO DEL CASO: Paciente de 11 años, con diagnóstico de Síndrome de Kabuki, que fue admitida para exéresis de lesiones de las partes blandas. Presentaba un historial de reacciones alérgicas previas posteriores a los procedimientos quirúrgicos de pequeño porte. Con la necesidad de realizar un nuevo procedimiento, y después de la evaluación preanestésica, la paciente fue derivada a un alergista que la sometió a pruebas cutáneas las cuales confirmaron la hipótesis de alergia al látex. Una vez más fue enviada al quirófano para exéresis de las lesiones bajo anestesia general. Fueron tomadas todas las precauciones con el objetivo de evitar nuevas manifestaciones clínicas. El procedimiento transcurrió sin intercurrencias y la paciente recibió alta el mismo día, sin que presentase ningún tipo de complicación, lo que reforzó mucho más el diagnóstico. CONCLUSIONES: El Síndrome de Kabuki parece tener un curso relativamente benigno en su historial natural. Sin embargo, existen muchos aspectos que todavía necesitan ser aclarados y por lo tanto, no descartamos la posibilidad de la asociación de esa patología con otras condiciones que son del interés del anestesiólogo. Esa descripción tiene el objetivo de alertar sobre el riesgo de la asociación de ese síndrome con la alergia al látex. Para tanto, debemos incentivar la evaluación preanestésica de esos pacientes, la realización de una anamnesis correcta y el análisis de otros factores

  13. Crecimiento demográfico y cambio climático

    Directory of Open Access Journals (Sweden)

    Wilfredo Bulege Gutiérrez

    2013-06-01

    Full Text Available El mundo seguirá creciendo. Las más recientes proyecciones de las Naciones Unidas no prevén todavía un punto de inflexión en el crecimiento poblacional en el transcurso del presente siglo, pero se estima que, dadas las tendencias demográficas registradas, para mediados de siglo seremos alrededor de 9 mil 300 millones de habitantes en el planeta. La dinámica demográfica es la principal fuerza conductora del cambio ambiental global, pues constituye una presión para ocupar cada vez más espacios, explotar más recursos, producir más alimentos, consumir más agua, contaminar más, utilizar más energía y emitir más gases de efecto invernadero (1. La disminución del crecimiento demográfico resulta un requisito necesario para reducir las emisiones de carbono en el futuro; sin embargo, se objeta que ello puede dar lugar a programas de “control demográfico” en los países en desarrollo. Y como se sabe, estos países se verían afectados gravemente por el cambio climático; desde tal perspectiva ha sido identificado por lo menos una de tres posibles formas de interacción entre las tendencias demográficas y los efectos del cambio climático: (i un rápido deterioro de las fuentes de recursos naturales, (ii mayordemanda de recursos escasos y (iii el aumento de la vulnerabilidad humana a fenómenos meteorológicos extremos (2. Resultados de investigaciones indican que habría que ofrecer más posibilidades de acceso voluntario a los servicios de planificación familiar a las comunidades pobres de los países menos adelantados. Este enfoque prioriza el bienestar de las comunidades pobres afectadas por el cambio climático, a diferencia de la otra postura que propone la reducción del crecimiento de la población a fin de limitar el aumento de las emisiones de carbono mundiales (2. El crecimiento poblacional aumenta la demanda de bienes y servicios, sin duda implica una mayor presión ambiental. Al mismo tiempo, el crecimiento econ

  14. Secondary Education in Afghanistan: a portray of postconflict education reconstrution

    Directory of Open Access Journals (Sweden)

    Juan Manuel Moreno Olmedilla

    2005-01-01

    importante: Dependiendo de la región o la provincia, la tasa de escolarización de las niñas en secundaria varía desde el 34 por ciento hasta el 0. Todavía hoy hay provincias enteras en que ni una sola niña está matriculada en la escuela secundaria superior. A todo esto se une la limitación impuesta por el escaso número de profesores ¿ y sobre todo de profesoras ¿ de secundaria tanto en determinadas regiones y provincias como en ciertas áreas curriculares (matemáticas y ciencias especialmente. El casi exclusivo énfasis actual, en buena medida impulsado por las distintas organizaciones donantes, sobre la educación primaria y en la universitaria, no permite anticipar que se vayan a llevar a cabo las reformas y las inversiones necesarias en el sector de la secundaria. Y no es necesario insistir en que ello puede llevar a desequilibrios importantes en el sistema educativo afgano, que al no poder hacer frente a la demanda de secundaria, podría ver cómo disminuyen ¿ o no siguen creciendo como es necesario ¿ las tasas de graduación en la primaria, cómo se amplía el déficit de profesorado tanto de primaria como de secundaria, y cómo continúan sin abrirse las puertas de la educación superior a las mujeres. Conseguir universalizar la educación secundaria de primer ciclo ¿ ya obligatoria, como se ha dicho ¿ va a requerir políticas muy decididas y orientadas a colectivos específicos. La provisión de escolarización habría de concentrarse en provincias, distritos y grupos étnicos muy específicos, además de las mujeres, que en principio no tienen asegurada su inclusión en un sistema que está en rapidísimo crecimiento

  15. Situación y tendencias epidemiológicas de la infección por VIH/SIDA en Colombia

    Directory of Open Access Journals (Sweden)

    Ricardo Luque Núñez

    2004-03-01

    heterosexual, 28,3% homosexual y 16,8% bisexual, para un total de 96% transmitidos por vía sexual, 3,1% perinatal, 0,67% transfusional, 0,11% en usuarios de drogas intravenosas y 0,12% por otras formas. Por otro lado, en el estudio centinela realizado en el año 2000 (2, se encontraron prevalencias por encima de lo esperado en departamentos de la costa atlántica, lo que sugiere una tendencia a una epidemia generalizada en estos sitios. Las mujeres representan el 18% de los casos, pero este número continúa creciendo y la relación hombre-mujer sigue siendo cada vez más cercana, con una relación de 3:1 promedio en el país, que en algunos departamentos puede ser de 2:1. El 52.86 % de los casos por VIH se presenta en personas entre los 15 y los 35 años, lo que quiere decir que este grupo poblacional, probablemente, se infectó antes de los veinte años de edad.

    La tendencia de la epidemia es creciente y las curvas no parecen aplanarse de la forma como se ha logrado en otros países. Según las proyecciones, si las intervenciones no logran su efecto o no se les da la sostenibilidad requerida, para el año 2010 tendremos una prevalencia cercana al 1.5%, lo que representará un número estimado de 800.000 casos.

     

    REFERENCIAS

    1. INSTITUTO NACIONAL DE SALUD. Estudio de prevalencia al VIH con HSH en Bogotá, Liga Colombiana de Lucha contra el SIDA, 2000.

    2. INSTITUTO NACIONAL DE SALUD. Estudio Centinela Nacional, 2000.

  16. Selected Abstracts of the 9th International Workshop on Neonatology; Cagliari (Italy; October 23-26, 2013

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2013-06-01

    Full Text Available Selected Abstracts of the 9th International Workshop on Neonatology • LEARNED LESSONS, CHANGING PRACTICE AND CUTTING-EDGE RESEARCH • Cagliari (Italy • October 23rd-26th 2013The Workshop has been organized on behalf of Union of European Neonatal and Perinatal Societies, Union of Mediterranean Neonatal Societies, Italian Society of Neonatology, UNICEF, and under the High Patronage of the President of the Italian Republic. ABS 1. Aetiology and type of reference hospital for neonatal transport in Greece during 2012 • S. Mouskou, C. Varakis, D. Pyrros, N. Iacovidou; Athens (Greece ABS 2. Changes in neonatal outcomes of very low birth weight infants in Hospital of Lithuanian University of Health Sciences • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 3. Autoimmune liver disease in childhood • Y. Gibo, D. Fanni, P. Van Eyken, S. Nemolato, G. Floris, C. Gerosa; Matsumoto (Japan, Leuven (Belgium and Cagliari (Italy ABS 4. Lactoferrin attenuates intestinal injury afther perinatal hypoxia and hypothermia • N. Barisic, G. Konstantinidis, V. Stojanovic, A. Doronjski, S. Spasojevic; Novi Sad (Serbia ABS 5. Osteopenia in prematurity: case report • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 6. Neonatal Bartter syndrome: case report of a very unusual entity • A. Koutroumpa, K. Georgiou, H. Georgaki, F. Anatolitou; Athens (Greece ABS 7. Placental Growth Factor (PlGF and placental function • I. Atzeni, S.F. Deiana, A. Meloni, B. Piras, P. Zedda, S. Soddu, G. Parodo, G. Faa, G.B. Melis, A.M. Paoletti; Cagliari (Italy ABS 8. Neonatal ECMO: initial experience of Hospital de São João • G. Rocha, P. Soares, T. Henriques-Coelho, J. Correia-Pinto, J. Monteiro, H. Guimarães, R. Roncon-Albuquerque Jr; Porto (Portugal ABS 9. GCMS-based metabolomics analysis of urines in hypoxic neonatal piglets • C. Fattuoni, L. Barberini, N. Iacovidou, T