WorldWideScience

Sample records for bledo pira creciendo

  1. Activities on PIRA Researches and its Applications in Korea

    International Nuclear Information System (INIS)

    Yoo, Kunjoong; Chae, Sungki; Choi, Youngsang; Roh, Myungsub

    1986-01-01

    Since 1979, activities on the developments of PIRA methodologies and procedures, and its application as well as the safety goal establishment have increased because of the important benefits which may be derived from the uses of PIRA. PIRA is used in many areas including safety evaluation, preparation of basis of standards, siting of nuclear facilities, operator training, energy technology comparison, design, safety improvement(backfitting), operating procedure changes, test and maintenance procedure development, safety goal establishment, and plant availability improvement. Especially, vendor countries are utilizing PIRA methods for parts of the safety demonstration for proposed power plants. In this connection, Korea began to take a interest in PIRA in 1979. Since then, basic methodologies and computer codes of PIRA have been introduced, modified, and applied to Korea nuclear power plants

  2. Bromeliaceae from Pico Piraí, Guaratuba Municipality (Parana, Brazil Bromeliaceae Juss. do Pico Piraí, município de Guaratuba (Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Rosemeri Morokawa

    2011-12-01

    Full Text Available The results of a Bromeliaceae Juss. floristic survey in the Piraí Mountain, Araraquara complex(Guaratuba Municipality, Paraná State are presented. Twenty six species included in nine genera and three subfamilies were registered. Bromelioideae presented the highest genera diversity and Tillandsioideae showed the highest species diversity, including twelve species belonging to the genus Vriesea (46%. It was the first register of Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vrieseaflava And.Costa, H. Luther & Wand., Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm. at the Guaratuba Municipality. Dyckia leptostachya Baker was collected for the first time at the coastal zone of Paraná State, being this record done after 40 years since its last register in the State. For each species, information on phenology, geographic distribution and vulnerability level are included. Apresentam-se resultados de levantamento florístico das espécies de Bromeliaceae Juss. no Pico Piraí, Complexo do Araraquara (Guaratuba, Paraná. Verificou-se a ocorrência de 26 espécies pertencentes a nove gêneros e três subfamílias. Bromelioideae englobou a maior diversidade de gêneros e Tillandsioideae registrou-se a maior diversidade de espécies, sendo 12 delas incluídas no gênero Vriesea (46%. As seguintes espécies foram registradas pela primeira vez no município de Guaratuba: Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vriesea flava And. Costa, H. Luther & Wand.,Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm.. Dyckia leptostachya Baker foi registrada pela primeira vez na zona litorânea paranaense e após 40 anos do último

  3. A new detection method for the K variant of butyrylcholinesterase based on PCR primer introduced restriction analysis (PCR-PIRA).

    Science.gov (United States)

    Shibuta, K; Abe, M; Suzuki, T

    1994-01-01

    The K variant of human butyrylcholinesterase is caused by a G/A transition in the butyrylcholinesterase gene, which neither creates nor destroys any restriction site. In an attempt to detect the K variant both simply and rapidly, we developed a two step method of "PCR primer introduced restriction analysis" (PCR-PIRA). The first step was used to introduce a new Fun4HI site into the normal allele for a screening test, while the second step was performed to create a new MaeIII site on the variant allele for a specific test. This method thus enabled us to distinguish clearly the K variant from the normal allele, and also showed that the frequency of the K variant allele is 0.164 in the Japanese population. Images PMID:7966197

  4. The Pseudomonas aeruginosa pirA gene encodes a second receptor for ferrienterobactin and synthetic catecholate analogues.

    Science.gov (United States)

    Ghysels, Bart; Ochsner, Urs; Möllman, Ute; Heinisch, Lothar; Vasil, Michael; Cornelis, Pierre; Matthijs, Sandra

    2005-05-15

    Actively secreted iron chelating agents termed siderophores play an important role in the virulence and rhizosphere competence of fluorescent pseudomonads, including Pseudomonas aeruginosa which secretes a high affinity siderophore, pyoverdine, and the low affinity siderophore, pyochelin. Uptake of the iron-siderophore complexes is an active process that requires specific outer membrane located receptors, which are dependent of the inner membrane-associated protein TonB and two other inner membrane proteins, ExbB and ExbC. P. aeruginosa is also capable of using a remarkable variety of heterologous siderophores as sources of iron, apparently by expressing their cognate receptors. Illustrative of this feature are the 32 (of which 28 putative) siderophore receptor genes observed in the P. aeruginosa PAO1 genome. However, except for a few (pyoverdine, pyochelin, enterobactin), the vast majority of P. aeruginosa siderophore receptor genes still remain to be characterized. Ten synthetic iron chelators of catecholate type stimulated growth of a pyoverdine/pyochelin deficient P. aeruginosa PAO1 mutant under condition of severe iron limitation. Null mutants of the 32 putative TonB-dependent siderophore receptor encoding genes engineered in the same genetic background were screened for obvious deficiencies in uptake of the synthetic siderophores, but none showed decreased growth stimulation in the presence of the different siderophores. However, a double knock-out mutant of ferrienterobactin receptor encoding gene pfeA (PA 2688) and pirA (PA0931) failed to be stimulated by 4 of the tested synthetic catecholate siderophores whose chemical structures resemble enterobactin. Ferric-enterobactin also failed to stimulate growth of the double pfeA-pirA mutant although, like its synthetic analogues, it stimulated growth of the corresponding single mutants. Hence, we confirmed that pirA represents a second P. aeruginosa ferric-enterobactin receptor. The example of these two

  5. Structure and Function of the PiuA and PirA Siderophore-Drug Receptors from Pseudomonas aeruginosa and Acinetobacter baumannii.

    Science.gov (United States)

    Moynié, Lucile; Luscher, Alexandre; Rolo, Dora; Pletzer, Daniel; Tortajada, Antoni; Weingart, Helge; Braun, Yvonne; Page, Malcolm G P; Naismith, James H; Köhler, Thilo

    2017-04-01

    The outer membrane of Gram-negative bacteria presents an efficient barrier to the permeation of antimicrobial molecules. One strategy pursued to circumvent this obstacle is to hijack transport systems for essential nutrients, such as iron. BAL30072 and MC-1 are two monobactams conjugated to a dihydroxypyridone siderophore that are active against Pseudomonas aeruginosa and Acinetobacter baumannii Here, we investigated the mechanism of action of these molecules in A. baumannii We identified two novel TonB-dependent receptors, termed Ab -PiuA and Ab -PirA, that are required for the antimicrobial activity of both agents. Deletion of either piuA or pirA in A. baumannii resulted in 4- to 8-fold-decreased susceptibility, while their overexpression in the heterologous host P. aeruginosa increased susceptibility to the two siderophore-drug conjugates by 4- to 32-fold. The crystal structures of PiuA and PirA from A. baumannii and their orthologues from P. aeruginosa were determined. The structures revealed similar architectures; however, structural differences between PirA and PiuA point to potential differences between their cognate siderophore ligands. Spontaneous mutants, selected upon exposure to BAL30072, harbored frameshift mutations in either the ExbD3 or the TonB3 protein of A. baumannii , forming the cytoplasmic-membrane complex providing the energy for the siderophore translocation process. The results of this study provide insight for the rational design of novel siderophore-drug conjugates against problematic Gram-negative pathogens. Copyright © 2017 American Society for Microbiology.

  6. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae) em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae) in Piraí do Sul, Paraná, southern Brazil

    OpenAIRE

    Fernanda G. Braga; Yoshiko S. Kuniyoshi

    2010-01-01

    Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...

  7. Feasibility and impact of Creciendo Sanos, a clinic-based pilot intervention to prevent obesity among preschool children in Mexico City.

    Science.gov (United States)

    Martínez-Andrade, Gloria Oliva; Cespedes, Elizabeth M; Rifas-Shiman, Sheryl L; Romero-Quechol, Guillermina; González-Unzaga, Marco Aurelio; Benítez-Trejo, María Amalia; Flores-Huerta, Samuel; Horan, Chrissy; Haines, Jess; Taveras, Elsie M; Pérez-Cuevas, Ricardo; Gillman, Matthew W

    2014-03-20

    Mexico has the highest adult overweight and obesity prevalence in the Americas; 23.8% of children obese. Creciendo Sanos was a pilot intervention to prevent obesity among preschoolers in Instituto Mexicano del Seguro Social (IMSS) clinics. We randomized 4 IMSS primary care clinics to either 6 weekly educational sessions promoting healthful nutrition and physical activity or usual care. We recruited 306 parent-child pairs: 168 intervention, 138 usual care. Children were 2-5 years old with WHO body mass index (BMI) z-score 0-3. We measured children's height and weight and parents reported children's diet and physical activity at baseline and 3 and 6-month follow-up. We analyzed behavioral and BMI outcomes with generalized mixed models incorporating multiple imputation for missing values. 93 (55%) intervention and 96 (70%) usual care families completed 3 and 6-month follow-up. At 3 months, intervention v. usual care children increased vegetables by 6.3 servings/week (95% CI, 1.8, 10.8). In stratified analyses, intervention participants with high program adherence (5-6 sessions) decreased snacks and screen time and increased vegetables v. usual care. No further effects on behavioral outcomes or BMI were observed. Transportation time and expenses were barriers to adherence. 90% of parents who completed the post-intervention survey were satisfied with the program. Although satisfaction was high among participants, barriers to participation and retention included transportation cost and time. In intention to treat analyses, we found intervention effects on vegetable intake, but not other behaviors or BMI. ClinicalTrials.gov NCT01539070.Comisión Nacional de Investigación Científica del IMSS: 2009-785-120.

  8. Genotyping of friesian horses to detect a hydrocephalus-associated c.1423C>T mutation in B3GALNT2 using PCR-RFLP and PCR-PIRA methods: Frequency in stallion horses in México.

    Science.gov (United States)

    Ayala-Valdovinos, Miguel Angel; Galindo-García, Jorge; Sánchez-Chiprés, David; Duifhuis-Rivera, Theodor

    2017-04-01

    Hydrocephalus in Friesian horses is an autosomal recessive hereditary disease that can result in an abortion, a stillbirth, or euthanization of a newborn foal. Here, the hydrocephalus-associated c.1423C > T mutation in B3GALNT2 gene was detected with PCR-RFLP and PCR-PIRA methods for horse genotyping. A preliminary genotyping survey was performed on 83 randomly selected Friesian stallion horses to determine the current allele frequency in Mexico. The frequency of the mutant T allele was 9.6%. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae) em Piraí do Sul, Paraná, sul do Brasil

    OpenAIRE

    Braga,Fernanda G.; Kuniyoshi,Yoshiko S.

    2010-01-01

    Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...

  10. L1014F-kdr Mutation in Indian Anopheles subpictus (Diptera: Culicidae) Arising From Two Alternative Transversions in the Voltage-Gated Sodium Channel and a Single PIRA-PCR for Their Detection.

    Science.gov (United States)

    Singh, O P; Dykes, C L; Sharma, G; Das, M K

    2015-01-01

    Leucine-to-phenylalanine substitution at residue L1014 in the voltage-gated sodium channel, target site of action for dichlorodiphenyltrichloroethane (DDT) and pyrethroids, is the most common knockdown resistance (kdr) mutation reported in several insects conferring resistance against DDT and pyrethroids. Here, we report presence of two coexisting alternative transversions, A>T and A>C, on the third codon position of L1014 residue in malaria vector Anopheles subpictus Grassi (species A) from Jamshedpur (India), both leading to the same amino acid substitution of Leu-to-Phe with allelic frequencies of 19 and 67%, respectively. A single primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR) was devised for the identification of L1014F-kdr mutation in An. subpictus resulting from either type of point mutation. Genotyping of samples with PIRA-PCR revealed high frequency (82%) of L1014F-kdr mutation in the study area. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Estimativas de parâmetros populacionais e demográficos de Ozotoceros bezoarticus (Artiodactyla, Cervidae em Piraí do Sul, Paraná, sul do Brasil Estimates of population and demographic parameters of Ozotoceros bezoarticus (Artiodactyla, Cervidae in Piraí do Sul, Paraná, southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda G. Braga

    2010-06-01

    Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although

  12. Da ictiologia ao etnoconhecimento: saberes populares, percepção ambiental e senso de conservação em comunidade ribeirinha do rio Piraí, Joinville, Estado de Santa Catarina - DOI: 10.4025/actascibiolsci.v26i3.1594 From ichthyology to ethnoknowledge: popular knowledge, environmental perceptions and sense of environmental conservation of river land inhabitants - DOI: 10.4025/actascibiolsci.v26i3.1594

    Directory of Open Access Journals (Sweden)

    Luciana Pinheiro

    2004-04-01

    Full Text Available Este trabalho tem por objetivo descrever os potenciais do conhecimento empírico ou prático relacionados à ictiofauna e, de um modo mais amplo, à percepção ambiental da população ribeirinha do rio Piraí, Município de Joinville, Santa Catarina, Brasil. Partindo de uma pesquisa prévia, que teve como resultado um inventário ictiológico preliminar desse rio, foram elaborados os procedimentos metodológicos relativos à dimensão qualitativa do estudo. Com base nos depoimentos dessa população ribeirinha, obtidos mediante entrevista semi-estruturada, organizaram-se as categorias de análise com vistas a uma proposta de tipologia etnográfica. Essa tipologia foi utilizada na análise dos depoimentos dos sujeitos da pesquisa, concluindo-se que o estudo ictiológico desenvolvido sob uma perspectiva de diálogo com o saber popular dos ribeirinhos pode ser muito profícuo, em face do senso de conservação ambiental atrelado à sustentabilidade de seu modo de vidaThe purpose of this paper is to describe the potential of empirical knowledge or practice related to fishes and, in more general terms, the environmental perceptions of the population living alongside the Piraí river, Joinville, Santa Catarina, Brazil. Its point of departure is initial research that resulted in a preliminary ichthyological inventory of the river, from which methodological procedures relative to the qualitative dimension of the study were developed. Based on the testimony of the river land inhabitants, obtained through semi-structured interviews, analytical categories providing an ethnographic typology were developed. This typology was then used in the analysis of the testimony of the study's informants, arriving at the conclusion that an ichthyological study based on dialogue with popular knowledge can be very valuable, given the local people's sense of environmental conservation as it is linked to their sustainable life style

  13. Expansión y recambio foliar de gramíneas perennes C4 creciendo a temperaturas moderadamente bajas

    OpenAIRE

    Berone, Germán D.

    2016-01-01

    Understanding the mechanisms by which some C4 grasses grow more than others at moderately low temperatures (~12-20°C) is valuable to select materials to lengthen the growing season. In turn, the determination of leaf lifespan for each material to be used is relevant to optimize the balance between herbage production and herbage utilization. The objectives of this study were to analyze the growth capacity and the leaf lifespan in two native mat...

  14. Creciendo Sin Drogas: Guia de Prevencion para Padres (Growing Up Drug-Free: A Parent's Guide to Prevention).

    Science.gov (United States)

    Office of Elementary and Secondary Education (ED), Washington, DC. Safe and Drug Free Schools Program.

    This publication is part of the Department of Education's ongoing effort to provide information to emerging populations in their native language on how to create and maintain drug-free and safe schools across the nation. Throughout the publication are personal stories and artwork of elementary and secondary school students that promote the message…

  15. Mindfulness en Pediatría: el proyecto "Creciendo con atención y consciencia plena"

    OpenAIRE

    Ruiz Lázaro, P.J.; Rodríguez Gómez, T.; Martínez Prádanos, A.; Núñez Marín, E.

    2014-01-01

    Distintos estudios sugieren que la atención y consciencia plena mindfulness tiene, entre otros, el beneficio potencial de mejorar la atención de los niños y las habilidades sociales, la reducción de ansiedad ante los exámenes y la mejora en mantener la calma. Promovido desde el espacio grupal "De jóvenes a jóvenes" y fruto de la colaboración entre nuestro centro de salud y el colegio Emperador Fernando de Alcalá de Henares (Madrid), está en marcha, desde octubre de 2012, el proyecto "Creciend...

  16. Diseño de un proceso estratégico para la empresa New Care – Creciendo Saludable

    OpenAIRE

    Murillo Agudelo, Jessica Alexandra; Caballero Montaño, Luis Ferney

    2015-01-01

    En este trabajo de grado se elabora una breve presentación de propuestas, modelos y teorías de organizaciones saludables desde diferentes perspectivas, con el fin de lograr un análisis y aplicación de un modelo en una pequeña empresa del sector cosmetico para lograr la propuesta y formulacion estrategica de un modelo aplicable. En este ejercicio se logra un diagnóstico, evaluación y direccionamiento estrategico de la compañía para la elaboración de una propuesta que le permita a la compañía c...

  17. La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

    Directory of Open Access Journals (Sweden)

    Leonidas Torres Citraro

    2014-12-01

    Full Text Available La finalidad del presente artículo es establecer la fuerte vinculación que existe entre el conocimiento y los activos intangibles, siendo que estos son los grandes desconocidos en la valoración de las empresas y en el cálculo de las cuentas nacionales, en especial el PIB y la productividad. Fue el investigador Robert Solow, en 1956, uno de los primeros en señalar la importancia del conocimiento en el crecimiento económico, expresando que este es una función de capital, trabajo y conocimiento. Desde la década de 1990 viene creciendo la inquietud sobre la necesidad de analizar y medir los diferentes tipos de activos intangibles para incluirlos, con su justo valor, tanto en las cuentas nacionales como en los estados financieros de las empresas. Pero dichos activos tienen unas características muy especiales, las cuales hacen de su valoración monetaria una difícil tarea. Es impostergable profundizar su análisis y estudio para que no sigan siendo ignorados o minimizados en las prácticas cotidianas de las empresas y los mercados.

  18. Crystal structure of pira toxin-I: a calcium-independent, myotoxic phospholipase A2 - homologue from Bothrops pirajai venom

    International Nuclear Information System (INIS)

    Canduri, R.J.; Ward, R.J.; Azevedo Junior, G.W.F. de; Arni, R.K.; Soares, A.M.; Giglio, J.R.

    1997-01-01

    Full text. Phospho lipases A2 (PLA 2 ) are small enzymes that specifically hydrolysed the sn-2 ester bond of phospholipids, preferentially in lamellar or micellar aggregates at membrane surfaces. These enzymes are widely distributed in nature and have been extensively studied. Toxic proteins from venoms from Bothrops species include catalytically active PLA 2 s and calcium independent PLA 2L ys 49 homologues. The substitution of Asp49 by Lys greatly diminishes the ability of these PLA 2 to bind calcium, an ion that plays a critical role in the stabilization of the tetrahedral transition state intermediate in the catalytic mechanism. The Lys 49 PLA 2 homologues and therefore catalytically inactive yet maintain cytolytic and myotoxic activities and furthermore retain the ability to disrupt the integrity of both plasma membranes and model lipid bilayers by a poorly understood Ca 2+ independente mechanism. Lys49 PLA 2 homologues demonstrate a specific toxic activity against skeletal muscle, affecting only muscle fibers and leaving other tissue structure such as connective tissue, nerves and vessels essentially unharmed. In order to improve our understanding of the molecular basis of the myotoxic and Ca 2+ -independent membrane damaging activities, we have determined the crystal structure of Pr TX-I, a Lys49 variant from the venom of B. pirajai. The model presented has been determined at 2.8 angstrom resolution and refined to a crystallographic residual of 19.7% (R free =29.7%). (author)

  19. Intervención grupal con mujeres víctimas de violencia de género : taller "creciendo juntas"

    OpenAIRE

    Lafuente Bolufer, María Eugenia

    2014-01-01

    Treball Final de Màster Universitari en Igualtat i Gènere en l'Àmbit Públic i Privat (Pla de 2013). Codi: SRM042. Curs: 2014/2015 El trabajo que presento a continuación consiste en el desarrollo de un proyecto de intervención social con mujeres víctimas de violencia de género, que tiene como origen la realización del periodo de prácticas del Máster Universitario en Igualdad y Género en el Ámbito Público y Privado de la Universidad Jaume I de Castellón durante el curso 2014-15. Dichas pr...

  20. Variações espaciais na assembléia de peixes no Rio Paraíba do Sul (Barra Mansa, Barra do Piraí, Rio de Janeiro, Brasil Spatial variation in fish assemblage in the Paraíba do Sul River (Barra Mansa, Barra do Piraí, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Gerson Araújo

    2001-06-01

    Full Text Available The Paraíba do Sul is a major running water system in southeastern Brazil (22º24' -22º26'S; 43º43' -44º16' W, draining one of the most important industrial regions in the country. Because of its location, it has suffered a large amount of alteration due to discharges of urban and industrial effluents with direct influence in the ichthyofauna. The aim of this study is to up-to-date information on fish assemblage structure and its variation in the vicinity of a major industrial effluent outfall at Volta Redonda industrial complex. A standardized fishing sampling program, using seines, casting nets, gill nets and net trays, was carried out from October 1997 to September 1999, at six sites in three zones of the river (upstream, nearby and downstream the industrial complex, aiming to compare variation in fish assemblage due to anthropogenic alteration. Fifty-two species in 13 families were identified in the total of 7286 fish specimens. Characidae was the most diverse family contributing with 28,85% to total number of species, followed by Cichlidae (17,31 %. Overall 15,38% of the species were introduced from other watershed systems, four exotic cichlids (genera Oreochromis Günther, 1862 and Tilapia A. Smith, 1840 and three aloctone (Cichla ocellaris Bloch & Schneider, 1801, Hyphessobricon callistus (Boulenger, 1900 e Metynnis maculatus (Kner, 1860. Lebistes reticulatus (Peters, 1859 was the most abundant fish species contributing to 39,7% of the total number of fish, followed by Geophagus brasiliensis (Quoy & Gaimard, 1824 amounting to 27,4%. Fish abundance was higher in the industrial zone, but only a few very dominant species were captured, while the upstream zone showed the most even community. Species replacement tolerance along the alterations gradient in the three zone seems to be a strategy to use the limited resources in the area.

  1. “Sou caipira pira pora...”: representations of the provincial, from the parasite of the land to the paradigm of national reality (1889-1945“Sou caipira pira pora...”: representações sobre o caboclo, do parasita da terra a paradigma da realidade nacional (1889-1945

    Directory of Open Access Journals (Sweden)

    Jonathan de Oliveira Molar

    2009-04-01

    Full Text Available This paper is aimed at discussing the representations about the hillbilly, the national peasant based on visions of two intellectuals: writer Monteiro Lobato and painter José Ferraz de Almeida Jr. Therefore, both literature and iconographic sources will support an analysis of the living standards of the rustic, as found in the historical period covered – 1889 until 1945. Contributions from authors who work with image analysis will be used as method, such as Henry Silva’s and Ana M. Mauad’s, and authors who work with the said period and the provincial issue: Lilia Schwarcz, Glauco Barsalini and Antonio Candido. O presente trabalho se propõe a discutir as representações elaboradas acerca do caboclo, do caipira nacional a partir das visões de dois intelectuais: o escritor Monteiro Lobato e o pintor José Ferraz de Almeida Júnior. Desse modo, analisar tanto na literatura quanto no conjunto iconográfico o ir e vir que perpassa as considerações sobre o modo de vida do caboclo, de acordo com o período histórico abordado – de 1889 até 1945. Para tanto, utiliza-se de autores que trabalham com análise de imagens, tais como: Henrique Silva e Ana M. Mauad; e, autores que trabalham com o citado período e a questão cabocla: Lilia Schwarcz, Glauco Barsaline e Antônio Cândido.

  2. Inverting the Army Intelligence Pyramid

    Science.gov (United States)

    2011-05-19

    British experience fighting the Provisional Irish Republican Army ( PIRA ) in Northern Ireland, which began an insurgency in 1969.91...they became extremely successful.”93 Martin Van Creveld posits that the British Army’s success against the PIRA in Northern Ireland stands out as...and MI6 (Secret Intelligence Service) to defeat the PIRA .97 92 John Kiszely, "Learning About

  3. Creciendo en la adversidad. Una revisión del proceso de adaptación al diagnóstico de cáncer y el crecimiento postraumático (Growing through adversity. Analysis of the process of adaptation to a diagnosis of cancer and subsequent posttraumatic growth. A review

    Directory of Open Access Journals (Sweden)

    María del Mar Campos-Ríos

    2013-04-01

    Full Text Available The aim of this paper was to examine adjustment to a diagnosis of cancer, cancer as trauma, and the posttraumatic growth process by reviewing the scientific literature. We first present Folkman & Greer's (2000 adjustment to cancer model updated by Holland (2002 and then review cancer as a possible cause of posttraumatic stress. Finally, we describe Tedeschi & Calhoun's (2004 Posttraumatic Growth construct. The review is concluded with a sample of different points of view about posttraumatic growth related to cancer, and with some suggestions about future researches.

  4. Estrategias metodológicas para mejorar la motricidad fina en niños de 3 a 4 años en la Unidad de Atención MIES, Creciendo con Nuestros Hijos (CNH) Estrellitas Radiantes de la parroquia Luis Cordero Vega, del cantón Gualaceo, período lectivo 2016-2017

    OpenAIRE

    Banegas Cabrera, Tania Maribel

    2017-01-01

    El presente trabajo de investigación consiste en la elaboración de la Guía Metodológica para el mejoramiento de la Motricidad Fina para los niños y niñas del MIES-CNH Estrellitas Radiantes. Se basa en motricidad fina y técnicas grafoplásticas estructuradas en una guía constituida y organizada en principios, criterios, procedimientos, implementación y evaluación. This research work consists on the development of a Methodological Guide for the improvement of fine motor control for children o...

  5. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel

    2012-09-01

    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los 20 y 66 DDS, respectivamente, y también se redujo a una menor saturación de Al. En suelos con 60% de saturación de Al se observó una gran producción de esporas a los 41 DDS, siendo 'Aurora' el de más alta densidad de esporas a los 66 DDS. A los 20 DDS se observó una relación negativa (r = -0.37, p < 0,001 entre la colonización MA temprana y la masa de las raíces. Además, dicha relación fue más fuerte (r = -0.49, p < 0,001 cuando las plantas fueron cultivadas en alta saturación de Al. Una temprana colonización MA se observó en todos los cultivares ensayados cuando se cultivaron en alta saturación de Al y fue superior en las variedades aparentemente más tolerantes a Al, sugiriendo que una temprana colonización MA puede ser un factor importante en la tolerancia a Al para plantas agrícolas cultivadas en suelos ácidos.

  6. Growing up with HIV/AIDS: a study on adolescents with HIV/AIDS and their family caregivers Creciendo con VIH/SIDA: un estudio con adolescentes portadoras de VIH/SIDA y sus cuidadoras familiares Crescendo com HIV/AIDS: estudo com adolescentes portadoras de HIV/AIDS e suas cuidadoras-familiares

    Directory of Open Access Journals (Sweden)

    Ana Amélia Antunes Lima

    2008-06-01

    Full Text Available This is an exploratory study with a qualitative approach, which looks at the adolescent process with HIV/AIDS. The purpose is to identify how the adolescent process occurs, from the perspective of these teenagers and their family caregivers. The investigation was performed in Porto Alegre, RS between May and July 2005, and the subjects were four adolescents and three caregivers. Data were collected by means of interviews, which were subject to the content analysis technique. The study revealed that both teenagers and family caregivers did not show concern with the changes typical of the period, especially regarding sexuality questions. Yet, the underlying diagnosis and coping with HIV remain in the family core in order to protect these agents against the stigma of the disease.Es un estudio exploratorio con abordaje cualitativo, que trata del proceso de desarrollo de la adolescencia en portadoras de VIH/SIDA, con el objetivo de identificar cómo ocurre el proceso de la adolescencia, en la visión de estas adolescentes y de sus cuidadoras familiares.La investigación se realizó en Porto Alegre-RS, entre los meses de mayo y julio de 2005; los sujetos fueron cuatro adolescentes y tres cuidadoras. La colecta de las informaciones se hizo por medio de entrevistas que fueron sometidas a la técnica de análisis de contenido. El estudio reveló que las adolescentes y sus cuidadoras familiares, manifestaron preocupación con los cambios propios de ese período, especialmente en asuntos relacionados a la sexualidad. Se hizo evidente que el diagnóstico y la convivencia con el VIH permanecen ocultos en el contexto familiar, con el objetivo de proteger, a estos actores, del estigma de la enfermedad.Estudo exploratório com abordagem qualitativa, que trata do processo de adolescer de portadoras de HIV/AIDS, com o objetivo de identificar como ocorre o processo da adolescência, na ótica dessas adolescentes e de suas cuidadoras-familiares. A investigação foi realizada em Porto Alegre, RS, entre os meses de maio e julho de 2005, sendo que os sujeitos foram quatro adolescentes e três cuidadoras. A coleta das informações ocorreu por meio de entrevistas que foram submetidas à técnica de análise de conteúdo. O estudo revelou que tanto as adolescentes quanto suas cuidadoras-familiares não manifestaram preocupação com as transformações próprias do período, especialmente nas questões que envolvem a sexualidade. Evidenciou-se que o diagnóstico e a convivência com o HIV ainda permanecem velados no círculo familiar, visando a proteção desses atores com relação ao estigma da doença.

  7. Field Insect Pests and Crop Damage Assessment of Pigeon Pea (Cajanus cajan [L.] Huth grown under Ratoon and in Mixture with Maize Evaluación de Campo de Insectos Pestes y Daño del cultivo de Gandul (Cajanus cajan [L.] Huth creciendo bajo Rebrotes o en Mezcla con Maíz

    Directory of Open Access Journals (Sweden)

    Madang A Dasbak

    2012-03-01

    Full Text Available The widespread adoption of cropping systems that are sustainable and environmentally friendly is vital for the macroeconomic survival of civilization. Intercropping could ensure stability of insect populations in a system. A 3-yr (2005-2007 field trial was therefore carried out in Nigeria under regular and ratoon crops to evaluate five recently developed pigeon pea (Cajanus cajan [L.] Huth genotypes (ICPL 87, ICPL 161, ICPL 85063, ICP 7120, and ICPL 87119 from the International Crops Research Institute for Semi-Arid Tropics (ICRISAT and one local variety for their relative performance and susceptibility to insect pests. The pigeon pea genotypes were in a mixture with two maize genotypes (Zea mays L., open-pollinated and hybrid in regular crops for 2 yr (2005-2006 followed by a ratoon crop for 1 yr (2007. Termites (Odontotermes badius, crickets (Gymnogryllus lucens, and variegated grasshoppers (Zonocerus variegatus were the crop's seedling pests and caused minimal damage. Clavigralla spp. infestations were high at the reproductive stage causing 24% and 29% seed damage in regular and ratoon pigeon pea crops, respectively. Maize slightly suppressed insect pest incidence and damage to pigeon pea pods and seeds but significantly (P La extendida adopción de sistemas de cultivo que son sustentables y benignos para el medio ambiente es vital para la supervivencia macro-económica de la civilización. El intercultivo podría asegurar la estabilidad de población de insectos en un sistema. Un ensayo de campo de 3 anos (2005-2007 fue realizado en Nigeria bajo condiciones de cultivo regular y ratoon para evaluar cinco genotipos de poroto gandul (Cajanus cajan [L.] Huth: ICPL 87, ICPL 161, ICPL 85063, ICP 7120, e ICPL 87119 desde International Crops Research Institute for Semi-Arid Tropics (ICRISAT y una variedad local, por sus rendimientos y susceptibilidades relativas a insectos plaga. Los genotipos de poroto gandul estaban en mezcla con dos genotipos de maíz (Zea mays L., de polinización abierta e híbrido en cultivos regulares por 2 anos (2005-2006 seguido por un ratoon por 1 ano (2007. Termitas (Odontotermes badius, grillos (Gymnogryllus lucens y saltamontes variegado (Zonocerus variegatus fueron las plagas de plántula del cultivo, causando dano mínimo. Infestaciones con Clavigralla spp. fueron altas en el estado reproductivo causando 24% y 29% de dano seminal en cultivos regular y de poroto gandul ratoon. El maíz suprimió la incidencia de la plaga y el dano a las vainas y semillas de poroto gandul pero redujeron significativamente (P < 0,01 el rendimiento de grano en los cultivos de poroto gandul en 2005 y 2006, pero no en ratoon en 2007. Los genotipos de poroto gandul difirieron significativamente (P < 0,05 en incidencia de la plaga al estado de vaina en cultivos regular y ratoon y en rendimiento de grano (P < 0,01 bajo el cultivo regular. El rendimiento de granos de los cultivos de poroto gandul ratoon fue aproximadamente 60% de aquel del cultivo regular. Los genotipos ICPL 161 e ICPL 87 se recomendaron para adopción por los agricultores basados en tolerancia a las plagas y alto rendimiento de granos o como idiotipos en programas de hibridación de poroto gandul.

  8. A Preliminary Investigation into CNO Availability Schedule Overruns

    Science.gov (United States)

    2012-06-01

    days PHNSY Pearl Harbor Naval Shipyard and IMF PIA Planned Incremental Availability PIRA Pre-Inactivated Restricted Availability PNSY Portsmouth...DSRA 6 DEM 2 EOH 6 IA 2 PIA 3 MMP 1 ERO 3 SRA 1 PIRA 2 DMP 1 RCD 2 CM 1 DPIA 2 Table 23. High Level Work Stoppage Data Characteristics 1

  9. Highway Security: Filling the Void

    Science.gov (United States)

    2011-09-01

    Infrastructure Protection Plan PERF – Police Executive Research Forum PIRA – Provisional Irish Republican Army SCC – Sector Coordinating Council TSA...experience dealing with IEDs, such as the United Kingdom whose “troubles” with the Provisional Irish Republic Army ( PIRA ) was fraught with IED

  10. PirAB Toxin from Photorhabdus asymbiotica as a Larvicide against Dengue Vectors▿

    OpenAIRE

    Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R.; ffrench-Constant, Richard; Kittayapong, Pattamaporn

    2009-01-01

    We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of P...

  11. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products

    Directory of Open Access Journals (Sweden)

    Ola M. EL-Houssini

    2013-01-01

    Full Text Available Specific stability indicating reverse-phase liquid chromatography (RP-LC assay method (SIAM was developed for the determination of cinnarizine (Cinn/piracetam (Pira and cinnarizine (Cinn/heptaminol acefyllinate (Hept in the presence of the reported degradation products of Cinn. A C 18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20-200, 20-1000 and 25-1000 μgmL −1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations.

  12. Development and Validation of RP-LC Method for the Determination of Cinnarizine/Piracetam and Cinnarizine/Heptaminol Acefyllinate in Presence of Cinnarizine Reported Degradation Products

    Science.gov (United States)

    EL-Houssini, Ola M.; Zawilla, Nagwan H.; Mohammad, Mohammad A.

    2013-01-01

    Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20–200, 20–1000 and 25–1000 μgmL−1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations. PMID:24137049

  13. Curvature Analysis of Cardiac Excitation Wavefronts

    Science.gov (United States)

    2013-04-01

    reconstructed the isolines of 10,000 frames, both with PIRA and the contour function of MATLAB. The first took 1.65 seconds while the second took 720...seconds. Hence, PIRA had a 444.44-fold speedup compared to contour. The platform was equipped with Intel Core i7-930 2.8 GHz LGA 1,366 130W Quad-Core

  14. Effect of pioglitazone and ramipril on biomarkers of low-grade inflammation and vascular function in nondiabetic patients with increased cardiovascular risk and an activated inflammation: results from the PIOace study.

    Science.gov (United States)

    Pfützner, Andreas; Hanefeld, Markolf; Dekordi, Lida A; Müller, Jürgen; Kleine, Iris; Fuchs, Winfried; Forst, Thomas

    2011-07-01

    This study investigated the effects of pioglitazone (PIO), ramipril (RAM), or their combination (PIRA) on low-grade inflammation in nondiabetic hypertensive patients with increased cardiovascular risk. Patients enrolled in this placebo-controlled, double-blind, randomized, parallel trial (72 male, 77 female, aged 60 ± 9 years, body mass index 30.4 ± 4.7 kg/m(2), duration of hypertension 9 ± 8 years) were treated with either 30/45 mg PIO (dose titration), 2.5/5 mg RAM, or their combination for 12 weeks. A reduction in high-sensitivity C-reactive protein was observed with PIO (-0.89 ± 1.98 mg/liter; -25%) and PIRA (-0.49 ± 2.11 mg/liter; -16%), while an increase was seen with RAM (0.58 ± 2.13 mg/liter; +20%, p PIRA). The 24-hour blood pressure profile showed a small increase with both monotherapies but a decrease with PIRA (p PIRA arms only [PIO/RAM/PIRA: homeostasis model of assessment of IR: -0.78 ± 1.39 (-29%)/0.15 ± 1.03 (+5%)/ -1.44 ± 2.83 (-40%); adiponectin: 8.51 ± 5.91 (+104%)/ 0.09 ± 2.63 (+1%)/ 8.86 ± 6.37 mg/liter (+107%); matrix metallo-proteinase-9: -48 ± 127 (-12%)/-1 ± 224 (0%)/-60 ± 210 ng/ml (-13%), p PIRA in all cases]. Our 3-month study in nondiabetic hypertensive patients showed a decrease in biomarkers of IR and chronic systemic inflammation with the PIO monotherapy and the PIRA combination only, which may help to explain some findings in other cardiovascular outcome trials. © 2011 Diabetes Technology Society.

  15. Tectono-volcanic control of fissure type vents for the 28 Ma Panalillo ignimbrite in the Villa de Reyes Graben, San Luis PotosI, Mexico

    International Nuclear Information System (INIS)

    Tristan-Gonzalez, Margarito; Labarthe-Hernandez, Guillermo; Aguillon-Robles, Alfredo; Aguirre-DIaz, Gerardo J

    2008-01-01

    The volcano-tectonic events at the Villa de Reyes Graben (VRG), in the southern Sierra Madre Occidental, Mexico, include 1) a regional NNE fault system developed before 32 Ma, 2) this pre-32 Ma faulting controlled the emplacement of 31.5 Ma dacitic domes, 3) NE faulting at 28 Ma that displaced the 31.5 Ma dacitic domes and formed the VRG, as well as the oblique grabens of Bledos and Enramadas oriented NW, 4) emplacement of Panalillo ignimbrite at 28 Ma filling the VRG and erupting from fissures related to the oblique grabens, and eruption of Placa basalt apparently also from fault-controlled vents.

  16. Tectono-volcanic control of fissure type vents for the 28 Ma Panalillo ignimbrite in the Villa de Reyes Graben, San Luis PotosI, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Tristan-Gonzalez, Margarito; Labarthe-Hernandez, Guillermo; Aguillon-Robles, Alfredo [Instituto de Geologia/DES IngenierIa, UASLP, Av. Dr. Manuel Nava 5, Zona Universitaria, C.P. 78240, San Luis PotosI, S.L.P. (Mexico); Aguirre-DIaz, Gerardo J [Centro de Geociencias, Universidad Nacional Autonoma de Mexico, Campus Juriquilla, Queretaro, 76230 (Mexico)], E-mail: mtiistan@uasln.mx, E-mail: ger@geociencias.unam.mx

    2008-10-01

    The volcano-tectonic events at the Villa de Reyes Graben (VRG), in the southern Sierra Madre Occidental, Mexico, include 1) a regional NNE fault system developed before 32 Ma, 2) this pre-32 Ma faulting controlled the emplacement of 31.5 Ma dacitic domes, 3) NE faulting at 28 Ma that displaced the 31.5 Ma dacitic domes and formed the VRG, as well as the oblique grabens of Bledos and Enramadas oriented NW, 4) emplacement of Panalillo ignimbrite at 28 Ma filling the VRG and erupting from fissures related to the oblique grabens, and eruption of Placa basalt apparently also from fault-controlled vents.

  17. CHRISTIAN PHILOSOPHERS OF THE WEST ABOUT THE “COLD WAR”, TOTALITARIANISM AND COMMUNISM: COMPARATIVE ANALYSIS OF REINHOLD NIEBUHR’S AND GIORGIO LA PIRA’S CONCEPTS

    Directory of Open Access Journals (Sweden)

    T. V. Zonova

    2012-01-01

    Full Text Available The author examines the legacy of two great Christian thinkers, the American Reinhold Niebuhr and the Italian Giorgio La Pira, both very influential during the Cold War. Niebuhr was a Protestant theologian and political adviser to the American establishment. The Mayor of Florence, La Pira, was a prominent Italian statesman and an eminent Catholic thinker. The author analyzes their views on international relations, in particularly on the western policy towards the Soviet Union, the use of nuclear weapons, the war in Vietnam and communism. The legacy of two thinkers is highly topical in front of the ethical dimension of choices needed in international politics today.

  18. Densidad de la madera de Pinus ponderosa (Dougl. Ex Laws) en tres localidades de Argentina

    OpenAIRE

    JOVANOVSKI, A; JARAMILLO, M; LOGUERCIO, G; ANTEQUERA, S

    2002-01-01

    Se estudió el ancho de anillo, la densidad básica de la madera y su variación y la relación entre ancho de anillo y densidad en Pinus ponderosa (Dougl. Ex. Laws) creciendo en tres localidades de la Patagonia andina argentina. El ancho de anillo obtenido se corresponde con una conífera de rápido crecimiento, mientras que la densidad media es levemente menor que la de la especie creciendo en los sitios de origen en Estados Unidos. Ring-width growth, wood specific gravity and its variation, a...

  19. Reprodução do pirá-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae, e caracterização de seu habitat na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brasil Reproduction of pira-brasília, Simpsonichthys boitonei Carvalho (Cyprinodontiformes, Rivulidae and its habitat characterization in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística, Brasília, Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Oscar A. Shibatta

    2005-12-01

    Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.

  20. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  1. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  2. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  3. Breaching the Fortress Wall. Understanding Terrorist Efforts to Overcome Defensive Technologies

    Science.gov (United States)

    2007-01-01

    that affect, in overlapping ways, sequential parts of the terrorist activity chain (Figure 1.2). The purposes of each of these types of technologies...fication lineup .51 The ways in which PIRA chose to manage operations also contrib- uted to its overall counterforensic effort. For example, although

  4. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  5. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  6. Database Overlap vs. Complementary Coverage in Forestry and Forest Products: Factors in Database Acquisition.

    Science.gov (United States)

    Hoover, Ryan E.

    This study examines (1) subject content, (2) file size, (3) types of documents indexed, (4) range of years spanned, and (5) level of indexing and abstracting in five databases which collectively provide extensive coverage of the forestry and forest products industries: AGRICOLA, CAB ABSTRACTS, FOREST PRODUCTS (AIDS), PAPERCHEM, and PIRA. The…

  7. Comparison of allele-specific PCR, created restriction-site PCR, and PCR with primer-introduced restriction analysis methods used for screening complex vertebral malformation carriers in Holstein cattle

    Science.gov (United States)

    Altınel, Ahmet

    2017-01-01

    Complex vertebral malformation (CVM) is an inherited, autosomal recessive disorder of Holstein cattle. The aim of this study was to compare sensitivity, specificity, positive and negative predictive values, accuracy, and rapidity of allele-specific polymerase chain reaction (AS-PCR), created restriction-site PCR (CRS-PCR), and PCR with primer-introduced restriction analysis (PCR-PIRA), three methods used in identification of CVM carriers in a Holstein cattle population. In order to screen for the G>T mutation in the solute carrier family 35 member A3 (SLC35A3) gene, DNA sequencing as the gold standard method was used. The prevalence of carriers and the mutant allele frequency were 3.2% and 0.016, respectively, among Holstein cattle in the Thrace region of Turkey. Among the three methods, the fastest but least accurate was AS-PCR. Although the rapidity of CRS-PCR and PCR-PIRA were nearly equal, the accuracy of PCR-PIRA was higher than that of CRS-PCR. Therefore, among the three methods, PCR-PIRA appears to be the most efficacious for screening of mutant alleles when identifying CVM carriers in a Holstein cattle population. PMID:28927256

  8. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  9. Tiocfaidh ar la : A Critical Examination of British Counterinsurgency Operations in Northern Ireland 1969-1998

    Science.gov (United States)

    2012-05-17

    mid to late 18th century, a large Protestant Irish bourgeoisie had emerged that was dissatisfied with British mercantile economic policies. There was...of the cargo ship Eksund off the coast of France in 1987, which was carrying a large consignment of Libyan arms for the PIRA is one of the most

  10. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... antitermination factor [Ureaplasma parvum serovar 3 str. ... ATCC 700970] pir||A82874 tran...scription antitermination ... factor UU581 [imported] - Ureaplasma urealyt...icum ... Length = 137 ... Query: 24 ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLXXXXXXXXXXXXYEPSEAPRSMKN 83 ... ... ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDL ... YEPSEAPRSMKN Sbjct: 1 ... HQWYIVTVVSGNEQKVIENIKDKLNGYG... NC_002162 gi|13358146 >1nz8A 2 112 24 160 9e-13 ... ref|NP_078420.1| transcription an

  11. Micropropagação de cebola a partir de bulbinhos induzidos in vitro Micropropagation of onion from in vitro induced bulblet

    Directory of Open Access Journals (Sweden)

    Benedita Maria Rodrigues

    1996-01-01

    Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the

  12. Características qualitativas de cultivares de cebola no sul de Minas Gerais Qualitative characteristics of onion cultivars in southern Minas Gerais State

    Directory of Open Access Journals (Sweden)

    Silvio Júlio de Rezende Chagas

    2004-02-01

    Full Text Available Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L., conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%, acidez titulável (%, ácido pirúvico (µmol/g, açúcares totais, redutores e não-redutores (% e índice industrial dos bulbos. As cultivares Crioula, Baia Periforme, Pira Ouro e Jubileu apresentaram as maiores concentrações de sólidos totais e solúveis. A acidez mais elevada foi observada nas cultivares Crioula (0,370% e Pira Ouro (0,315%. Os maiores índices industriais foram apresentados pelas cultivares Crioula (0,87 e Baia Periforme (0,75, e os menores, pelas cultivares Texas Grano 502 (0,51 e Granex 33 (0,32.This study was carried out from March to September of 1995, in the Experimental Field of EPAMIG, Lavras-MG, Brazil, with the objective of determining the physico-chemical and chemical composition of onions from different cultivars (Allium cepa L.. The experimental design was completely randomized blocks with four repetitions and six cultivars as follow: Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu and Texas Grano 502. After the cure it was evaluated the pH, soluble and total solids (%, titrate acidity (%, pyruvic acid (µmol/g, total sugar, reducers and non reducers (% and industrial index. The cultivars Crioula, Baia Periforme, Pira Ouro and Jubileu showed the largest concentrations of total and soluble solids. The highest acidity indexes were observed in the cultivars Crioula (0.370% and Pira Ouro (0.315%. The largest industrial indexes were found in the cultivars Crioula (0.87 and Baia Periforme (0.75, and the smallest ones in the

  13. Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code

    Directory of Open Access Journals (Sweden)

    Filip Cvitić

    2014-07-01

    Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  15. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  16. The Prachanda Path and Oglaigh na hEireann: A Comparative Case Study of the Insurgencies in Nepal and Northern Ireland

    Science.gov (United States)

    2008-05-22

    Prior to the 1980s, politicians aligned with the PIRA conducted an activity called “ abstentionism ,” which meant that they participated in elections... The Prachanda Path and Óglaigh na hÉireann: A Comparative Case Study of the Insurgencies in Nepal and Northern Ireland A Monograph by MAJOR...burden for this collection of information is estimated to average 1 hour per response, including the time for reviewing instructions, searching existing

  17. An End to the Troubles: Unionism, Nationalism and the Path to Peace

    Science.gov (United States)

    2006-12-01

    Nationalist community but also provided a viable alternative to the violence espoused by the PIRA.14 The policy of abstentionism was not without risk...revolutionary socialism; and the continuation of the policy of abstentionism was hindering the party’s ability to achieve political change on its terms...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release: distribution is unlimited AN END TO THE

  18. Browse Author Index

    African Journals Online (AJOL)

    Palacio-Grüber, Jose · Palacio-Gruber, Jose · Parga-Lozano, C · Perrin, P · Phylactou, LA · Piras, IS 1 - 6 of 6 Items. ISSN: 1737-8176. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL ...

  19. Killing Range

    Science.gov (United States)

    Asal, Victor; Rethemeyer, R. Karl; Horgan, John

    2015-01-01

    This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for careful IED usage, which significantly minimizes civilian casualties (a specific strategic goal of PIRA) while increasing the ability to kill more high value targets with IEDs. Lethal counter-terrorism events also significantly affect a brigade's likelihood of killing both civilians and high-value targets but in different ways. Killing PIRA members significantly decreases IED fatalities but also significantly decreases the possibility of zero civilian IED-related deaths in a given year. Killing innocent Catholics in a Brigade's county significantly increases total and civilian IED fatalities. Together the results suggest the necessity to analyze dynamic situational variables that impact terrorist group behavior at the sub-unit level. PMID:25838603

  20. VARIABILIDAD Y RELACION ENTRE LAS PROPIEDADES ANATOMICAS, QUIMICAS Y LA APTITUD PULPABLE, EN CLONES DE EUCALYPTUS GLOBULUS.

    OpenAIRE

    RAMIREZ VIDAL, MAURICIO HERNAN; RAMIREZ VIDAL, MAURICIO HERNAN

    2008-01-01

    Se estudió la variación de la anatomía de la madera, variables biornétricas, aptitud pulpable y propiedades de la pulpa, en 14 clones de E. globulus de 7 años de edad, creciendo en un ensayo clonal en la zona de Arauco, región del Bio-Bio, Chile. Las Cara 61p.

  1. Posibilidades de reducción de los residuos sólidos (no peligrosos) en el Municipio de Barbosa : un estudio de caso

    OpenAIRE

    Mejía Ríos, Luis Santiago

    2007-01-01

    Este trabajo muestra los diferentes mecanismo utilizados en la actualidad para disminuir la cantidad de residuos sólidos en el municipio de Barbosa, explicando desde el problema de las externalidades que se generan en el sitio de disposición final y el medio ambiente, pasando por el desarrollo del manejo integral de estos desechos y formas en las cuales se puede contribuir al mejoramiento de esta situación que cada vez sigue creciendo.

  2. Comunicándonos con las cosas

    Directory of Open Access Journals (Sweden)

    Miguel Delgado

    2009-09-01

    Full Text Available Tras la Web 2.0 y gracias a la colaboración entre las personas, Internet sigue creciendo y evolucionando, pero esta vez a través de los objetos. La siguiente evolución pretende que las personas puedan interactuar con las cosas de una forma inteligente mediante tecnologías ampliamente utilizadas como el teléfono móvil e Internet, y tecnologías que permitan etiquetar objetos.

  3. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  4. Análise sensorial, teores de nitrato e de nutrientes de alface cultivada em hidroponia sob águas salinas Sensory analysis, nitrate and nutrient concentration of lettuce grown in hydroponics under saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2012-03-01

    Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of

  5. Efeito da cerosidade foliar na reação de variedades de cebola (Allium cepa L. a herbicidas de pós-emergência Effect of the foliar waxiness of onion varieties (Allium cepa L. in reaction to post-emergence herbicides

    Directory of Open Access Journals (Sweden)

    P.V. Ferreira

    1982-12-01

    Full Text Available Em ensaios experimentais, realizados no Departamento de Genética da Escola Superior de Agricultura "Luiz de Queiroz" da Universidade de São Paulo, Piracicaba - SP, verificou-se o efeito da ce rosidade foliar na reação de variedades de cebola a herbicidas de pós-emergência. Utilizaram-se variedades do grupo não ceroso, como Granex e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Barreiro SMP-IV, Red Creole e Roxa Chata SMP-IV, no 1.º ensaio; e variedades do grupo não ceroso, como Excel Bermudas 986 e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole e Roxa Chata SMP-IV, no 2.º ensaio. Os herbicidas de pós-emergência e as doses utilizadas foram: bentazon, 0,48 kg i.a./ha e prometryne 1,60 kg i.a./ha, no 1.0 ensaio; e ácido sulfúrico (4%, bentazon 0,48 kg i.a./ha, prometryne 1,60 kg i.a./ha e diuron 1,60 kg i.a./ha, no 2: ensaio. Os resultados obtidos mostram que a cerosidade foliar é um dos mecanismos de resistência de cebola à ação de herbicidas de pós-emergência.In experimental trials, carried out in the Department of Genetic of ESALQ, University of São Paulo, Piracicaba - SP, the effect of the foliar waxiness in reaction of onion varieties at postemergence herbicides was studied. Glossy group varieties such as Granex and Texas Grano and non-glossy group varieties such as Baia Periforme, Barreiro SMP-IV, Red Creole and Roxa-Chata SMP-IV, were tested in 1st. experiment; and glossy group varieties such as Excel Bermudas 986 and Texas Grano and nonglossy group varieties such as Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole and Roxa Chata SMP-IV, in 2nd experiment. The following post-emergence herbicides and doses were used: bentazon 0,48 kg a.i./ha and prometryne 1,60 kg a.i./ha, in the last experiment: and sulphuric acid (4%, bentazon 0,48 kg a.i./ha, prometryne 1,60 kg a.i./ha and diuron 1,60 kg a.i./ha, in the 2nd experiment

  6. PirAB protein from Xenorhabdus nematophila HB310 exhibits a binary toxin with insecticidal activity and cytotoxicity in Galleria mellonella.

    Science.gov (United States)

    Yang, Qing; Zhang, Jie; Li, Tianhui; Liu, Shen; Song, Ping; Nangong, Ziyan; Wang, Qinying

    2017-09-01

    PirAB (Photorhabdus insect-related proteins, PirAB) toxin was initially found in the Photorhabdus luminescens TT01 strain and has been shown to be a binary toxin with high insecticidal activity. Based on GenBank data, this gene was also found in the Xenorhabdus nematophila genome sequence. The predicted amino acid sequence of pirA and pirB in the genome of X. nematophila showed 51% and 50% identity with those gene sequences from P. luminescens. The purpose of this experiment is to identify the relevant information for this toxin gene in X. nematophila. The pirA, pirB and pirAB genes of X. nematophila HB310 were cloned and expressed in Escherichia coli BL21 (DE3) using the pET-28a vector. A PirAB-fusion protein (PirAB-F) was constructed by linking the pirA and pirB genes with the flexible linker (Gly) 4 DNA encoding sequence and then efficiently expressed in E. coli. The hemocoel and oral insecticidal activities of the recombinant proteins were analyzed against the larvae of Galleria mellonella. The results show that PirA/B alone, PirA/B mixture, co-expressed PirAB protein, and PirAB-F all had no oral insecticidal activity against the second-instar larvae of G. mellonella. Only PirA/B mixture and co-expressed PirAB protein had hemocoel insecticidal activity against G. mellonella fifth-instar larvae, with an LD 50 of 2.718μg/larva or 1.566μg/larva, respectively. Therefore, we confirmed that PirAB protein of X. nematophila HB310 is a binary insecticidal toxin. The successful expression and purification of PirAB laid a foundation for further studies on the function, insecticidal mechanism and expression regulation of the binary toxin. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Social Movements and Interrelated Effects: The Process of Social Change in the Post-Movement Lives of Provisional IRA Volunteers

    Directory of Open Access Journals (Sweden)

    Bosi, Lorenzo

    2016-12-01

    Full Text Available This article systematizes a research perspective that assesses how different types of social movement outcomes mutually influence one another over time. This should offer a different perspective on the consequences of social movements by shifting the focus from single outcomes to processes of social change that are generated by the interaction between different types of effects. The variety of ways in which movement outcomes potentially influence each other in the short-term, or over an extended period of time, will be broken down into six hypothetical processes. Empirically, through a process-tracing approach, in this article I investigate how the British state’s responses at policy level toward the disruptive mobilization of the Catholic community in Northern Ireland and to the armed campaign of the PIRA have shaped the post-movement lives of PIRA volunteers.Este artículo sistematiza una perspectiva de investigación que evalúa cómo los diferentes tipos de resultados de los movimientos sociales se influyen mutuamente en el tiempo. Esto debería ofrecer una perspectiva diferente sobre las consecuencias de los movimientos sociales, cambiando el foco de atención desde los resultados individuales a procesos de cambio social generados a partir de la interacción entre diferentes tipos de efectos. La variedad de formas en las que los resultados de los movimientos se influyen potencialmente entre sí en el corto plazo, o durante un período prolongado de tiempo, se dividen en seis procesos hipotéticos. Empíricamente, a través de un enfoque centrado en los procesos, este artículo investiga cómo las respuestas políticas ofrecidas del Estado británico a la movilización disruptiva de la comunidad católica de Irlanda del Norte y la lucha armada del PIRA han dado forma a la vida post-movimiento de los voluntarios del PIRA.

  8. Herança de coloração de bulbos em cebola (Allium cepa L. com resistência a Colletotrichum gloeosporioides Inheritace of bulb color in onion (Alllum cepa L. resitant to Colletotrichum gloeosporioides

    Directory of Open Access Journals (Sweden)

    A.I.I. Cardoso

    1995-08-01

    Full Text Available O objetivo deste trabalho foi determinar a herança de coloração de bulbos de cebola a partir do cruzamento de bulbos brancos com resistência a Colletotrichum gloeosporioides (Mal de 7 voltas segregantes da população Roxa do Barreiro com bulbos amarelos de linhagens endogâmicas obtidas das variedades Super Precoce e Pira Ouro. Para tal obtiveram-se as gerações F1 e F2 entre (Super Precoce x Barreiro "Branca" e entre (Pira Ouro x Barreiro "Branca". Nas gerações F1 obtiveram-se apenas bulbos roxos, enquanto que nas gerações F2 obtiveram-se uma segregação para bulbos roxos, brancos e amarelos numa proporção aproximada de 9:4:3, o que permitiu concluir que a herança, para estes cruzamentos, foi devida a 2 pares de genes contrastantes nas populações progenitoras, cujos genótipos, com base na literatura, são: ii cc RR (Barreiro Branca e ii CC rr (linhagens de Super Precoce e de Pira Ouro. Conclui-se, também, que é possível, a partir destes cruzamentos, obter uma variedade ou linhagem com resistência a C. gloeosporioides somente com bulbos amarelos ou com bulbos brancos com genótipo homozigoto recessivo para todos os genes, que quando cruzada com outra amarela pode-se obter uma geração F1 com bulbos amarelos e com resistência a C. gloeosporioides.The inheritance of onion bulb color was studied utilizing white bulbs resistant to Colletotrichum gloeosporioides that segregated from the population 'Roxa do Barreiro' and two inbred Unes with yellow bulbs originated from 'Super Precoce" and 'Pira Ouro' cultivars. The white bulbs and the inbred Unes were crossed to obtain the F1 and F2 generations (yellow x white. Both F1 generations were of red bulbs and in the F2 generation there were segregations to red, white and yellow bulbs in a proportion of 9:4:3, respectively. It was concluded that the inheritance of bulb color in these crosses is controlled by two contrasting genes hi the parental (ii cc RR = white bulbs, ii CC rr

  9. Jedna strila, čet’ri krila. Carmina figurata u hrvatskoj vernakularnoj i novolatinskoj poeziji XVI. stoljeća

    OpenAIRE

    Stepanić, Gorana

    2015-01-01

    Članak se bavi figuralnim pjesmama (carmina figurata) na hrvatskom i latinskom u dubrovačkom pjesništvu 16. stoljeća. Nakon uvodnog osvrta na žanr tehnopegnija i terminoloških objašnjenja rekapitulira se dosadašnje znanje o primjerima figuralne poezije kod Dinka Ranjine (Dubrovnik, 1536 – Dubrovnik, 1607) te portugalskog humanista Didaka Pira (Évora, 1517 – Dubrovnik, 1599). Analiziraju se, korigiraju i nadopunjuju studije posvećene Ranjininoj hrvatskoj pjesmi u obliku strijele (Pavličić) i k...

  10. Bioacumulacion y biomagnificacion de mercurio en diferentes poblaciones de peces de la Amazonía boliviana

    OpenAIRE

    Lopez Siangas, E.I.

    2005-01-01

    La bioacumulación de mercurio respecto al tamaño, peso y edad, así como la influencia de aspectos biológicos como la alimentación, el crecimiento, la madurez sexual y el sexo, fueron determinadas en seis especies de peces piscívoros y no piscívoros de importancia regional: #Cichla monoculus# (Tucunaré), #Pygocentrus nattereri# (Piraña), #Psedoplatystoma fasciatum# (Surubí), #Plagioscion squamossisimus# (Corvina), #Colosoma macropomum# (Pacú) y #Piaractus brachypomus# (Tambaquí), en las cuenca...

  11. Simón Bolívar y la cultura iberoamericana

    Directory of Open Access Journals (Sweden)

    Luis López de Mesa

    1979-08-01

    Full Text Available Simón Bolívar -en cuanto héroe de la historia de América- nació en Cartagena del Caribe en 1812 y murió en Lima hacia 1926. Comparando esos catorce años de prodigiosa actividad pública con el promedio de "realizaciones " que en el decurso de su vida lleva a cabo el hombre común, resultaría de longevidad casi milenaria: prueba de ello es que su pensamiento actúa aún en el continente americano, y que sus obras siguen creciendo a la faz del mundo.

  12. ¿OFRECEN CALIDAD LAS CONSULTORÍAS EN CALIDAD? /

    OpenAIRE

    Marimon Viadiu, F.; Casadesús Fa, M; Heras Saizarbitoria, I.

    2004-01-01

    En este artículo analizamos la calidad del servicio ofertado por las empresas consultoras. Concretamente aquellas especializadas en la implantación de sistemas basados en normativa ISO 9000. Es un mercado que sigue creciendo en los últimos años por todo el planeta. El principal objetivo es analizar el beneficio aportado por estas consultarías, así como la relación entre estos beneficios y la percepción de calidad del servicio. Para ello se ha realizado un trabajo empírico sobre una muestra de...

  13. Diseño para la implementación de los procesos de talento humano para la Pyme Producomercio Joseph´s Foods

    OpenAIRE

    Alvarado Villarreal, Maria del Rocio

    2014-01-01

    La empresa Producomercio Joseph´s Foods, es una empresa de tipo familiar, actualmente está formando parte del sector de las PYMES, inició sus operaciones hace 47 años como una pequeña empresa artesanal, con el pasar del tiempo ha ido creciendo progresivamente, por lo que cada día precisa la contratación de más personal con especialización de funciones; el compromiso de sus directivos es ofrecer productos de la mejor calidad y con el mejor servicio, por ello para seguir operando y llegar a tra...

  14. Paralelización de aplicaciones econométricas que requieren estimación de los modelos de elección discreta

    OpenAIRE

    Trigila, Mariano; Di Pasquale, Ricardo

    2016-01-01

    En las últimas dos décadas, el uso eficiente del hardware para aplicaciones científicas fue creciendo en dificultad. Además, muchas de estas aplicaciones requieren mejorar el rendimiento del procesamiento y tratar datos masivos. Estos son sistemas complejos de implementar y en especial para aquellos que no son especialista en computación. Es necesario desarrollar e implementar abstracciones de programación de alto nivel que permitan modelos de programación simples de usar. Las aplica...

  15. La docencia del marketing sensorial en el Grado de Publicidad y Relaciones Públicas de la Universidad de Valladolid

    OpenAIRE

    Figueroa Escribano, Carmen

    2014-01-01

    He querido plasmar en este trabajo de investigación cómo es la docencia y qué importancia se le da al Marketing en general y al Marketing Sensorial en particular, en el grado de Publicidad y Relaciones Públicas en la Universidad de Valladolid, en la cual he estado estudiando mis cuatro años de carrera. He querido centrarme en estos dos fenómenos, puesto que valoro que el Marketing Sensorial es una estrategia que está creciendo mucho y las empresas están utilizando como reclamo publicitario pa...

  16. Compromiso político y labor profesional : Estudios sobre psicólogos y abogados en los primeros setenta

    OpenAIRE

    Chama, Mauricio Sergio

    2016-01-01

    Este libro aborda el proceso de politización y radicalización de sectores medios de la sociedad argentina en los tempranos años setenta, a partir del análisis de dos grupos de profesionales. Por un lado, pone el foco en un núcleo de psicólogos que, creciendo desde los márgenes de una institución psiquiátrica tradicional, radicalizó sus posturas al impulsar un conjunto de innovaciones que tenían como horizonte la idea de “comunidades terapéuticas”. Por otro lado, reconstruye el itinerario de u...

  17. Implantación de un sistema de información para la comercialización tercerizada de productos financieros

    OpenAIRE

    Lara Bendezu, Junior Felix; Lara Bendezu, Junior Felix; Lara Bendezu, Junior Felix

    2013-01-01

    La tercerización es el proceso por el cual se transfieren actividades dentro de la cadena de valor a socios seleccionados. Es una práctica que ha ido creciendo y evolucionando dentro del mundo de los negocios ya que permite concentrar las energías empresariales en el núcleo del negocio. La empresa Certicom brinda el servicio de tercerización de los procesos de comercialización de créditos financieros de las entidades financieras. Este proceso es de suma importancia para dichas entidades po...

  18. Contribución al estudio del sistema de lipasas de Trichoderma harzianum

    OpenAIRE

    Jorge, Maria de Lurdes Antunes

    2015-01-01

    [ES]Entre los hongos del género Trichoderma se han descrito algunas especies importantes como agentes de biocontrol, tales como las parejas anamorfo/teleomorfo T. harzianum/Hypocrea lixii, T. viride/H. rufa, T. atroviride/H. atroviridis y T. virens/H. virens. Trichoderma tiene una amplia distribución geográfica, está presente en casi todos los suelos y en hábitats diversos (creciendo en madera, corteza, sobre y dentro otros hongos y sustratos innumerables). Por su adaptación a distintos en...

  19. Higiene Industrial en empresa de limpieza

    OpenAIRE

    Dorca-Mariño, José Ignacio

    2012-01-01

    Este trabajo se realiza basándose en la experiencia del autor al hacerse cargo del Servicio de Prevención Propio de SERLIMAT ESPAÑOLA , empresa de limpieza industrial con 28 años de experiencia en su sector y que ha ido creciendo tanto en número de empleados, como en actividades y en implantación geográfica. En la actualidad, formamos parte de la empresa más de 700 trabajadores, con una amplia mayoría femenina, que representa aproximadamente el 80%, y la principal actividad de la empresa e...

  20. Imagen corporal en pacientes sometidos a cirug?a bari?trica

    OpenAIRE

    Vega Meza, Mar?a Paula

    2017-01-01

    La obesidad es un problema de salud que ha ido creciendo de manera considerable en los ?ltimos a?os, afectando a un alto porcentaje de la poblaci?n mundial (WHO, 2015). Uno de los tratamientos que m?s se emplea en la actualidad para tratar esta condici?n es la cirug?a bari?trica, la cual ha mostrado, hasta el momento, ser una de las t?cnicas m?s eficaces en cuanto a la p?rdida significativa del peso y el mantenimiento de los resultados (Abeles & Shikora, 2008). En ese orden, es pertinente ent...

  1. Planeamiento estratégico del sector de las fuentes no convencionales de energía renovable en Colombia

    OpenAIRE

    Torres Wilches, Carlos Rolando; Rojas Patiño, Alejandro; Higuera Rincón, Diana Astrid; Hernández Henríquez, Jorge Daniel; Calle Forero, Jorge Alberto

    2017-01-01

    xiv, 192 h. : il. ; 30 cm. A través de los años y en el ámbito mundial, la generación de energía eléctrica por medio de fuentes no convencionales de energía como el sol, el viento, la biomasa, y la energía mareomotriz, ha estado creciendo constantemente tanto en capacidad instalada (i.e., megawatt) como en número de proyectos implementados. Parte importante de este crecimiento se debe a la mejora continua en la tecnología de producción que utilizan entre otros los paneles so...

  2. Inversión tecnológica empresarial para la instalación de una piscigranja de Paiche - Shapajilla - Tingo Maria

    OpenAIRE

    Martos Gurmendi, Victor Hugo; Martos Gurmendi, Victor Hugo

    2013-01-01

    Del mar, ya no es posible extraer más especies. Este consenso se consolida al advertir que existe la explotación plena de varias especies, por lo que no parece factible mayor crecimiento en la extracción. ¿De donde vendrá el alimento para las mayores necesidades de alimentación de una población mundial que sigue creciendo geométricamente? Todo hace suponer que de la acuicultura. Mundialmente la acuicultura es un sector dinámico, de crecimiento rápido y gran potencial. En la actualidad...

  3. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Jorge Thierer

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la en...

  4. Insuficiencia cardíaca y diabetes

    OpenAIRE

    Thierer, Jorge

    2006-01-01

    La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los betabloqueantes vasodilatadores y los inhibidores de la enzim...

  5. Condiciones de sostenibilidad de la ciudad compacta: análisis de superficies expuestas a la radiación y sombras arrojadas en la Ciudad de Mendoza

    OpenAIRE

    Ganem, Carolina; Balter, Julieta; Coch Roura, Helena

    2009-01-01

    ¿Podemos decir que toda ciudad compacta es una ciudad sostenible? ¿Cuáles son los parámetros que definen a una ciudad compacta sostenible? El objetivo de este trabajo es determinar las características de la ciudad compacta tal y como está creciendo hoy mediante el estudio en profundidad de una ciudad en plena densificación, la ciudad de Mendoza en la República Argentina. Se parte del estudio de los diferentes códigos de edificación vigentes desde su fundación y las restricciones y oportunida...

  6. Corporeidad y significado: naturaleza dual de lo físico

    OpenAIRE

    Arranz Rodrigo, Marceliano

    2015-01-01

    La información es una dimensión de lo real que, a pesar de no tener natu-raleza física, solo existe apoyada en una base física. Y su presencia en los objetos, eventos y procesos que constituyen nuestro entorno vital humano, es lo que permite que el mundo sea inteligible. Sin información no serían posibles las definiciones, ni el pensamiento, ni el lenguaje, ni la ciencia. La importancia de la información está creciendo de manera expo-nencial en nuestros días. Aclarar su estatuto ...

  7. INFLUENCIA DE LA MADERA JUVENIL DE PINO RADIATA SOBRE LAS PROPIEDADES MECÁNICAS DE TABLEROS OSB

    OpenAIRE

    PECHO,Robert; ANANIAS,Rubén A; BALLERINI,Aldo; CLOUTIER,Alain

    2004-01-01

    En este trabajo se estudia la influencia de la madera juvenil de pino radiata (Pinus radiata D. Don) sobre las propiedades mecánicas de tableros de hojuelas orientadas OSB. La madera para los ensayos es recogida de 10 árboles en pié de 26 años creciendo en plantaciones manejadas de la Octava región, Chile. La determinación de madera juvenil se realiza observando la variación radial de los anillos de crecimiento de la madera, usando un analizador de anillos en base a rayos X. Los detalles de l...

  8. Territorio virtual: arquitectrónica

    Directory of Open Access Journals (Sweden)

    Marta Borbonet

    2002-08-01

    Desde el nacimiento en 1989 del lenguaje HTML para el intercambio de datos entre científicos, de la mano de Tim Berners-Lee la densificación de la información en Internet ha adquirido proporciones colosales hasta hoy en día. Paralelamente al ingente volcado de información en la Red han ido creciendo lógicamente nodos de conexión, servidores, routers, etc. o sea, mecanismos de distribución y acceso a este flujo informacional.

  9. Aceite de frutos de Persea schiedeana en sobremaduración y cosechados de árboles en estado silvestre

    OpenAIRE

    Campos-Hernández, N; Cruz-Castillo, JG; Hernández-Montes, A; Rubio-Hernández, D

    2011-01-01

    En frutos sobremaduros de Persea schiedeana Nees colectados en árboles creciendo en estado silvestre se estudiaron las características químicas y sensoriales del aceite. La extracción de aceite con isopropanol y hexano tuvo un rendimiento de 12% aceite/pulpa (v/p). El aceite de P. schiedeana fue comparado con aceites comerciales de oliva y aguacate. El aceite de P. schiedeana tuvo menor número de insaturaciones y más ácidos grasos de cadena larga que los aceite de oliva y de aguacate. Los índ...

  10. Influencia de los balances microscópicos en el diseño de reactores de flujo pistón. Aplicación para la obtención de propilenglicol a partir de óxido de propileno

    OpenAIRE

    López Rodríguez, Sergio

    2017-01-01

    Actualmente, la optimización de los equipos de la industria de procesos en base a criterios económicos (sin dejar de lado el impacto medioambiental) está creciendo de manera significante. Una de las grandes limitaciones, en este sentido, es el tiempo de computación debido a la necesidad de optimizar uno o varios objetivos (coste e impacto ambiental generalmente) utilizando modelos complejos basados en ecuaciones diferenciales. En este trabajo, se ha propuesto una estructura sistemática para e...

  11. Consumo responsable

    Directory of Open Access Journals (Sweden)

    Educadores por la sostenibilidad

    2007-01-01

    Full Text Available Hablar de consumo moderado es plantear el problema del hiperconsumo de las sociedades “desarrolladas” y de los grupos poderosos de cualquier sociedad, que sigue creciendo como si las capacidades de la Tierra fueran infinitas. Baste señalar que los 20 países más ricosdel mundo han consumido en este siglo más naturaleza, es decir, más materia prima y recursos energéticos no renovables, que toda la humanidad a lo largo de su historia y prehistoria

  12. Propuesta Para La Disposición Adecuada De Los Residuos Sólidos Reciclables En El Laboratorio San Martín

    OpenAIRE

    Araya-Trejos, Yesenia

    2011-01-01

    Proyecto de Graduación (Maestría en Gestión de Recursos Naturales y Tecnologías de Producción) Instituto Tecnológico de Costa Rica. Área Académica Agroforestal, 2011. En las últimas décadas la generación de residuos sólidos ha ido creciendo exponencialmente a nivel mundial. Dentro de los factores que han contribuido a tal expansión están: la cultura de usar y tirar los llamados “desechables”, la elevada cantidad y diversidad de materiales de empaque que se comercializan con los productos, ...

  13. A multi-scale analysis of transforming agricultural markets in the context of globalization: implications for natural resources, food prices and rural poverty in Latin America

    OpenAIRE

    Flachsbarth, Insa

    2015-01-01

    Vivimos una época en la que el mundo se transforma aceleradamente. La globalización está siguiendo un curso imparable, la población mundial así como la población urbana siguen creciendo, y en los países emergentes los ingresos promedios aumentan, resultando en un cambio también acelerado de las dietas y hábitos alimentarios. En conjunto esos factores están causando un aumento fundamental de la demanda de alimentos. Junto con la apertura de los mercados agrícolas, estos procesos han provocado ...

  14. Editorial

    Directory of Open Access Journals (Sweden)

    Oscar Oswaldo Rodriguez Díaz

    2014-12-01

    Full Text Available El mercado de alta tecnología está creciendo a pasos gigantescos, es importante explorarlo, conocerlo y tratar de aprovechar al máximo, es así como la sociedad de consumo compra en forma masiva productos que apenas aprendemos a usar en un bajo porcenytaje de capacidades, un ejemplo es el celular, dispositivo que en primera instancia fue creado para realizar llamadas de cualquier puto y lugar "realizar llamadas", pero el mercado de consumo necesita nuevos dispositivos que complementen la vida diaria.

  15. Estudio de factibilidad para empresa de experiencias culturales en Medellín “Colombia en una Noche”

    OpenAIRE

    Aristizábal Botero, Santiago

    2013-01-01

    El número de visitantes extranjeros y de otras ciudades de Colombia con fines de negocios y turismo ha venido aumentando considerablemente en Medellín durante los últimos años -- Esto tiende a seguir creciendo, más aún luego de que la ciudad fue escogida por el Citigoup y el Wall Street Journal como la más innovadora del mundo en febrero de 2013 -- Estos visitantes llegan a la ciudad buscando cumplir con sus propósitos principales de turismo y negocios, pero adicionalmente ansían tener experi...

  16. Personas mayores con demencia institucionalizadas : efectos de la musicoterapia versus los talleres de reminiscencia-recreación

    OpenAIRE

    Solé Resano, Carme; Mercadal-Brotons, Melissa; Castro, Mónica de; Asensio, Francisca María

    2017-01-01

    Las personas afectadas de demencia continúan creciendo cada año.. Dentro del marco de la Psicología Positiva, vamos a estudiar los efectos positivos de la musicoterapia en la calidad de vida de las personas con demencia. El objetivo principal es analizar y comparar los efectos de un programa de musicoterapia (grupo experimental), y un programa de reminiscencia/recreación (grupo control) en personas mayores institucionalizadas. Se analiza el impacto: cognitivo, estado anímico y participación-i...

  17. Planeación estratégico de marketing infantil y de control interno para la empresa de eventos "Magic" dirigido a los niños de clase socio-económica media alta de la ciudad de Guayaquil.

    OpenAIRE

    Peña Calle, Enrique Leonardo; Sánchez Limones, Christian

    2015-01-01

    “MAGIC” es una empresa relativamente nueva, la cual cuenta con menos de 2 años de vida dentro del mercado de eventos infantiles, fue fundada en el año 2013; pero a pesar del poco tiempo en el mercado ha venido creciendo en una manera positiva ya que la empresa ofrece servicio de eventos infantiles personalizados para cada cliente con el fin de generar satisfacción y seguridad a cada uno de los padres en la organización del evento. El presente trabajo de titulación se fundamenta en la necesida...

  18. La escolarización en Gambia

    OpenAIRE

    Farjas Bonet, Anna

    2002-01-01

    Actualmente en Gambia el número total de alumnos matriculados en escuelas de modelo británico es mucho más alto que en escuelas coránicas formales o madrasas. De todas formas, la popularidad de los centros coránicos formales va creciendo, aunque lentamente, en todo el país. Las escuelas de modelo británico aún son vistas por la población rural como un elemento extranjero. De hecho, la educación occidental ha sido vista como un elemento extranjero desde su introducción. Las escuelas, sobre...

  19. Redes sociales, políticas públicas y capital social

    OpenAIRE

    Lluís Ballester; Belén Pascual; Carlos Vecina

    2014-01-01

    La comunidad, o en un espacio más amplio la propia sociedad, en cualquiera de sus dimensiones, no es un espacio cerrado sin conexiones e interconexiones; más bien puede concebirse como una red de relaciones. En este sentido, desde las Ciencias Sociales ha ido creciendo el interés por el estudio de las redes sociales; esto ha permitido comprender mejor como se construyen y mantienen las relaciones sociales entre la población. Junto al concepto de redes sociales aparece también el de capital...

  20. Servidor dedicado de seguridad en contenedores de Linux Docker

    OpenAIRE

    Arjona Rivera, Daniel

    2017-01-01

    Actualmente, estamos viviendo en un momento en el que la importancia de la seguridad informática está creciendo exponencialmente, en parte, debido a la gran subida del porcentaje de cibercrimen en los últimos meses. El sector empresarial y financiero como grandes afectados, han entrado en un estado de alerta en el cual la preocupación se ha hecho notar. El presente proyecto plantea una posible solución informática enfocada principalmente para aquellas personas que por su constante movilidad t...

  1. Teleoperación de un robot mindstorm mediante técnicas de visión artificial

    OpenAIRE

    Méndez Rodríguez, Eduardo

    2011-01-01

    Las tres partes tratadas son la teleoperacióon (principalmente con comunicaciones mediante bluetooth), la visión arti cial para elementos móviles en tiempo real y proyectos realizados con el Mindstorm NXT. Hay que destacar que en los dos primeros campos hay innumerables aplicaciones debido a que ambos campos siguen hoy en día bajo invetigación en busca de lograr mejoras tecnológicas, también los proyectos con el Mindstorm están creciendo exponencialmente, mayormente debido a...

  2. Mexican Immigrants and Temporary Residents in Canada: Current Knowledge and Future Research

    OpenAIRE

    Richard E. Mueller

    2005-01-01

    La migración de mexicanos a Canadá, aunque es un fenómeno reciente, ha tenido uno de los incrementos más significativos entre los movimientos de personas de América Latina. Desde mediados de los noventa, el número de mexicanos en Canadá ha estado creciendo rápidamente como resultado del retorno de los descendientes de la población menonita que emigró a México y de las disposiciones del Tratado de Libre Comercio de América del Norte (tlcan), que facilita el ingreso de ciudadanos mexicanos. En ...

  3. Internacionalización de Mercadona: Análisis del Sector de la Distribución Alimentaria en Coímbra

    OpenAIRE

    Sastre García, Héctor

    2017-01-01

    En un mundo cada vez más globalizado las empresas que tienen éxito en su país de origen pueden internacionalizarse para seguir creciendo. Se presenta un estudio de la internacionalización de la empresa Mercadona, con una reflexión sobre los diferentes motivos que pueden animar a que las empresas se internacionalicen y las diferentes formas de hacerlo. Se hace hincapié en Coímbra, ciudad de Portugal, como futuro destino de la empresa, evaluando la prosperidad y el bienestar del contexto en el ...

  4. Brain-Computer Interfaces: Desarrollo de un sistema de identificación de estados mentales alfa

    OpenAIRE

    Iglesias López, Pablo

    2016-01-01

    En el mundo actual las aplicaciones basadas en sistemas biométricos, es decir, aquellas que miden las señales eléctricas de nuestro organismo, están creciendo a un gran ritmo. Todos estos sistemas incorporan sensores biomédicos, que ayudan a los usuarios a controlar mejor diferentes aspectos de la rutina diaria, como podría ser llevar un seguimiento detallado de una rutina deportiva, o de la calidad de los alimentos que ingerimos. Entre estos sistemas biométricos, los que se basan en la in...

  5. El Bambú como material estructural:análisis de un caso práctico

    OpenAIRE

    Rodríguez Alonso, Cesar A.; Morales Díaz, Estefan

    2008-01-01

    Esta investigación quiere participar en la búsqueda de encontrar nuevas formas para el uso del bambú porque creciendo rápido y siendo muy resistente, el bambú es muy competitivo con respecto a otros materiales. La idea principal de esa investigación es aplicar al bambú las técnicas modernas de estructuras livianas, espaciales y flexibles del acero o la madera. De allí que decidieramos investigar sistemas estructurales que respondan a las siguientes pautas de diseño: aprovechamiento de la l...

  6. Implementación del sistema de venta de recarga virtual para distribuidores de una empresa de telecomunicaciones

    OpenAIRE

    Ibarra Apaza, Wilson Daniel; Ibarra Apaza, Wilson Daniel

    2012-01-01

    En la actualidad se ha observa que el Sector de las Telecomunicaciones ha ido creciendo notablemente, esto debido en parte al crecimiento económico del país en los últimos años, lo cual ha traído consigo oportunidades de negocio para las empresas de telecomunicaciones, quienes constantemente ofrecen productos y servicios de calidad enfocados a la satisfacción de los clientes, con la finalidad de retener a los clientes y atraer nuevos clientes de segmentos que aún no han sido explorados y que ...

  7. MOOC de Introducción al Business intelligence

    OpenAIRE

    Masip Rodó, David; Garrigues Olivella, Carles; Guitart Hormigo, María Isabel; Rius Gavidia, Àngels; Minguillón Alfonso, Julià; Rodríguez González, M. Elena; Rodríguez Bermúdez, José Ramón; Pujol Jover, Maria; Conesa Caralt, Jordi; Marco Simó, Josep Maria

    2015-01-01

    Colección de vídeos docentes del MOOC de Introducción al Business intelligence que la Universitat Oberta de Catalunya. El Business Intelligence es uno de los puntales de la actual revolución tecnológica que estamos experimentando. La cantidad de datos generados por la sociedad de la información crece día a día, y seguirá creciendo gracias a la explosión de las redes sociales, las smarts cities, el big data, los dispositivos móviles, los sensores, etc. Este incremento exponencial del volumen d...

  8. La economía colaborativa. Una aproximación al turismo colaborativo en España

    OpenAIRE

    Rodríguez Antón, José Miguel; Alonso Almeida, María del Mar; Rubio Andrada, Luis; Celemín Pedroche, Soledad

    2016-01-01

    La actualmente denominada economía colaborativa, como modelo económico y social en el que los agentes comparten, de manera temporal, activos, bienes y servicios, en muchos casos infrautilizados, a cambio de dinero o de otros servicios, utilizando plataformas on line, está creciendo de manera imparable y se está introduciendo en sectores tradicionales como la producción de bienes y la prestación de servicios profesionales y financieros y, muy especialmente, en el sector turismo, en concreto en...

  9. El Mercado Europeo de Productos Orgánicos de Comercio Justo

    OpenAIRE

    Garibay, Salvador; Richter, Toralf

    2005-01-01

    Los países centroamericanos son importantes productores de productos orgánicos. Su base de exportaciones, sin embargo, es altamente dependiente de un número limitado de productos (café, cacao, banano, azúcar) lo que atenta contra la sostenibilidad del sector exportador. Por lo tanto, hay una urgente necesidad de diversificar la base de exportaciones y de desarrollar mercados nacionales y regionales, los cuales están creciendo continuamente y tienen un gran potencial. El propósito de este repo...

  10. Periodo de interferencia de arvenses en el cultivo de berenjena (Solanum melongena L.

    Directory of Open Access Journals (Sweden)

    Aramendiz-Tatis Hermes

    2010-04-01

    Full Text Available

    Dada la importancia de la berenjena en la horticultura del Caribe colombiano, el presente trabajo buscó establecer las bases de un manejo sustentable e integrado de malezas en este cultivo, basado en el período de máxima interferencia de aquellas sobre este. El estudio se realizó en la Universidad de Córdoba, ubicada en Montería (8°39’ N; 75°58’ W. El diseño experimental consistió en bloques completamente aleatorizados, con cuatro repeticiones y siete tratamientos relacionados con periodos crecientes de control de arvenses, seguidos por ausencia de control. Los resultados muestran que las arvenses con mayor presencia fueron paja mona (Leptochloa filiformis [Lam.] Beauv., caminadora (Rottboellia cochinchinensis [Lour.] W.D. Clayton, liendre de puerco (Echinochloa colona [L.] Link., coquito (Cyperus rotundus L. y bledo (Amaranthus retroflexus L.. Las arvenses afectaron la altura de la planta, el diámetro del tallo, y el rendimiento y calidad del fruto. Este último parámetro no se ve afectado cuando el cultivar lila se mantiene limpio durante los primeros 40 días. Al considerar el tipo de productor de esta hortaliza en el valle del Sinú, se sugiere utilizar: i para áreas pequeñas, métodos físicos, como el arranque manual o corte con machete u otra herramienta, y prácticas culturales; ii para áreas grandes, la combinación de herbicidas de presiembra con métodos físicos y culturales.

  11. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas

    Directory of Open Access Journals (Sweden)

    Mier Barona Carmen Elena

    2009-06-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.

  12. Produção e indicadores fisiológicos de alface sob hidroponia com água salina Production and physiologic indicators of lettuce grown in hydroponics with saline water

    Directory of Open Access Journals (Sweden)

    Dalva Paulus

    2010-03-01

    Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes

  13. ANÁLISE DOS PARÂMETROS DE FUNCIONAMENTO E SIMULAÇÃO COMPUTACIONAL EM UM PROTÓTIPO DE TURBINA OPERANDO A AR COMPRIMIDO

    Directory of Open Access Journals (Sweden)

    Wesley Saldanha Nogueira Oliveira

    2016-12-01

    Full Text Available RESUMO. Este trabalho apresenta os resultados iniciais da comparação de alguns parâmetros de funcionamento do protótipo de uma turbina de ação simples, operando com ar comprimido como fluido de trabalho, realizados na unidade do SENAI de Barra do Piraí/RJ. O protótipo foi desenvolvido integralmente no Centro Universitário Geraldo Di Biase - UGB - Campus de Barra do Piraí/RJ, que inicialmente teve como o fluido de trabalho o vapor d’água, que nos testes inicias se mostrou ineficiente. A simulação computacional do sistema foi feita através do software SolidWorks na Universidade Federal Fluminense - UFF - Campus de Volta Redonda/RJ, o que permitiu determinar a faixa de trabalho que apresentou maior eficiência nos resultados experimentais do sistema por meio da relação entre pressão de operação, velocidade angular transmitida pelo fluido ao eixo da turbina e a potência da mesma. Os valores nas simulações em velocidade tangencial na região rotacional apresentaram-se convergentes aos valores experimentais medidos no protótipo.

  14. Spatio-temporal evaluation of emerging contaminants and their partitioning along a Brazilian watershed.

    Science.gov (United States)

    de Sousa, Diana Nara Ribeiro; Mozeto, Antonio Aparecido; Carneiro, Renato Lajarim; Fadini, Pedro Sergio

    2018-02-01

    The occurrence, partitioning, and spatio-temporal distribution of seven pharmaceuticals for human use, three steroid hormones and one personal care product were determined in surface water, suspended particulate matter (SPM), and sediment of Piraí Creek and Jundiaí River (Jundiaí River Basin, São Paulo, Brazil). The maximum average detected concentrations of the compounds in the Piraí River samples were contaminants most frequently detected in sediment and SPM samples. Triclosan had the highest average proportion of SPM as opposed to in the aqueous phase (> 75%). Contaminants with acid functional groups showed, in general, a lower tendency to bind to particulate matter and sediments. In addition, hydrophobicity had an important effect on their environmental partitioning. The spatial distribution of contaminants along the Jundiaí River was mainly affected by the higher concentration of contaminants in water samples collected downstream from a sewage treatment plant (STP). The results obtained here clearly showed the importance of the analysis of some contaminants in the whole water, meaning both dissolved and particulate compartments in the water, and that the partitioning is ruled by a set of parameters associated to the physicochemical characteristics of contaminants and the matrix properties of the studied, which need be considered in an integrated approach to understand the fate of emerging chemical contaminants in aquatic environments.

  15. Genetic variants of serum butyrylcholinesterase in Chilean Mapuche Indians.

    Science.gov (United States)

    Acuña, M; Eaton, L; Ramírez, N R; Cifuentes, L; Llop, E

    2003-05-01

    We estimated the frequencies of serum butyrylcholinesterase (BChE) alleles in three tribes of Mapuche Indians from southern Chile, using enzymatic methods, and we estimated the frequency of allele BCHE*K in one tribe using primer reduced restriction analysis (PCR-PIRA). The three tribes have different degrees of European admixture, which is reflected in the observed frequencies of the atypical allele BCHE*A: 1.11% in Huilliches, 0.89% in Cuncos, and 0% in Pehuenches. This result is evidence in favor of the hypothesis that BCHE*A is absent in native Amerindians. The frequencies of BCHE*F were higher than in most reported studies (3.89%, 5.78%, and 4.41%, respectively). These results are probably due to an overestimation of the frequency of allele BCHE*F, since none of the 20 BCHE UF individuals (by the enzymatic test) individuals analyzed showed either of the two DNA base substitutions associated with this allele. Although enzymatic methods rarely detect the presence of allele BCHE*K, PCR-PIRA found the allele in an appreciable frequency (5.76%), although lower than that found in other ethnic groups. Since observed frequencies of unusual alleles correspond to estimated percentages of European admixture, it is likely that none of these unusual alleles were present in Mapuche Indians before the arrival of Europeans. Copyright 2003 Wiley-Liss, Inc.

  16. Selection for bulb maturity in onion Seleção para maturidade de bulbos em cebola

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    2003-02-01

    Full Text Available It is possible to produce onions (Allium cepa all over the year in Brazil, but most of the Brazilian cultivars have poor quality bulbs, a fact that favours onion imports from Argentina, a producer of Valenciana type cultivars that does not bulb in Brazil, but please Brazilian consumers. To study the effect of selection for bulb maturity, seventeen half sib progenies selected for early maturity and twenty five for late maturity, from the intervarietal triple cross [Crioula x (Pira Ouro x Valenciana Sintetica 14] were grown, along with the triple cross itself and the cultivars Pira Ouro (short-day, Crioula (intermediate-day and Armada (long-day. A total of forty six treatments were tested in a randomized block design with three replications of 32 plants per plot. The progenies selected for earliness had cycles from 67 to 83 days, whereas those selected for lateness had cycles of 85 to 103 days. This difference was evident when comparisons were made for the percent thick neck bulbs, which varied from 0 to 6.2% and from 8.1 to 59.8% for the early and late progenies, respectively. High heritability estimates were obtained for all characters and they varied from 0.65 (thick neck percentage, in the late selection to 0.80 (average bulb weight, in the early selection. Progenies of higher bulb weight and maturity similar to the standard cultivars were obtained. Selection for maturity was highly efficient and the population selected for early maturity has potential to originate adapted cultivars, with bulb yield and quality superior to the available cultivars.Embora seja possível produzir cebola (Allium cepa o ano inteiro no Brasil, a maioria dos cultivares nacionais apresentam bulbos com baixa qualidade, o que proporcionou grande importação de cebola da Argentina, do tipo Valenciana, que não bulbifica no Brasil, mas que agradou os consumidores brasileiros. Para estudar o efeito da seleção para maturidade de bulbos baseada em progênies de meios irm

  17. Presence of two alternative kdr-like mutations, L1014F and L1014S, and a novel mutation, V1010L, in the voltage gated Na+ channel of Anopheles culicifacies from Orissa, India

    Directory of Open Access Journals (Sweden)

    Bhatt Rajendra M

    2010-05-01

    Full Text Available Abstract Background Knockdown resistance in insects resulting from mutation(s in the voltage gated Na+ channel (VGSC is one of the mechanisms of resistance against DDT and pyrethroids. Recently a point mutation leading to Leu-to-Phe substitution in the VGSC at residue 1014, a most common kdr mutation in insects, was reported in Anopheles culicifacies-a major malaria vector in the Indian subcontinent. This study reports the presence of two additional amino acid substitutions in the VGSC of an An. culicifacies population from Malkangiri district of Orissa, India. Methods Anopheles culicifacies sensu lato (s.l. samples, collected from a population of Malkangiri district of Orissa (India, were sequenced for part of the second transmembrane segment of VGSC and analyzed for the presence of non-synonymous mutations. A new primer introduced restriction analysis-PCR (PIRA-PCR was developed for the detection of the new mutation L1014S. The An. culicifacies population was genotyped for the presence of L1014F substitution by an amplification refractory mutation system (ARMS and for L1014S substitutions by using a new PIRA-PCR developed in this study. The results were validated through DNA sequencing. Results DNA sequencing of An. culicifacies individuals collected from district Malkangiri revealed the presence of three amino acid substitutions in the IIS6 transmembrane segments of VGSC, each one resulting from a single point mutation. Two alternative point mutations, 3042A>T transversion or 3041T>C transition, were found at residue L1014 leading to Leu (TTA-to-Phe (TTT or -Ser (TCA changes, respectively. A third and novel substitution, Val (GTG-to-Leu (TTG or CTG, was identified at residue V1010 resulting from either of the two transversions–3028G>T or 3028G>C. The L1014S substitution co-existed with V1010L in all the samples analyzed irrespective of the type of point mutation associated with the latter. The PIRA-PCR strategy developed for the

  18. Mujeres migrantes en un país en crisis

    Directory of Open Access Journals (Sweden)

    Giovanna Campani

    2013-10-01

    Full Text Available ¿Cuáles son los problemas que los migrantes, y especialmente las mujeres migrantes, enfrentan en Italia desde el inicio de la crisis económica, la que ha sido reforzada por las austeras políticas impuestas por el liderazgo germano de la Unión Europea? Datos recientes muestran que el desempleo está creciendo entre extranjeros, alcanzando el número de 318.000 personas en el segundo semestre de 2012 y de 385.000 en el primer semestre de 2013 sobre un total de 2.334.000 extranjeros activos. Además, estos datos indican que el porcentaje de desempleo es ahora más alto entre los extranjeros que entre los italianos: esta es una tendencia creciente, hasta 2010 ocurría lo contrario (Ministerio del Trabajo, 2013. Al mismo tiempo, la demanda por trabajo domestico, luego de una breve y limitada debacle en 2010 y 2011, está creciendo. Hay razones estructurales para esta paradoja.

  19. [The issue of medico-legal assessment of noise induced hearing loss: comparison of methods].

    Science.gov (United States)

    Bosio, D; Coggiola, M; Baracco, A; Andreis, P; Perrelli, F

    2011-01-01

    Audiogram classification is crucial for hearing protection of workers occupationally exposed to noise. The methods that have been proposed are based on two principles: the morphological evaluation of the audiometric curve (eg. Merluzzi-Pira-Bosio--MPB) or the average hearing loss on different frequencies (eg. Albera-Beatrice--AB). The purpose of this study was to classify audiograms compatible with chronic acoustic trauma performed at the Occupational Medicine Outpatient Clinic of CTO Hospital in Turin from 2004 to 2011 with the methods outlined in Guidelines published by SIMLII. A substantial agreement among the methods was observed. While MPB is the most appropriate method for secondary prevention, the AB would seem more appropriate for the verification of a permanent weakening that has to be reported to the competent legal authorities.

  20. Características estruturais de ácidos húmicos isolados de solos com adição de resíduos orgânicos de origem urbana: composição elementar, análise de RMN 13C e Pi-CG/EM

    OpenAIRE

    L. P. Canellas; A. A. Moraes; V. M. Rumjanek; M. R. Garcia; F. Guridi; G. A. Santos; A. C. X. Velloso; R. Braz-Filho

    2002-01-01

    Foram avaliadas as alterações nas características estruturais de ácidos húmicos (AH) decorrentes da adição de matéria orgânica de resíduos urbanos. Os AH foram extraídos da camada superficial (0-20 cm) de um Argissolo Vermelho-Amarelo (Seropédica, RJ) e de um Latossolo Vermelho Amarelo (Piraí, RJ), ambos tratados com o equivalente a 80 t ha-1 (em base seca) de composto de lixo urbano e lodo de estação de tratamento de esgotos. O tempo de incubação em laboratório foi de 24 semanas à temperatur...

  1. O CARAMUJO AFRICANO EM CONTEXTO ESCOLAR: AS PERCEPÇÕES DE ESTUDANTES DO ENSINO FUNDAMENTAL E O ESTUDO DA HELMINTOFAUNA ASSOCIADA AO CARAMUJO EM BARRA DO PIRAÍ (RJ

    Directory of Open Access Journals (Sweden)

    Zilene Moreira Pereira

    2012-01-01

    Full Text Available The study investigates elementary students’ perception of the species Achatina fulica (African snail and the risks this mollusc may pose to the population of Barra do Piraí – in the state of Rio de Janeiro. The research involved questionnaires, focus groups and field observations, besides A. fulica specimens parasitological analysis. The results indicated the presence of snails infected with nematodes of medical and veterinary interest in the locality. The students have a negative perception of the snail, and there is great difference between their perceptions and scientific knowledge. Based on the contributions of the perceptions study and of Meaningful Learning Theory, guidelines are suggested so that strategies for teaching the content regarding the African snail at school environment can be developed.

  2. What I wish I had in my stockroom

    Science.gov (United States)

    Sampere, Samuel

    2015-12-01

    Most new teachers walk into their new classroom territory and find at least some equipment. Perhaps there are items there that you don't recognize. One way to get those types of questions answered is to post a question and/or picture on the TAP-L (Teaching Apparatus List) listserv (see: http://www.pira-online.org for more information). Within a few short minutes, the sender will receive at least a couple of responses. But what if a new teacher walks into a totally empty prep room? Now that teacher is tasked with purchasing useful equipment, and we know that the opportunity for a similar acquisition in the near future is slim. So you better choose wisely! Whether my new stockroom is well equipped or completely empty, I would make sure to have the following six items in my arsenal.

  3. Edge stability and pedestal profile sensitivity of snowflake diverted equilibria in the TCV Tokamak

    International Nuclear Information System (INIS)

    Medvedev, S.Yu.; Ivanov, A.A.; Martynov, A.A.; Poshekhonov, Yu.Yu.; Behn, R.; Martin, Y.R.; Moret, J.M.; Piras, F.; Pitzschke, A.; Pochelon, A.; Sauter, O.; Villard, L.

    2010-01-01

    A second order null divertor (snowflake) has been successfully created and controlled in the TCV tokamak[1] (F. Piras et al., Plasma Phys. Control. Fusion, 2009). The results of ideal MHD edge stability computations show an enhancement of the edge stability properties of the snowflake equilibria compared to standard x-point configurations[2] (S. Yu. Medvedev et al., 36th EPS Conference on Plasma Physics, 2009). However, a sensitivity study of the stability limits to variations of the pedestal profiles is essential for making conclusions about possibilities of ELM control in snowflake plasmas. Variations of the edge stability and beta limits for several types of snowflake equilibria, different values of triangularity and various pedestal profiles are investigated (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. The Provisional Irish Republican Army and the Development of Mortars

    Directory of Open Access Journals (Sweden)

    Gary Ackerman

    2016-03-01

    Full Text Available The Provisional Irish Republican Army (PIRA repeatedly showed itself to be one of the most inventive and adaptive of all the violent non-state actors who operated in the latter part of the twentieth century. Among its most innovative exploits was the PIRA’s successful development and fielding – spanning almost its entire operational lifetime – of improvised mortar systems. This chapter will trace the sustained development of mortars, including the underlying motivations for pursuing mortars as a complex engineering effort, the process by which the development took place and the underpinnings of its success. The discussion will show that the PIRA’s mortar development program was born out of tactical necessity but enabled by good organizational practices and the organization’s access to materials, expertise and places in which to leverage these.

  5. Cristiani ed Ebrei dopo la Shoah. Momenti e protagonisti dell’Amicizia ebraico-cristiana di Firenze (1945-1965

    Directory of Open Access Journals (Sweden)

    Elena Mazzini

    2014-04-01

    Full Text Available Il contributo punta a ricostruire la genesi e la storia dell’Amicizia ebraico-cristiana di Firenze (AEC, fondata nel capoluogo toscano nel 1950 con l’intento di promuovere un dialogo interreligioso fra ebrei e cristiani all’indomani dell’Olocausto. La periodizzazione proposta prende avvio dalla data della nascita della stessa associazione e si conclude con il 1965, anno della chiusura del Concilio Vaticano II, che decreta prospettive religiose nuove della Chiesa cattolica nei suoi rapporti con l’ebraismo. Nata per volontà di Arrigo Levasti, Giorgio La Pira, Ines Zilli, Giorgio Spini, Giacomo Devoto, Angelo Orvieto e Aldo Neppi Modona, l’Amicizia fiorentina rappresentava la sezione italiana dell’International Council of Christians and Jews e dell’Amitié judéo-chrétienne di Parigi, divenendo presto un luogo di attività feconde per il dialogo interreligioso in età pre-conciliare.

  6. A BWR Safety and Operability Improvements

    International Nuclear Information System (INIS)

    Sawyer, Craig D.

    1993-01-01

    The A BWR is the culmination of 30 years of design, development and operating experience of BWRs around the world. It represents across the board improvements is safety, operation and maintenance practices (O and M), economics, radiation exposure and rad waste generation. More than ten years and $20m5 went into the design and development of its new features, and it is now under construction in Japan. This paper concentrates on the safety and operability improvements. In the safety area, more than a decade improvement in core damage frequency (CDFR) has been assessed by formal PIRA techniques, with CDFR less than 10 -6 /year. Severe accident mitigation has also been formally addressed in the design. Plant operations were simplified by incorporation of better materials, optimum use of redundancy in mechanical and electrical equipment so that on-line maintenance can be performed, by better arrangements which account for required maintenance practices, and by an advanced control room

  7. La configuración de un modelo : los catafalcos madrileños durante el reinado de Felipe V

    Directory of Open Access Journals (Sweden)

    Victoria Soto Caba

    1989-01-01

    Full Text Available En el último tercio del siglo xvii la tendencia decorativista y la variedad tipológica fueron las características más acusadas de los aparatos provisionales de las exequias reales. Las tradiciones locales y los talleres barrocos mantuvieron ambos rasgos durante gran parte de la centuria siguiente. El tapizado ornamental recubrió túmulos en forma de torre, pira, templetes, baldaquinos... Estas estructuras heredadas apenas dejaron sitio para nuevas variantes arquitectónicas, por lo que se puede decir que el siglo xviii, al menos la primera mitad, contribuyó muy poco en el enriquecimiento del repertorio tipológico de los catafalcos reales.

  8. Avaliação da perda de mercúrio total em peixe antes e após os processos de fritura e cocção Determination of mercury losses in fish after cooking

    Directory of Open Access Journals (Sweden)

    Aricelso Maia LIMAVERDE FILHO

    1999-01-01

    Full Text Available A perda de mercúrio contido em músculo de peixes (Piraíba, Brachyplatystoma ssp; Traíra, Hoplias malabaricus submetidos a dois distintos processos de cozimento foi investigada. Os resultados mostraram perdas variando entre 0 e 30% (base seca, indicando que a maior parte do mercúrio foi retida. Assim, tais processos não protegem as populações, que deles se utilizam, contra a exposição por ingestão ao mercúrio originariamente contido na amostra "in natura".Mercury losses from flesh fish after two cooking process were investigated. Results showed losses ranging from 0 to 30% (dry weight basis. Such result indicates that fish consuming populations are not protected from mercury exposition by the studied cooking processes.

  9. Evidence of spotted fever group rickettsiae in state of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    ROZENTAL Tatiana

    2002-01-01

    Full Text Available Ticks were obtained from dogs from February to September of 1999 at weekly intervals, in the County of Piraí, State of Rio de Janeiro. Four hundred seventy four ixodids were taxonomically identified, 103 Amblyomma cajennense, seven Amblyomma ovale, 209 Rhipicephalus sanguineus, and 155 Amblyomma sp. An hemolymph test associated with Giemsa's stain revealed two specimens in 163 ticks tested (R. sanguineus and Amblyomma sp, containing rickettsia-like organisms. Direct immunofluorescence verified the presence of spotted fever group rickettsia in one specimen of R. sanguineus. Considering the limited information on rickettsiosis in Brazil, principally in relation to the vectors involved in perpetuating it in foci, these preliminary results give us an idea on the importance of infection in ticks, allowing to expand our knowledge on this zoonosis.

  10. Características qualitativas de cultivares de cebola no sul de Minas Gerais Qualitative characteristics of onion cultivars in southern Minas Gerais State

    OpenAIRE

    Silvio Júlio de Rezende Chagas; Geraldo Milanez de Resende; Lair Victor Pereira

    2004-01-01

    Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...

  11. Características qualitativas de cultivares de cebola no sul de Minas Gerais

    OpenAIRE

    Chagas, Silvio Júlio de Rezende; Resende, Geraldo Milanez de; Pereira, Lair Victor

    2004-01-01

    Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...

  12. Photorhabdus insect-related (Pir) toxin-like genes in a plasmid of Vibrio parahaemolyticus, the causative agent of acute hepatopancreatic necrosis disease (AHPND) of shrimp

    Science.gov (United States)

    Han, Jee Eun; Tang, Kathy F. J.; Tran, Loc H.; Lightner, Donald V.

    2016-01-01

    The 69 kb plasmid pVPA3-1 was identified in Vibrio parahaemolyticus strain 13-028/A3 that can cause acute hepatopancreatic necrosis disease (AHPND). This disease is responsible for mass mortalities in farmed penaeid shrimp and is referred to as early mortality syndrome (EMS). The plasmid has a GC content of 45.9% with a copy number of 37 per bacterial cell as determined by comparative quantitative PCR analyses. It consists of 92 open reading frames that encode mobilization proteins, replication enzymes, transposases, virulence-associated proteins, and proteins similar to Photorhabdus insect-related (Pir) toxins. In V. parahaemolyticus, these Pir toxin-like proteins are encoded by 2 genes ( pirA- and pirB-like) located within a 3.5 kb fragment flanked with inverted repeats of a transposase-coding sequence (1 kb). The GC content of these 2 genes is only 38.2%, substantially lower than that of the rest of the plasmid, which suggests that these genes were recently acquired. Based on a proteomic analysis, the pirA-like (336 bp) and pirB-like (1317 bp) genes encode for 13 and 50 kDa proteins, respectively. In laboratory cultures of V. parahaemolyticus 13-028/A3, both proteins were secreted into the culture medium. We developed a duplex PCR diagnostic method, with a detection limit of 105 CFU ml−1 and targeting pirA- and pirB-like genes in this strain of V. parahaemolyticus. This PCR protocol can reliably detect AHPND-causing strains of V. parahaemolyticus and does not cross react with non-pathogenic strains or with other species of Vibrio isolated from shrimp ponds. PMID:25667334

  13. Application of iterative reconstruction in dynamic studies

    International Nuclear Information System (INIS)

    Meikle, S.R.

    1998-01-01

    Full text: The conventional approach to analysing dynamic tomographic data (SPECT or PET) is to reconstruct projections corresponding to each time interval separately and then fit a suitable tracer kinetic model to the dynamic sequence (method 1 ) . This approach assumes that the tracer distribution remains static during any given time interval and, for practical reasons, filtered back-projection (FBP) is the preferred reconstruction algorithm. However, alternative approaches exist which lend themselves to iterative algorithms, such as EM. One approach is to fit the model directly to the projection data, followed by EM reconstruction of the parameter estimates (method 2). This requires that the tracer model can be expressed as a linear function of the unknown model parameters. A third alternative is to incorporate the tracer model into the reconstruction algorithm (method 3). Such an extension was described during the early development of the EM algorithm, referred to as the EM parametric image reconstruction algorithm (EM-PIRA). We have investigated these various strategies for analysing dynamic data and their relative pros and cons. Tracer modelling was performed using a general model, referred to as spectral analysis, which makes no restriction on the number of physiological compartments and satisfies the linearity requirement of method 2. A kinetic software phantom was created and used to test the convergence and noise properties of the different approaches. In summary, method 2 is the most practical as it reduces the number of reconstructions by at least an order of magnitude and provides improved signal-to-noise ratios compared with method 1. EM-PIRA allows greater flexibility in the choice of parametric images and appears to have a regularising effect on convergence. Methods 2 and 3 are also better suited to dynamic scanning with a rotating camera, as they can potentially account for changes in tracer distribution between projections

  14. Characterization and PCR Detection Of Binary, Pir-Like Toxins from Vibrio parahaemolyticus Isolates that Cause Acute Hepatopancreatic Necrosis Disease (AHPND in Shrimp.

    Directory of Open Access Journals (Sweden)

    Ratchanok Sirikharin

    Full Text Available Unique isolates of Vibrio parahaemolyticus (VPAHPND have previously been identified as the causative agent of acute hepatopancreatic necrosis disease (AHPND in shrimp. AHPND is characterized by massive sloughing of tubule epithelial cells of the hepatopancreas (HP, proposed to be induced by soluble toxins released from VPAHPND that colonize the shrimp stomach. Since these toxins (produced in broth culture have been reported to cause AHPND pathology in reverse gavage bioassays with shrimp, we used ammonium sulfate precipitation to prepare protein fractions from broth cultures of VPAHPND isolates for screening by reverse gavage assays. The dialyzed 60% ammonium sulfate fraction caused high mortality within 24-48 hours post-administration, and histological analysis of the moribund shrimp showed typical massive sloughing of hepatopancreatic tubule epithelial cells characteristic of AHPND. Analysis of the active fraction by SDS-PAGE revealed two major bands at marker levels of approximately 16 kDa (ToxA and 50 kDa (ToxB. Mass spectrometry analysis followed by MASCOT analysis revealed that both proteins had similarity to hypothetical proteins of V. parahaemolyticus M0605 (contig034 GenBank accession no. JALL01000066.1 and similarity to known binary insecticidal toxins called 'Photorhabdus insect related' proteins A and B (Pir-A and Pir-B, respectively, produced by the symbiotic, nematode bacterium Photorhabdus luminescens. In in vivo tests, it was shown that recombinant ToxA and ToxB were both required in a dose dependent manner to cause AHPND pathology, indicating further similarity to Pir-A and -B. A single-step PCR method was designed for detection of the ToxA gene and was validated using 104 bacterial isolates consisting of 51 VPAHPND isolates, 34 non-AHPND VP isolates and 19 other isolates of bacteria commonly found in shrimp ponds (including other species of Vibrio and Photobacterium. The results showed 100% specificity and sensitivity for

  15. El emprendimiento social: una comparativa entre España y países sudamericanos

    Directory of Open Access Journals (Sweden)

    Catalina Nicolás Martínez

    2012-07-01

    Full Text Available La crisis global que sufrimos en la actualidad está haciendo que las labores realizadas por las empresas sociales sean imprescindibles para alcanzar una sociedad igualitaria, eficiente y justa. El número empresas sociales va creciendo año tras año, atendiendo problemas sociales generalmente olvidados por las instituciones. Los estudios empíricos que profundizan en el conocimiento de este tipo de emprendimiento social son escasos. Este trabajo, bajo el marco del proyecto Global Entrepreneurship Monitor (GEM, analiza la influencia de una serie de variables objetivas y cognitivas del emprendedor social, sobre una muestra constituida por emprendedores sociales en España y en diversos países sudamericanos.

  16. Gestión de calidad de las empresas comercializadoras de agua de mesa de la provincia de San Martin

    OpenAIRE

    Reátegui Vela, Aldo Omar

    2011-01-01

    Las ventas y el consumo de agua embotellada se han incrementado drásticamente en los últimos años. De 1988 a 2009, las ventas de agua embotellada a nivel mundial se han más que cuadruplicado a más de 131 millones de metros cúbicos anuales. Las ventas de agua embotellada en todo el mundo están aumentando a razón de 6% por año, mientras que el volumen de las bebidas de fruta que se consume es cada vez menos del 2% anual y venta de cerveza y la venta de refrescos están creciendo a menos del 1% a...

  17. Residencia Universitaria + Centro de Producción Cultural en Edimburgo

    OpenAIRE

    García Blaya, Paula

    2018-01-01

    EDIMBURGO: DATOS DEMOGRÁFICOS. Edimburgo es la ciudad que más está creciendo en Escocia desde hace varios años. En el último censo, realizado en el año 2011, se puso de manifiesto que la población había crecido un 6,2% entre 2001-2011, y este aumento ha ido incrementándose en los últimos años; se espera que la población crezca, entre 2012-2037, más que cualquier otra ciudad en el Reino Unido. Esto se debe, principalmente, al crecimiento de población extranjera, que ha pasado de ser el 8% de l...

  18. La reciente narrative Espaňola en el context postmoderno

    Directory of Open Access Journals (Sweden)

    Yvonna Vaňková

    2001-12-01

    Full Text Available Año tras año está creciendo la cantidad de biografia, escrita desde diversas fuentes, per­ spectivas y ramas del saber sobre lo que, en estas últimas décadas del siglo XX, se ha denominado posmodernidad/posmodernismo. Este fenómeno es tratado y debatido en numerosos articulos y volúmenes monográficos, en congresos, seminarios y reuniones científicas, abordado desde puntos de vista especializados o de forma interdisciplinar. Los teóricos más destacados y tan diferentes entre si como Habermas, Sontag, Lyotard, Vattimo, Foucault, Derrida o Jameson, desde posiciones distintas y utilizando diferentes planteamientos, intentan proporcionarnos las claves de comprensión y un sistema mas o menos adecuado para orientarnos mejor en el mundo contemporaneo.

  19. Capítulo 2. Introducción, epidemiología de la falla cardiaca e historia de las clínicas de falla cardiaca en Colombia

    Directory of Open Access Journals (Sweden)

    Efraín Gómez

    2016-03-01

    Conclusión: Las clínicas de falla cardiaca surgieron en Colombia en 1985. Desde entonces se cuenta con varios programas en ciudades como Bogotá, Medellín, Cali y Bucaramanga que ofrecen la opción de seguimiento multidisciplinario por Enfermería y Cardiología, e incluso muchas de ellas tienen programas de trasplante de corazón. Sin embargo, el reto actual para todos los programas es continuar creciendo e integrándose con los niveles básicos de atención para permitir intervenir desde la prevención, el diagnóstico temprano y el tratamiento adecuado de la falla cardiaca.

  20. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    OpenAIRE

    Oliva Marañón, Carlos

    2012-01-01

    En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca Universidad. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institucional Audi...

  1. La “defensa social”. Pugnas y competencias en torno a la mano de obra en el Oriente Boliviano, 1890-1910.

    Directory of Open Access Journals (Sweden)

    Ana María Lema Garrett

    2010-01-01

    la región amazónica boliviana, al norte del país, suscitó profundos cambios en otros departamentos y, entre otras cuestiones, en el mercado laboral. Los departamentos de Beni y de Santa Cruz se constituyeron entonces en reservorios de mano de obra y el flujo migratorio hacia las regiones gomeras del norte fue creciendo proporcionalmente a las necesidades de los empresarios gomeros. Sin embargo, las regiones de origen, y específicamente Santa Cruz, reaccionaron en contra de este “vaciamiento”, desarrollando estrategias para controlar las migraciones o, eventualmente, frenarlas. Este proceso fue acompañado por el despliegue de varias normas novedosas en el ámbito laboral, producto de un debate parlamentario en torno al tema de las migraciones.

  2. Industrias, distritos, instituciones y escenas : tipología de clústeres culturales en Barcelona.

    OpenAIRE

    Rius-Ulldemolins, Joaquim; Zarlenga, Matías I.

    2014-01-01

    En los últimos veinte años ha ido creciendo en el ámbito de las ciencias sociales el interés por el análisis de la dinámica territorial de la cultura y en particular su tendencia a la clusterización. La mayor parte de la literatura sobre el tema analiza los clústeres culturales entendiéndolos como un solo tipo y desde la dimensión de la planificación urbana o los impactos económicos. No obstante, cada vez se toma más consciencia de la importancia de la naturaleza de la actividad y de las diná...

  3. El fundamentalismo islámico en América Latina.

    OpenAIRE

    Rosemberg Fuentes, Velvet

    2018-01-01

    238 p. El islam, aunado al cristianismo, budismo, judaísmo e hinduismo entre otros, forma parte de los sistemas religiosos que cuentan con un gran número de seguidores en el mundo. Con el correr de los años el Islam ha ido ganando una gran cantidad de adeptos alrededor del orbe y día con día continúa creciendo. Los musulmanes se han expandido a lo largo del planeta y con ellos el Islam como un sistema de vida que va más allá del ámbito religioso. Para 2009, según Pew Research Center 0.3 po...

  4. Pentecostalismo en contextos rurales de violencia. El caso de El Garzal, sur de Bolívar, Colombia

    Directory of Open Access Journals (Sweden)

    William Mauricio Beltrán

    2016-01-01

    Full Text Available Como en el resto de Colombia, el movimiento pentecostal está creciendo aceleradamente en los espacios rurales y en las zonas golpeadas por el conflicto armado. Este ar-tículo explora, por medio de un estudio de caso, algunos de los impactos económicos y políticos de este proceso. En particular, se pregunta por la capacidad de las comu-nidades pentecostales de constituirse en espacios de organización social para hacer frente a la precariedad económica y a las amenazas propias del conflicto armado co-lombiano (secuestros, masacres y desplaza-miento forzado. Según el caso estudiado, las comunidades pentecostales pueden fa-cilitar la asociación de campesinos para el desarrollo de emprendimientos productivos y para la organización política desde la base, especialmente en procesos de resistencia pacífica.

  5. EVALUACIÓN DE LA TELEVISIÓN INTERACTIVA DESDE UNA PERSPECTIVA DE USABILIDAD: CASO PRÁCTICO

    Directory of Open Access Journals (Sweden)

    César Alberto Collazos Ordoñez

    2009-01-01

    Full Text Available La televisión interactiva ha ido creciendo en popularidad, en poco tiempo esta tecnología estará en nuestros hogares. A diferencia de la televisión analógica, la televisión digital posibilita la transformación de televidentes pasivos en activos con la capacidad de interactuar con nuevos servicios superpuestos sobre los contenidos y novedosas formas de negocio. Uno de los aspectos más importantes a analizar en este nuevo estilo interactivo es su usabilidad. Este trabajo presenta una pauta para evaluar la usabilidad de este tipo de servicios. Por último, se presentan los resultados de un caso práctico.

  6. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos

    OpenAIRE

    Julio CABERO ALMENARA; Verónica MARÍN DÍAZ; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previame...

  7. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos Women and research in educational technology. Analysis of its presence in the author of scientific papers

    OpenAIRE

    Julio CABERO ALMENARA; Verónica MARÍN DÍAZ; Ana Isabel VÁZQUEZ MARTÍNEZ

    2011-01-01

    La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previame...

  8. UN SEGMENTO DEL TURISMO INTERNACIONAL EN AUGE: EL TURISMO DE CAZA

    Directory of Open Access Journals (Sweden)

    Juan Ignacio Rengifo Gallego

    2008-01-01

    Full Text Available El número de turistas internacionales viene creciendo de forma continuada desde que existen fuentes estadísticas. Este crecimiento, que no sólo ha sido cuantitativo, sino espacial, ha ido acompañado de una segmentación del mercado en función de las motivaciones. Entre estos segmentos se halla el turismo cinegético, modalidad que ha experimentado un importante crecimiento en los últimos años por diversos motivos. Este incremento ha ido asociado a la movilidad de un porcentaje importante de cazadores de Europa y Estados Unidos, a la existencia de una gran variedad de especies cinegéticas en el mundo que se distribuyen de forma irregular por el territorio y al desarrollo de un entramado empresarial que participa en la comercialización de la caza.

  9. Cervecería Artesanal, Mela`s Craft Beer : trabajo de Grado en emprendimiento

    OpenAIRE

    Manotas, Eduardo Alejandro

    2017-01-01

    En Colombia, el consumo de cerveza viene creciendo a pasos agigantados, nada más en los últimos 4 años pasamos de ser el octavo país en consumo per cápita de cerveza en Latinoamérica con 45 Litros a ser el tercero con un consumo de 58Lt. Al año. EL crecimiento de Bavaria se ha sostenido alrededor de los 18 puntos porcentuales y el de la cerveza artesanal esta aproximadamente en un 40% año a año. Mela´s Craft Beer nace bajo la necesidad de traer al país cerveza de calidad mundial como no ex...

  10. Control de un generador doblemente alimentado para turbinas eólicas

    OpenAIRE

    Gamarra Rodríguez, Isabel

    2009-01-01

    En los últimos años se está produciendo un crecimiento de demanda energética y un aumento de los niveles de contaminación, debido en parte a la industrialización de países en vías de desarrollo. Para controlar la problemática actual y contribuir al desarrollo sostenible se hace uso, cada vez más, de sistemas de conversión eléctrica mediante fuentes renovables. En particular una de ellas está sufriendo un aumento considerable y se prevé seguirá creciendo, la energía eólica. ...

  11. Influencia de la corrupción en la implantación de la ISO 9001

    OpenAIRE

    Olga Rodriguez Arnaldo; Angel R. Martinez Lorente

    2014-01-01

    En las últimas dos décadas, el número de empresas certificadas por ISO 9001 ha ido creciendo constantemente llegando a finales de 2011 a más de 1,1 millones en todo el mundo (ISO, 2012). Sin embargo, la distribución de certificados entre los países no coincide con el peso que cada uno tiene en la economía global. Este artículo comienza con una breve revisión de la literatura sobre las razones por las que las empresas implantan un sistema de gestión que se ajusta a la norma ISO 9001. Esta revi...

  12. Reconocimiento de una plataforma para aterrizaje de UAV mediante procesamiento de imágenes

    OpenAIRE

    Álvarez Piñeiro, Emilio

    2016-01-01

    En el año 2016 se vendieron en EE.UU más de un millón de Unmanned Aerial Vehicles (UAVs, Vehículos aéreos no tripulados), casi el doble que el año anterior, país del que se dispone de información. Para el año 2020 se estima que este mercado alcance los 5.600 millones de dólares en todo el mundo, creciendo a un ritmo del 30% anual. Este crecimiento demuestra que existe un mercado en expansión con muchas y diversas oportunidades de investigación. El rango de aplicaciones en los que se utiliz...

  13. Sistema de prototipos para control numérico

    Directory of Open Access Journals (Sweden)

    Abdón Sánchez Sossa

    1992-05-01

    Full Text Available La mejor utilización de equipos de alta tecnología implica el contar con el adecuado entrenamiento. La conformaci6n del Grupo de Control Numérico Computarizado de Ingenierfa de Sistemas en 1987, pionero, al permitir canalizar y consolidar en tres cursos electivos interdisciplinarios una respuesta a las inquietudes académico-docentes de apoyo al sector manufacturero. El desarrollo de varios programas, cuya complejidad ha venido creciendo con el tiempo, permitió explorar la aplicabilidad de los conceptos presentados en clase y sirvió de vinculo con la realidad Nacional de manera activa y comprometida, con el desarrollo del país. Los programas descritos en este trabajo son el resultado de muchas horas de labor y realizados contando con un exiguo presupuesto.

  14. Estudio teórico del comportamiento no lineal de losas de cimentación. Obtención de un método simplificado para la determinación del coeficiente de balasto y de los esfuerzos en losas de cimentación con geometría regular

    OpenAIRE

    Arroyo Portero, Juan Carlos

    2017-01-01

    Los métodos de análisis de losas de cimentación utilizados en la mayoría de los proyectos, desde Winkler hasta hoy, utilizan la hipótesis de relación lineal entre el asiento y la presión, denominada balasto. También desde hace tiempo, se sabe que esta relación no es cierta ni siquiera en todos los puntos de una misma losa en un terreno homogéneo, cargada con una carga uniforme, porque la relación real entre la presión y el asiento va creciendo del centro a los bordes. Sin embargo, e...

  15. Heterogeneity of Human Melanoma Cell Lines: a quantitative study of protein and mRNA expression profiles using Flow Cytometry and Real time PCR

    OpenAIRE

    Norte Pinto, Sandra Cristina

    2015-01-01

    El melanoma es el tipo de cáncer de piel más agresivo. Ocurre en los melanocitos, células productoras de melanina ubicadas en la capa inferior de la epidermis, en la piel. El melanoma puede propagarse a través del tejido creciendo en áreas cercanas. Cuando las células tumorales se separan del tumor primario y viajan a través del sistema linfático o de la sangre para otras partes del cuerpo donde se establecen y empiezan a formar un tumor metastásico, se denomina metástasis. La metástasis gene...

  16. Mexican Immigrants and Temporary Residents in Canada: Current Knowledge and Future Research

    Directory of Open Access Journals (Sweden)

    Richard E. Mueller

    2005-01-01

    Full Text Available La migración de mexicanos a Canadá, aunque es un fenómeno reciente, ha tenido uno de los incrementos más significativos entre los movimientos de personas de América Latina. Desde mediados de los noventa, el número de mexicanos en Canadá ha estado creciendo rápidamente como resultado del retorno de los descendientes de la población menonita que emigró a México y de las disposiciones del Tratado de Libre Comercio de América del Norte (tlcan, que facilita el ingreso de ciudadanos mexicanos. En este artículo se examina el número de mexicanos en Canadá, el tiempo de su ingreso y el número de migrantes temporales admitidos, y sugiere áreas de investigación para el futuro.

  17. Talento emprendedor, inteligencia, creatividad y sistema educativo

    Directory of Open Access Journals (Sweden)

    Mariano Gutiérrez Tapias

    2014-01-01

    Full Text Available En este artículo, pretendemos realizar un sencillo análisis de términos relacionados con el talento, el emprendimiento y la creatividad por entender que dichos conceptos deben estar presentes en aquellas sociedades que pretenden seguir creciendo en lo cultural, en lo social y en lo económico. Ya decía Einstein que es muy difícil encontrar niños que sigan siendo creativos al terminar la escuela. Este reto debe afrontarlo el sistema educativo si quiere ser de utilidad a la sociedad, favorecer personas críticas y creativas, con pensamientos divergentes, capaces de aprender y desaprender, de reinventarse varias veces a lo largo de su vida.

  18. PROPUESTAS PARA EL DESARROLLO Y COMERCIALIZACIÓN DEL TURISMO ORNITOLÓGICO EN EXTREMADURA

    Directory of Open Access Journals (Sweden)

    José Manuel Hernández Mogollón

    2011-01-01

    Full Text Available El turismo ornitológico es una de las grandes apuestas en el desarrollo turístico de Extremadura dada su riqueza en aves. El número de empresas enfocadas a este segmento está creciendo, las agencias de viajes ya incluyen estos paquetes en sus programaciones y la administración turística regional promueve eventos como la Feria Internacional de Turismo Ornitológico (FIO en Monfragüe, considerado punto de referencia mundial. Este trabajo trata de poner de manifiesto la relevancia de Extremadura como destino de turismo ornitológico aportando propuestas para su desarrollo y comercialización.

  19. ESTUDIOS EMBRIOLOGICOS Y CITOLOGICOS EN LA YERBA MATE ILEX PARAGUARIENSIS (AQUIFOLIACEAE

    Directory of Open Access Journals (Sweden)

    Cesar Otto Niklas

    1987-01-01

    Full Text Available El recuento cromosómico de Ilex paraguariensis St. Hil. confirmó el número 2n = 40 para todo el material estudiado. En el análisis de la meiosis se comprobó que tiene un comportamiento normal, presentando 20 II. El polen analizado presentó cerca de 100% de fertilidad. Se estableció que el saco embrionario es del tipo Polygonum. Cuando la fruta está madura, los embriones se encuentran en diferentes etapas: globulares 2,6%, corazón 70,24%, post corazón 23,3%; torpedo 2,62% y maduros 0,96%. Estos embriones seguen creciendo cuando la semilla está en condiciones para germinar, esta es la razón del lento desarrollo observado en la germinación.

  20. Hifenaciones instrumentales entre la cromatografía líquida, diferentes sistemas detectores y nuevos métodos de pretratamiento de muestra para la determinación de vitaminas en alimentos

    OpenAIRE

    Bravo Bravo, María de los Ángeles

    2013-01-01

    El Objetivo Principal de esta Tesis Doctoral es desarrollar nuevos métodos analíticos para la determinación de vitaminas, constituyentes esenciales en la dieta humana. La Cromatografía Líquida (LC) combinada en línea con Espectrometría de Masas (MS) es una de las metodologías analíticas más sensibles y selectivas, y la aplicación de esta técnica está creciendo rápidamente en análisis de alimentos. Dependiendo de las estructuras químicas y características analíticas de los grupos de vitamin...

  1. Terapias alternativas contra el cáncer basadas en la aplicación de campos eléctricos

    OpenAIRE

    Marshall, Guillermo Ricardo; Suárez, Cecilia

    2017-01-01

    El cáncer es la segunda causa de muerte por enfermedad en el mundo y su incidencia sigue creciendo con el aumento de la contaminación y del envejecimiento del promedio poblacional. La Argentina no es la excepción, como lo muestran las estadísticas del Ministerio de Salud (Estadísticas Vitales de 2002 a 2006). Además de un problema médico, el cáncer es un problema económico: el impacto en la economía es enorme y la tendencia actual en los países centrales es invertir recursos en investigación,...

  2. Marketing Relacional como Factor para la Competitividad

    Directory of Open Access Journals (Sweden)

    Francisca Sánchez de Dusso

    2009-12-01

    Full Text Available Durante los últimos años ha venido creciendo el interés por el estudio del marketing relacional focalizado en el establecimiento de relaciones a largo plazo con los consumidores, dejando atrás al concepto del marketing desde una perspectiva sólo transaccional. Sin embargo muy poco ha sido investigado sobre la aplicación de este nuevo paradigma en empresas de mediana y pequeña envergadura. El objetivo del presente trabajo es describir cómo el marketing relacional puede contribuir al desarrollo de las pequeñas y medianas empresas de nuestra región. Este artículo se enmarca en un estudio mayor en el que se realizará una bajada empírica.

  3. Modelización del crecimiento de una población microbiana en medio líquido y su implicación en el estudio de la morfología celular a través del análisis digital de imágenes

    Directory of Open Access Journals (Sweden)

    Ángel Viteri

    2017-08-01

    Full Text Available Cuando la levadura crece en un medio líquido rico en nutrientes genera una curva de crecimiento que presenta principalmente tres fases: fase de adaptación (o fase lag, fase exponencial (o fase log, y fase estacionaria. El modelo de Buchanan es un modelo lineal a trozos, simple pero suficientemente bueno para obtener estimaciones de los principales parámetros cinéticos de crecimiento microbiano. La morfometría de las levaduras que se reproducen por gemación (con células madre y células hija informa sobre el estado de las poblaciones y su capacidad productiva. Se han analizado de forma conjunta resultados experimentales en relación al número de células de S. cerevisiae creciendo en un medio de cultivo líquido cerrado con glucosa y con dos concentraciones diferentes de oxígeno (condiciones aerobias y microaerófilas, y un conjunto de imágenes digitales tomadas de estas células creciendo. Las distribuciones de valores obtenidos para los parámetros morfológicos de las células (área, perímetro, diámetro mayor, diámetro menor, circularidad y elongación se han relacionado con las distintas fases de crecimiento identificadas con el modelo Buchanan ajustado. La utilización de un modelo de crecimiento poblacional y los parámetros cinéticos estimados junto con el análisis de imágenes digitales de células individuales ha generado una aproximación muy atractiva del sistema, permitiendo conjugar conceptos matemáticos y biológicos a la vez que realizar un estudio a dos niveles distintos del sistema, a nivel poblacional y a nivel individual.

  4. Estilos de vida de pacientes hipertensos atendidos com la Estrategia de Salud de la Familia Estilos de vida de pacientes hipertensos atendidos com a Estratégia de Saúde Familiar Hypertensive patients’ attended with the family health strategy lifestyle

    Directory of Open Access Journals (Sweden)

    Elisabete Pimenta Araujo Paz

    2011-11-01

    Full Text Available Objetivo. Describir los estilos de vida de los pacientes hipertensos atendidos con la Estrategia de Salud de La Familia. Metodología. De octubre de 2009 a enero de 2010, se llevó a cabo un estudio transversal, en el que participaron 273 pacientes hipertensos seleccionados aleatoriamente del programa de salud familiar que atiende tres áreas de Piraí/RJ. Para la recolección de datos se utilizó el cuestionario "Estilo de Vida Fantástico". Resultados. De la muestra de estudio: el 61% eran mujeres, el 56% con 60 y más años, el 81% tenía bajo nivel de educación y 74% con bajos ingresos familiares. Los factores de riesgo más frecuentes fueron El sobrepeso u obesidad (72% y la diabetes mellitus (37%. La calificación del estilo de vida fue: 13% excelente, 55% muy bueno, 27% bueno y regular 4%. Conclusión. Aunque el estilo de invida se consideró satisfactorio, las condiciones socioeconômicas y el perfil de salud indican la persistencia de factores de riesgo de enfermedad cardiovascular.Objetivo. Descrever os estilos de vida dos pacientes hipertensos atendidos com a estratégia de Saúde Familiar. Metodologia. De outubro de 2009 a janeiro de 2010, levou-se a cabo um estudo transversal, no que participaram 273 pacientes hipertensos selecionados aleatoriamente do programa de Saúde Familiar que atende três áreas de Piraí/RJ (Brasil. Para a colheita de dados se utilizou o questionário "Estilo de Vida Fantástico". Resultados. Da mostra de estudo: o 61% eram mulheres, o 56% tinha 60 e mais anos, o 81% possuía sob nível de educação e 74% reportou ter baixos rendimentos familiares. Os fatores de risco mais frequentes foram o sobrepeso ou obesidade (72% e a diabete mellitus (37%. A qualificação do estilo de vida foi: 13% excelente, muito bom 55%, bom 27% e regular 4%. Conclusão. Ainda que o estilo de vida se considerou satisfatório, as condições e o perfil de saúde indicam a persistência de fatores de risco de doen

  5. Acute Hepatopancreatic Necrosis Disease-Causing Vibrio parahaemolyticus Strains Maintain an Antibacterial Type VI Secretion System with Versatile Effector Repertoires.

    Science.gov (United States)

    Li, Peng; Kinch, Lisa N; Ray, Ann; Dalia, Ankur B; Cong, Qian; Nunan, Linda M; Camilli, Andrew; Grishin, Nick V; Salomon, Dor; Orth, Kim

    2017-07-01

    Acute hepatopancreatic necrosis disease (AHPND) is a newly emerging shrimp disease that has severely damaged the global shrimp industry. AHPND is caused by toxic strains of Vibrio parahaemolyticus that have acquired a "selfish plasmid" encoding the deadly binary toxins PirA vp /PirB vp To better understand the repertoire of virulence factors in AHPND-causing V. parahaemolyticus , we conducted a comparative analysis using the genome sequences of the clinical strain RIMD2210633 and of environmental non-AHPND and toxic AHPND isolates of V. parahaemolyticus Interestingly, we found that all of the AHPND strains, but none of the non-AHPND strains, harbor the antibacterial type VI secretion system 1 (T6SS1), which we previously identified and characterized in the clinical isolate RIMD2210633. This finding suggests that the acquisition of this T6SS might confer to AHPND-causing V. parahaemolyticus a fitness advantage over competing bacteria and facilitate shrimp infection. Additionally, we found highly dynamic effector loci in the T6SS1 of AHPND-causing strains, leading to diverse effector repertoires. Our discovery provides novel insights into AHPND-causing pathogens and reveals a potential target for disease control. IMPORTANCE Acute hepatopancreatic necrosis disease (AHPND) is a serious disease that has caused severe damage and significant financial losses to the global shrimp industry. To better understand and prevent this shrimp disease, it is essential to thoroughly characterize its causative agent, Vibrio parahaemolyticus Although the plasmid-encoded binary toxins PirA vp /PirB vp have been shown to be the primary cause of AHPND, it remains unknown whether other virulent factors are commonly present in V. parahaemolyticus and might play important roles during shrimp infection. Here, we analyzed the genome sequences of clinical, non-AHPND, and AHPND strains to characterize their repertoires of key virulence determinants. Our studies reveal that an antibacterial type

  6. Desempenho de cultivares de alface crespa em dois ambientes de cultivo em sistema hidropônico Performance of lettuce cultivars grown in two environments, in the NFT hydroponic system

    Directory of Open Access Journals (Sweden)

    SF Blat

    2011-03-01

    Full Text Available Este trabalho foi desenvolvido em Ribeirão Preto-SP, de 06/02 a 07/04 de 2006. O objetivo foi avaliar o desempenho de cinco cultivares de alface (Pira Roxa, Belíssima, Locarno, Crespona Gigante e Verônica em dois ambientes de cultivo (casa de vegetação climatizada e não climatizada em sistema hidropônico NFT. O delineamento experimental foi em blocos casualizados para cada ambiente com três repetições sendo cinco cultivares. Os ambientes foram comparados por meio de análise conjunta. Avaliaram-se a massa fresca e seca da parte aérea, massas fresca e seca do caule, massa fresca e seca da raiz, número de folhas maiores que 10 cm e número total de folhas. Não houve efeito significativo da interação cultivares e ambientes, demonstrando que as cultivares tiveram comportamento similar em ambos os ambientes.This research was carried out in Ribeirão Preto, São Paulo State, Brazil, from February to April, 2006. The performance of five lettuce cultivars (Pira Roxa, Belíssima, Locarno, Crespona Gigante and Verônica was evaluated, growing the plants in two environments (conventional and acclimatized greenhouse in hydroponic system NFT. A randomized-block experimental design was used for each environment, with three replications and five cultivars. The environments were compared through joint analysis. Evaluations were done for fresh and dry mater of the aboveground part, stem, and roots; number of leaves larger than 10 cm and total number of leaves. The cultivars Crespona Gigante and Verônica were prominent with regard to green and dry mass of the aboveground part, leaves, and roots, as well as to the number of leaves larger than 10 cm. The interaction cultivar x environment was not significant, demonstrating that the cultivars had similar behavior in both environments.

  7. PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato

    Science.gov (United States)

    Singh, Om P; Bali, Prerna; Hemingway, Janet; Subbarao, Sarala K; Dash, Aditya P; Adak, Tridibes

    2009-01-01

    Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr) is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F) in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F) in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR), an Amplification Refractory Mutation System (ARMS) and Primer Introduced Restriction Analysis-PCR (PIRA-PCR) were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method was refractory to non

  8. Disponibilidade hídrica e germinação de sementes de cebola (Allium cepa L. Water availability and germination of onion seeds (Allium cepa L.

    Directory of Open Access Journals (Sweden)

    Z. Piana

    1994-12-01

    Full Text Available Objetivando verificar a influência do teor de água do substrato na germinação de sementes de cebola (Allium cepa L., conduziu-se um ensaio sob condições de ambiente de laboratório. Os efeitos de cinco níveis de água no substrato solo x areia (3:1, 20, 40, 60, 80 e 100% da capacidade de retenção foram avaliados através da porcentagem de emergência no 14° dia da semeadura e pesos da matéria verde e seca das plântulas normais. Para tanto, 200 sementes do cultivar Pira Ouro por tratamento, em quatro repetições de 50, foram semeadas a 1,5 cm de profundidade, mantendo-se constantes os níveis de água no substrato. Os resultados possibilitaram concluir que os níveis de umidade do solo indicados para germinação de sementes de cebola são de 40% e 60% da capacidade de retenção do substrato, por possibilitarem uma melhor emergência, peso da matéria verde e seca das plântulas.One essay was conducted under laboratory conditions, in order to verify the influence of substrate water content on the germination of onion (Allium cepa L. seeds. The effect of five water levels in the medium soil x sand (3:1 - 20, 40, 60, 80 and 100% retention capacity-were evaluated through the emergence percentage 14 days after seedling and the weight of fresh and dry matters of normal seedlings. For that purpose, 200 treated seeds of Pira Ouro cultivar were sown 1.5 cm deep in four replicátions of 50, with a constant water content in the medium. The best results showed that the soil moisture levels suggested for the germination of onion seeds were 40% to 60% of the substrate retention capacity, once they provide better emergence, weight of the fresh and dry matters of seedlings.

  9. Características produtivas de cultivares de cebola no Sul de Minas Gerais Yield of onion cultivars in the Southern region of Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Geraldo M. de Resende

    2003-12-01

    Full Text Available Identificou-se cultivares de cebola mais produtivas através de um ensaio da EPAMIG em Lavras, de março a setembro de 1994. O delineamento experimental foi de blocos ao acaso com quatro repetições e sete tratamentos, constituídos das cultivares Granex 33, Texas Grano 502, Crioula, Pira Ouro, Baia Periforme, Jubileu e Chata Roxa com parcelas de 3,84 m² de área útil. A produtividade de bulbos comerciais variou de 22,58 a 50,21 t/ha, destacando-se as cultivares Granex 33 (50,21 t/ha e Texas Grano 502 (44,36 t/ha que não mostraram diferença significativa entre si. Estas cultivares apresentaram incrementos na produtividade da ordem de 204,3 a 168,8% em relação à média nacional (16,5 t/ha. O mais baixo rendimento foi observado para a cultivar Chata Roxa com 22,58 t/ha. Observaram-se variações de 45,99 a 97,69 g/bulbo para peso médio de bulbo e 5,35 a 7,38 cm para o diâmetro transversal de bulbos.To identify onion cultivars of higher yield for the southern region of Minas Gerais State, Brazil, a field trial from EPAMIG was conducted in Lavras, Brazil, from March to September 1994.The experimental design was randomized complete blocks with four replications and seven treatments: Granex 33, Texas Grano 502, Crioula, Pira Ouro, Baia Periforme, Jubileu and Chata Roxa. The harvesting area of each plot was 3.84 m². The yield of commercial bulbs varied from 22.58 to 50.21 t/ha, and the highest yield was achieved by the cultivars Granex (50.21 t/ha and Texas Grano 502 (44.36 t/ha with no significant difference between them. These cultivars exceeded the national average yield (16.5 t/ha from 204.3 to 168.8%. The lowest yield was shown by the cultivar Chata Roxa (22.58 t/ha. A variation occurred from 45.99 to 97.69 g/bulb and 5.35 to 7.39 cm for the bulb diameter.

  10. PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato

    Directory of Open Access Journals (Sweden)

    Dash Aditya P

    2009-07-01

    Full Text Available Abstract Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR, an Amplification Refractory Mutation System (ARMS and Primer Introduced Restriction Analysis-PCR (PIRA-PCR were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method

  11. Esputos de papel. La historieta ‘underground’ española

    Directory of Open Access Journals (Sweden)

    Dopico, Pablo

    2011-09-01

    Full Text Available To know the origin and development of contemporary Spanish comic, we get into the suburbs of visual culture to discover the history of Spanish underground comics. A comic with which, thanks to the relative freedom of expression offered, the counterculture found a versatile vehicle that could express themselves without problems, becoming a new form of social protest and claim it offers an invaluable testimony to the Spanish reality, superior to that afforded other contemporary arts. The text examines the main features, aesthetic aspects and new language of Spanish comix, discovering the main authors (Ceesepe, Gallardo, Mariscal, Max and Nazario, series (Makoki, The Garriris, Gustavo, Anarcoma,... and magazines (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, and showing its connection with other arts, as painting, cinema and photography, not to mention its relationship to the world of drugs and rock music.

    Para conocer el origen y desarrollo de la historieta española contemporánea, debemos adentrarnos en los suburbios de la cultura visual. Así descubriremos la historia del cómic underground español. Un cómic donde, gracias a la relativa libertad de expresión que ofrecía, la contracultura encontró un vehículo versátil con el que podía expresarse sin trabas, convirtiéndose en una nueva forma de protesta y reivindicación social que ofreció un impagable testimonio de la realidad española, superior al que ofrecen otras artes coetáneas. El artículo analiza las principales características, aspectos estéticos y novedades lingüísticas del comix español, descubriendo sus principales autores (Ceesepe, Gallardo, Mariscal, Max y Nazario, series (Makoki, Los Garriris, Gustavo, Anarcoma,… y revistas (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, y mostrando su

  12. Registro Preliminar de Macrohongos (Ascomycetes y Basidiomycetes en el Bosque Húmedo Montano del Alto El Romeral (Municipio de Angelópolis, Departamento de Antioquia - Colombia Preliminar Report of Macrofungi (Ascomycetes and Basidiomycetes in the Romeral's Montain Humid Forest (Angelopolis, Antioquia - Colombia

    Directory of Open Access Journals (Sweden)

    José David Sierra Toro

    2011-12-01

    Full Text Available Los macrohongos desempeñan un papel importante en el ciclado de nutrientes, en especial en el del carbono, al participar activamente en los procesos de descomposición de la materia orgánica dentro de los bosques tropicales. El conocimiento de la diversidad de este grupo en Colombia está aún incompleto. Como contribución a este tema, se desarrolló durante cinco meses en cuatro hectáreas de un bosque húmedo montano del Departamento de Antioquia, el trabajo que reporta y describe un total de 40 especies de macrohongos (dos de ellas posiblemente nuevas para la ciencia pertenecientes a 34 géneros y 18 familias, creciendo sobre diferentes tipos de sustrato. La familia Marasmiaceae fue la más diversa con cinco especies, seguida por Boletaceae, Polyporacea y Russulaceae con cuatro especies cada una. Hypholoma, Lactarius y Marasmius fueron los géneros más importantes con tres especies cada uno. Las especies de mayor ocurrencia fueron Auricularia delicata (Fr. Henn., Xylaria polymorpha (Pers. Grev. y Ganoderma applanatum (Pers. Pat. La mayor cantidad de especies se registró creciendo sobre troncos caídos (19 especies y la menor sobre hojarasca (seis especies.Macrofungi play an important role in nutrient cycling. Especially, they are important drivers in the carbon cycling and in the organic matter decomposition process in tropical forests. In Colombia the knowledge on diversity of this group is still very poor. Through this work we intend to contribute to this knowledge. The macrofungi diversity was assessed on three different substrates on a 4 ha wet montane forest in the Antioquia province during five months. Forty species of macrofungi (two of them possible new species to science belonging to 34 genera and 18 families were recorded. Marasmiaceae was the most diverse family with five species followed by Boletaceae, Polyporacea and Russulaceae with four species each one. Hypholoma, Lactarius and Marasmius were the most important genera

  13. Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas Evaluation of cuban hemp, nut sedge, johnson grass and herb of grace extracts in weed control

    Directory of Open Access Journals (Sweden)

    Liliana Osorio Salazar

    2009-04-01

    Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.The objective of this work was to evaluate the effect of the extracts of the species Macrophylla furcraea Baker (cuban hemp, Cyperus rotundus L (nut sedge, Sorghum bicolor L (johnson grass and Ruta graveolens L (herb of grace on seed germination of two weeds and one crop. The extracts were obtained by the Soxhlet method, using water, ethanol and chloroform as solvents. Each extract was evaluated in three dilutions (0, 5 and 10 % v/v and was applied to Bidens pilosa L (spanish needle, Amaranthus dubius Mart (spleen amaranth and Coriandrum sativum L (coriander seeds. Three replications of 50 seeds each one were used and the control was watered only with destilled water. The results

  14. Genetic diversity of tropical-adapted onion germplasm assessed by RAPD markers Diversidade genética em germoplasma tropical de cebola estimada via marcadores RAPD

    Directory of Open Access Journals (Sweden)

    Maria do Desterro M dos Santos

    2012-03-01

    Full Text Available Onion is a crop of significant socioeconomic importance to Brazil. Onion germplasm with adaptation to tropical and sub-tropical conditions has played an important role in the development of this crop in the country. In this context, we studied the genetic diversity in a germplasm collection potentially useful for the development of cultivars for tropical and subtropical regions. The genetic variability of 21 accessions/cultivars that have been used as germplasm and/or were developed by onion breeding programs in Brazil was evaluated via RAPD markers. The following accessions were included in the study :'Red Creole', 'Roxa IPA-3', 'Valenciana 14', 'Beta Cristal', 'Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Alfa Tropical', 'Pêra IPA-4', 'Primavera', 'Belém IPA-9', 'Crioula Alto Vale', 'Conquista', 'Pira-Ouro', 'Vale-Ouro IPA-11', 'Franciscana IPA-10', 'Serrana', 'CNPH 6400', 'Petroline', and 'Baia Periforme'. From the 520 primers used in the initial screening only 38 displayed stable polymorphisms. They produced 624 amplicons, of which 522 (83.7% were monomorphic and 102 (16.3% were polymorphic. An average similarity coefficient of 0.72 was calculated among accessions based upon this subgroup of polymorphic amplicons. This allowed the discrimination of this germplasm collection into six groups with only one of them comprising more than one accession. The main group was formed by 16 accessions ('Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Conquista', 'Pira-Ouro', 'Serrana', 'Vale-Ouro IPA-11', 'Baia Periforme', 'Primavera', 'Franciscana IPA-10', 'Belém IPA-9', 'Crioula Alto Vale', 'Petroline', 'Pêra IPA-4' and 'Alfa Tropical', for which the genetic origin (with few exceptions can be traced back to the variety 'Baia Periforme'. The populations 'Red Creole', 'Roxa IPA-3', 'Beta Cristal', 'CNPH 6400', and 'Valenciana 14' comprised a set of five isolated groups, showing genetic divergence among them and in

  15. Identidade, riqueza e abundãncia de pequenos mamíferos (Rodentia e Didelphimorphia de área de Floresta com Araucária no estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Grazzini

    2015-01-01

    Full Text Available Roedores e Marsupiais são componentes importantes da fauna na região Neotropical. Estudos sobre a riqueza e abundância destes animais são raros na Floresta Ombrófila Mista (FOM e aqui apresentamos um inventário conduzido na Floresta Nacional de Piraí do Sul. Esta área possui uma área aproximada de 150 ha, cercada por pastos e plantações de Pinus. A amostragem foi feita através de armadilhas de queda, Sherman e Tomahawk, dispostas nos principais tipos de vegetação encontrados. Pelo menos um casal de cada espécie foi coletado. Como resultado, durante 5.892 armadilhas.noite nós obtivemos um total de 1.049 capturas, representando 17 espécies: Akodon montensis, Bibimys labiosus, Brucepattersonius iheringi, Cryptonanus sp., Didelphis albiventris, D. aurita, Gracilinanus microtarsus, Monodelphis americana, M. scalops, Myocastor coypus, Nectomys squamipes, Oligoryzomys nigripes, Oxymycterus judex, O. nasutus, Sooretamys angouya e Thaptomys nigrita. Capturas por armadilhas de queda representaram 67% do total, e oito espécies foram registradas exclusivamente por este método. Akodon montensis, O. nigripes e T. nigrita foram as espécies mais abundantes.

  16. CUIDADO FAMILIAL DE RECÉM-NASCIDOS NO DOMICÍLIO: UM ESTUDO DE CASO ETNOGRÁFICO

    Directory of Open Access Journals (Sweden)

    Julliana de Souza Leandro

    2011-01-01

    Full Text Available El presente estudio de caso etnográfico es un estudio cualitativo con el objetivo de analizar la dinámica de la atención en el hogar de las familias de los recién nacidos en la ciudad de Piraí-RJ, Brasil. Se recogieron datos de 18 familias de los recién nacidos matriculados en la Unidad de Salud Familiar. Se emplearon los siguientes instrumentos: la entrevista no estructurada, los registros de los miembros de las familias en la Estrategia de Salud Familiar y la observación participante. El análisis temático reveló tres categorías: la dimensión psicológica del cuidado familiar al recién nacido en el hogar, la dimensión biosociocultural del cuidado familiar al recién nacido; y el cuidado familiar a los recién nacidos y su interfaz con el parto y el puerperio. En este estudio las dimensiones psicológicas y biosocioculturales de la atención familiar están presentes en diferentes espacios de la atención de la salud del recién nacido. Se concluye que en el cuidado de los recién nacidos y de la familia en su totalidad es necesario repensar las culturas que se entrelazan con el cuidado familiar y el cuidado profesional

  17. wft4galaxy: a workflow testing tool for galaxy.

    Science.gov (United States)

    Piras, Marco Enrico; Pireddu, Luca; Zanetti, Gianluigi

    2017-12-01

    Workflow managers for scientific analysis provide a high-level programming platform facilitating standardization, automation, collaboration and access to sophisticated computing resources. The Galaxy workflow manager provides a prime example of this type of platform. As compositions of simpler tools, workflows effectively comprise specialized computer programs implementing often very complex analysis procedures. To date, no simple way to automatically test Galaxy workflows and ensure their correctness has appeared in the literature. With wft4galaxy we offer a tool to bring automated testing to Galaxy workflows, making it feasible to bring continuous integration to their development and ensuring that defects are detected promptly. wft4galaxy can be easily installed as a regular Python program or launched directly as a Docker container-the latter reducing installation effort to a minimum. Available at https://github.com/phnmnl/wft4galaxy under the Academic Free License v3.0. marcoenrico.piras@crs4.it. © The Author 2017. Published by Oxford University Press.

  18. Trabalho rural e fatores de risco associados ao regime de uso de agrotóxicos em Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Soares Wagner

    2003-01-01

    Full Text Available O objetivo deste artigo foi caracterizar o processo do trabalho rural em nove municípios de Minas Gerais, considerando indicadores sócio-demográficos, a estrutura agrária dos estabelecimentos rurais, práticas de trabalho relacionadas ao uso de agrotóxicos e, a intoxicação associada a seu uso. Os dados foram obtidos de uma pesquisa realizada pela Fundação Jorge Duprat Figueiredo, de Segurança e Medicina do Trabalho, que aplicou um questionário a 1.064 trabalhadores rurais, entre os anos de 1991 a 2000. Por meio de uma regressão logística, foram obtidos os fatores de risco associados à intoxicação por agrotóxicos dos grupos organofosforados e carbamatos. Cerca de 50% dos entrevistados se encontravam ao menos moderadamente intoxicados. Os fatores de risco encontrados foram: ter o último contato a menos de duas semanas com agrotóxicos; não usar proteção; ser orientado pelo vendedor; citar organofosforado ou carbamato como agrotóxico principal e trabalhar nos municípios de Teófoli Otoni, Guidoval ou Piraúba. Os resultados apontam para o alto grau de risco de agravos à saúde a que estão sujeitos trabalhadores rurais em contato com agrotóxicos.

  19. Avaliação de Métodos de Estimativa da Evapotranspiração de Referência para Fins de Manejo da Irrigação

    Directory of Open Access Journals (Sweden)

    Célia Maria Paiva

    2016-01-01

    Full Text Available O conhecimento da evapotranspiração das culturas é muito importante para o manejo da irrigação. A equação FAO56 Penman-Monteith tem sido recomendada pela FAO (Food and Agriculture Organization of the United Nations como método padrão para a estimativa da evapotranspiração de referência (ETo . Entretanto, esse método requer variáveis meteorológicas que em geral não são medidas nas estações meteorológicas no Brasil. Por isso, o objetivo deste estudo foi avaliar cinco métodos empíricos e comparar seus desempenhos com o de Penman-Monteith para as condições climáticas da região de Piraí do Sul no Estado do Paraná. Para tanto, foram utilizados dados meteorológicos registrados por uma plataforma de coleta de dados durante o período de 04/07/2008 a 12/10/2008 em uma cultura de trigo. Os resultados indicam que a ETo pode ser estimada adequadamente pelos métodos da Radiação Solar, Jensen-Haise e Makkink. O pior desempenho foi apresentado pelo método de Hargreaves-Samani, seguido do método de Camargo.

  20. First report of Angiostrongylus cantonensis (Nematoda: Metastrongylidae in Achatina fulica (Mollusca: Gastropoda from Southeast and South Brazil

    Directory of Open Access Journals (Sweden)

    Arnaldo Maldonado Júnior

    2010-11-01

    Full Text Available The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay and Santa Catarina (in municipality of Joinville. The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.

  1. First report of Angiostrongylus cantonensis (Nematoda: Metastrongylidae) in Achatina fulica (Mollusca: Gastropoda) from Southeast and South Brazil.

    Science.gov (United States)

    Maldonado, Arnaldo; Simões, Raquel O; Oliveira, Ana Paula M; Motta, Esther M; Fernandez, Mônica A; Pereira, Zilene M; Monteiro, Simone S; Torres, Eduardo J Lopes; Thiengo, Silvana Carvalho

    2010-11-01

    The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay) and Santa Catarina (in municipality of Joinville). The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.

  2. International conference centre, Geneva, Switzerland

    CERN Multimedia

    PH Department

    2009-01-01

    On 16-17 March 2009 the Energy Pact Foundation will be holding the Energy Pact Conference in Geneva. The Conference is organised with the support of the Republic and Canton of Geneva and has the Financial Times as its media partner. It will address for the first time in a comprehensive and integrated manner the key issues of energy needs and environmental and developmental challenges. Some 800 stakeholders and experts on these issues are expected. These will include high-level government officials, opinion leaders and representatives from the United Nations, NGOs, industry, civil society and the academic world. Gerhard Schröder, former Chancellor of Germany, will chair the Conference. Speakers with different backgrounds and expertise will include Dr. Carlo Rubia, Nobel Prize Winner, Ali Al-Naimi, Minister of Petroleum and Mineral Resources of Saudi Arabia, Gholam Hossein Nozari, Oil Minister of Iran, Gary Ross, CEO of PIRA Energy, a world-renowned energy market specialist, Ashok Khosla, President of the In...

  3. Reliability analysis of 2 types of auxiliary feedwater system for PWR

    International Nuclear Information System (INIS)

    Ekariansyah, Andi Sofrany

    2002-01-01

    This paper will explain the application of Fault Three Method for analyzing the system reliability of Auxiliary Feedwater System with 2 different configurations taken from PWR type nuclear power plant (NPP) in the USA. The first configuration of Braidwood NPP (design A) basically consists of 1 motor driven pump and 1 diesel driven pump. The second configuration of Haddam Neck NPP (Design B) consists of 2 turbine driven pumps. Based on the P and ID and success criteria the fault trees are constructed to estimate the system failure probabilities quantified from software code PIRAS 1.0. The result shows the second configuration (Design B) with 2 turbine driven pumps have the higher failure probability of 1,06 x 10 - 2 compared with design A of 1,09 x 10 - 3 . The modification of both systems are also tried to analyze its effect to the end result. Qualitatively, the common cause failures of 2 turbine driven pumps contribute to the highest risk of system failure probability. Combination with 1 turbine driven pump and 1 motor driven pump or 1 diesel driven pump will increase the system reliability about 80% and 50% without considering if this configuration is possible to realize in a real plant

  4. New Eocene Coleoid (Cephalopoda Diversity from Statolith Remains: Taxonomic Assignation, Fossil Record Analysis, and New Data for Calibrating Molecular Phylogenies.

    Directory of Open Access Journals (Sweden)

    Pascal Neige

    Full Text Available New coleoid cephalopods are described from statolith remains from the Middle Eocene (Middle Lutetian of the Paris Basin. Fifteen fossil statoliths are identified and assigned to the Sepiidae (Sepia boletzkyi sp. nov.,? Sepia pira sp. nov., Loliginidae (Loligo clarkei sp. nov., and Ommastrephidae (genus indet. families. The sediments containing these fossils indicate permanent aquatic settings in the infralittoral domain. These sediments range in age from 46 Mya to 43 Mya. Analysis of the fossil record of statoliths (from findings described here, together with a review of previously published data indicates marked biases in our knowledge. Fossil statoliths are known from as far back as the Early Jurassic (199.3 to 190.8 Mya but surprisingly, to the best of our knowledge, no record occurs in the Cretaceous. This is a "knowledge bias" and clearly calls for further studies. Finally, we attempt to compare findings described here with fossils previously used to constrain divergence and/or diversification ages of some coleoid subclades in molecular phylogenies. This comparison clearly indicates that the new records detailed here will challenge some estimated divergence times of coleoid cephalopod subclades.

  5. Draft genome sequence of pathogenic bacteria Vibrio parahaemolyticus strain Ba94C2, associated with acute hepatopancreatic necrosis disease isolate from South America

    Directory of Open Access Journals (Sweden)

    Leda Restrepo

    2016-09-01

    Full Text Available Vibrio parahaemolyticus is a pathogenic bacteria which has been associated to the early mortality syndrome (EMS also known as hepatopancreatic necrosis disease (AHPND causing high mortality in shrimp farms. Pathogenic strains contain two homologous genes related to insecticidal toxin genes, PirA and PirB, these toxin genes are located on a plasmid contained within the bacteria. Genomic sequences have allowed the finding of two strains with a divergent structure related to the geographic region from where they were found. The isolates from the geographic collection of Southeast Asia and Mexico show variable regions on the plasmid genome, indicating that even though they are not alike they still conserve the toxin genes. In this paper, we report for the first time, a pathogenic V. parahaemolyticus strain in shrimp from South America that showed symptoms of AHPND. The genomic analysis revealed that this strain of V. parahaemolyticus found in South America appears to be more related to the Southeast Asia as compared to the Mexican strains. This finding is of major importance for the shrimp industry, especially in regards to the urgent need for disease control strategies to avoid large EMS outbreaks and economic loss, and to determine its dispersion in South America. The whole-genome shotgun project of V. parahaemolyticus strain Ba94C2 have been deposited at DDBJ/EMBL/GenBank under the accession PRJNA335761.

  6. Westinghouse Advances in Passive Plant Safety

    International Nuclear Information System (INIS)

    Bruschi, H. J.; Manager, General; Gerstenhaber, E.

    1993-01-01

    On June 26, 1992, Westinghouse submitted the Ap600 Standard Safety Analysis Report and comprehensive PIRA results to the U. S. NRC for review as part of the Ap600 design certification program. This major milestone was met on time on a schedule set more than 3 years before submittal and is the result of the cooperative efforts of the U. S. Department of Energy (DOE), the Electric Power Requirements Program, and the Westinghouse Ap600 design team. These efforts were initiated in 1985 to develop a 600 MW advanced light water reactor plant design based on specific technical requirements established to provide the safety, simplicity, reliability, and economics necessary for the next generation of nuclear power plants. The Ap600 design achieves the ALRR safety requirements through ample design margins, simplified safety systems based on natural driving forces, and on a human-engineered man-machine interface system. Extensive Probabilistic Risk evolution, have recently shown that even if none of the active defense-in-depth safety systems are available, the passive systems alone meet safety goals. Furthermore, many tests in an extensive test program have begun or have been completed. Early tests show that passive safety perform well and meet design expectations

  7. Strategy for infrared photometry of comets with ISO

    Science.gov (United States)

    Solc, M.; Vanysek, V.; Gruen, E.

    1994-07-01

    The launch of the ISO (Infrared Satellite Observatory) by the European Space Agency is scheduled for autumn 1995. Photometry and spectrophotometry observing programs of comets in the wavelength range 2.5-200 microns for the onboard spectrophotometer ISOPHOT is now under final preparation. Technical details for preparing propasals are given. Phenomena in comets to be studied are surface properties of bare cometary nuclei at large heliocentric distances, onset of coma activity, and coma dust and gas emission (in inner solar system). Dust production, dust/gas mass ratio, dust distribution in coma, and their temporal variability are important for understanding the physical processes on nuclei, and spectrophotometry in the range of 2.5-12 microns could provide us with data of the chemical composition of cometary dust. Several active comets expected for the 18-month lifetime of ISO in 1995-1997 were selected for the ISO Central Program according to their orbital and physical parameters: P/Schwassman-Wachmann 1, P/Encke, P/d'Arrest, P/Honda-Mrkos-Pajdusakova, P/Churyumov-Gerasimenko, P/Kopff, P/IRAS, P/Wirtanen, P/Wild 2, P/Grigg-Skjellerup, P/Schwassman-Wachmann 3, P/Machholz, and (2060) Chiron. Four of them match well various constraints put on the observations by the technical arrangement of the satellite and instrument. A simple four-parameter model (size, albedo, rotation, optical thickness)was developed to estimate the temperatures and thermal fluxes of both solid nuclei and dust coma.

  8. New Eocene Coleoid (Cephalopoda) Diversity from Statolith Remains: Taxonomic Assignation, Fossil Record Analysis, and New Data for Calibrating Molecular Phylogenies.

    Science.gov (United States)

    Neige, Pascal; Lapierre, Hervé; Merle, Didier

    2016-01-01

    New coleoid cephalopods are described from statolith remains from the Middle Eocene (Middle Lutetian) of the Paris Basin. Fifteen fossil statoliths are identified and assigned to the Sepiidae (Sepia boletzkyi sp. nov.,? Sepia pira sp. nov.), Loliginidae (Loligo clarkei sp. nov.), and Ommastrephidae (genus indet.) families. The sediments containing these fossils indicate permanent aquatic settings in the infralittoral domain. These sediments range in age from 46 Mya to 43 Mya. Analysis of the fossil record of statoliths (from findings described here, together with a review of previously published data) indicates marked biases in our knowledge. Fossil statoliths are known from as far back as the Early Jurassic (199.3 to 190.8 Mya) but surprisingly, to the best of our knowledge, no record occurs in the Cretaceous. This is a "knowledge bias" and clearly calls for further studies. Finally, we attempt to compare findings described here with fossils previously used to constrain divergence and/or diversification ages of some coleoid subclades in molecular phylogenies. This comparison clearly indicates that the new records detailed here will challenge some estimated divergence times of coleoid cephalopod subclades.

  9. UTILIZAÇÃO DE RECURSOS ERGOGÊNICOS NUTRICIONAIS E/OU FARMACOLÓGICOS EM UMA ACADEMIA DA CIDADE DE BARRA DO PIRAÍ, RJ

    Directory of Open Access Journals (Sweden)

    Luana Palmeira Pereira

    2014-02-01

    Full Text Available The habit of doing workouts combined with use of nutritional ergogenic or pharmacological has grown considerably in the last years. Whether for esthetic reasons or in order to improve some performance aspects, athletes consume a large amount of these products. In this sense, the purpose of this study is: survey the consumers profile of a nutritional ergogenic resources in Barra do Piraí gyms (RJ state, enumerate the products used by users of both sexes and verify the prescription source of these products to researched participants, ascertain if the participants achieved the expected results with use of these products and if they caused any side effects. This is an observational study, which evaluated 101 athletes of both genders and social classes. It was found that the majority of participants 75% (n = 76 reported the use of nutritional ergogenic or pharmacological, with the highest prevalence among men. Two products were the most consumed: whey protein 56.57% (n = 34 and creatine 42.10% (n = 25. The majority 45% (n = 34 reported consuming ergogenic without an expert guidance. Therefore, that the study shows the importance of each time more the professional in the field of nutrition be inserted in the sports ground for possible explanations about the effects of this product type is found between sportsman.

  10. Midcourse Space Experiment Observations of Small Solar System Bodies

    Science.gov (United States)

    Kraemer, Kathleen E.; Lisse, C. M.; Price, Stephan D.; Mizuno, D.; Walker, R. G.; Farnham, T. L.; Mäkinen, T.

    2005-11-01

    Eight comets, two transition objects (extinct comet candidates), and two near-Earth asteroids were imaged in four infrared bands with the SPIRIT III instrument on the Midcourse Space Experiment, namely, C/1996 B2 (Hyakutake), C/1995 O1 (Hale-Bopp), C/1996 Q1 (Tabur), 126P/IRAS, 22P/Kopff, 46P/Wirtanen, (3200) Phaethon, (4015) 107P/Wilson-Harrington, (4179) Toutatis, (4197) 1982 TA, 125P/Spacewatch, and 55P/Tempel-Tuttle. We present maps of each object detected and a description of their characteristics. Five of the comets had extended dust tails, all of which show evidence for silicate emission in the 8.3 μm band. The comet C/Hyakutake had a strong secondary dust tail along the direction of the comet's motion, which the dynamical models showed was consistent with emission from large particles. The dust trail from P/Kopff was detected more than 2° from the coma in three of the four bands and is probably composed of large particles emitted during the 1996 apparition.

  11. La deuda pública y sus implicaciones. Un modelo The implications of public debt. a model

    Directory of Open Access Journals (Sweden)

    Salas Gustavo

    1997-06-01

    Full Text Available La crisis de la deuda pública es generalmente un reflejo de una crisis fiscal, como lo muestra el modelo que se propone este artículo en el que el endeudamiento externo ha sido suscrito por el gobierno. Al interrumpirse el financiamiento externo, los gobiernos no pudieron reducir los déficits con tanta rapidez y tuvieron que recurrir a fuentes internas. El modelo muestra que si la economía no está creciendo, la financiación con deuda constituye un factor adicional de perturbación a la estabilidad macroeconómica.The crisis of the public debt generally is the reflect of a fiscal
    crisis. As in the model, where the external debt belongs to the
    government. when the external financing stops, the governments can not reduce its deficits at the same speed so they have to look out for internal financing. The model shows that if the economy is not growing, the financing with debt constítutes and additional factor of perturbation to the macroeconomic stability

  12. Avaliação perceptiva da imagem corporal: história, reconceituação e perspectivas para o Brasil Evaluación de la percepción de la imagen del cuerpo: historia, reconceptualization y perspectivas para el Brasil Perceptive evaluation of body image: history, reconceptualization and perspectives for Brazil

    Directory of Open Access Journals (Sweden)

    Maria da Consolação Gomes Cunha Fernandes Tavares

    2010-09-01

    Full Text Available As pesquisas em Imagem corporal têm crescido em número no Brasil, porém a avaliação da dimensão perceptiva da imagem corporal é um tema pouco explorado. O objetivo deste artigo é rever criticamente a história, as características, os fatores intervenientes da avaliação perceptiva e apresentar perspectivas para o Brasil.La investigación en imagen del cuerpo ha estado creciendo en gran número en el Brasil. Sin embargo, la evaluación de la dimensión de la percepción de la imagen corporal es área poco explorada. La finalidad de este artículo es repasar críticamente la historia, las características, los factores de intervención de evaluación de la percepción y presentar perspectivas para el Brasil.The research in Body image has been growing in number in Brazil. However, the evaluation of the perceptual dimension of Body Image is little explored area. The aim of this article is to critically review the history, the characteristics, the intervening factors of perceptual evaluation and to present perspectives for Brazil.

  13. Prácticas musicales durante el proceso de urbanización en Bogotá (Colombia, 1900-1940

    Directory of Open Access Journals (Sweden)

    Julio Aldemar Gómez Castañeda

    2015-07-01

    Full Text Available Durante el proceso de urbanización que vivió Bogotá en las primeras décadas del siglo XX, además de los cambios demográficos, de infraestructura o de servicios, las formas de ritualizar alrededor de la música experimentaron una serie de transformaciones. En la medida en que la ciudad fue creciendo, y los tiempos para el entretenimiento y la recreación fueron aflorando, las prácticas musicales se ajustaron a nuevas influencias, espacios, escenarios y condiciones técnicas. Algunas de ellas se renovaron, como los conciertos públicos o las retretas de la banda. Otras como los cafés y los teatros tuvieron su apogeo, y unas más, como la radio y el disco, irrumpieron en la vida de los bogotanos. En este artículo se identifica y caracteriza cada una de estas prácticas, resaltando los personajes, grupos sociales, escenarios e imaginarios que las constituyeron. Desde una perspectiva cultural, y apoyado principalmente en la prensa de la época, se muestra cómo estas formas de habitar con la música, hablan de la transformación de una sociedad local; en este caso, de los cambios que experimentó la sociedad bogotana entre 1900 y 1940.

  14. Clínica y salud (1998-2008. Análisis de Diez Años de Publicaciones

    Directory of Open Access Journals (Sweden)

    Francisco Pérez Fernández

    2010-01-01

    Full Text Available Clínica y salud no sólo se ha convertido con el paso de los años en una publicación de referencia en el entorno de la psicología española sino que, a la vista de los datos que hemos podido recabar, y cuyo análisis se ofrece en este trabajo, es también una revista científica saludable y con un prometedor futuro. Ya parecía encontrarse en esta línea ascendente hace una década, momento en el que se realizó el primer estudio bibliométrico de la publicación que recogía la andadura de los siete primeros años de su existencia. En consecuencia, parecía pertinente comprobar ahora si aquellos primeros éxitos fueron un espejismo o el principio de la consolidación. Es precisamente al estudio y verificación de este hecho que dedicamos el presente trabajo de análisis bibliométrico esperando, asimismo, que sea útil para extraer conclusiones que permitan a Clínica y salud, a su equipo editorial y a sus afines, continuar creciendo en el futuro.

  15. Descubrimiento de conocimiento en los negocios

    Directory of Open Access Journals (Sweden)

    Johany Armando Carreño Gamboa

    2013-06-01

    Full Text Available Ante la internacionalización de la economía, las organizaciones requieren basarse en la información y el conocimiento, apoyadas en tecnologías de la información y comunicación (TIC, pensar globalmente en políticas integrales y basarse en economías en red bajo esquemas asociativos que las fortalezcan. El creciendo de empresas en los últimos años, hace prioritario tratar de obtener conocimiento útil desde los propios datos y dar un paso más allá en el apoyo a la toma de decisiones más acertada. A tal fin, se ofrece en el documento información básica acerca de la minería de datos, se reconocen sus diferentes etapas y se determina su relación con otras disciplinas. Además se da a conocer el funcionamiento del tipo de algoritmo “árboles de decisión” y, se utiliza la herramienta “Weka” para ajustar modelos a conjuntos de datos.

  16. El MERCOSUR y la Realidad Argentina 2006

    Directory of Open Access Journals (Sweden)

    Luis Felipe Agramunt

    2006-12-01

    Full Text Available Argentina está creciendo fuertemente pero no logra trasladar similar tendencia a sus relaciones comerciales con el exterior. Su competitividad internacional, medida a partir de las capacidades de sus empresas para sostener o ganar mercados internacionales, no es similar a la de otros países del MERCOSUR y por el contrario pierde ventajas a medida que pasan los años. El proceso integrador del MERCOSUR no es causa de dicho debilitamiento sino que, por el contrario y como lo demuestra el desarrollo de otros países del bloque, puede ser un factor crítico para ayudar a mejorar la creación de comercio. Sin embargo, el bloque está sufriendo tensiones que le impiden crecer y consolidarse más y mejor a lo largo de los años. Esta situación afecta al país, ya que se le restan posibilidades de aprovechar dicha ventaja como lo supo hacer en las primeras etapas por medio del efecto de “desvío de comercio”. Los esfuerzos cotidianos de los hombres de negocios para hacer posible un MERCOSUR más fuerte y con menos tensiones, a partir de acciones continuas y permanentes, deben ser acompañados por acciones políticas en igual sentido y resolución pronta y justa de las tensiones internas

  17. Estudios culturales y cine en España Cultural Studies and film in Spain

    Directory of Open Access Journals (Sweden)

    Manuel Palacio Arranz

    2007-10-01

    Full Text Available Este trabajo presenta el uso de las metodologías de los estudios culturales por los docentes e investigadores españoles. Estas metodologías de trabajo todavía resultan periféricas en los estudios de cine en España; sin embargo, está creciendo el número de publicaciones genéricamente adscritas a planteamientos culturalistas; en especial,y lo han hecho los estudios sobre el público del cine y los de género, y en menor medida los de recepción fílmica, la representación de los estereotipos y recientemente los estudios transnacionales. This paper presents the use of the different methodologies in cultural studies by Spanish researchers and academics. These working methodologies are still peripheral in film studies in Spain, although the number of publications generically adhering to cultural studies viewpoints are increasing, above all those studies concerning film audience or gender and, to a lesser extent, those dealing with film reception, stereotype representation and more recently transnational studies.

  18. La trata de personas en la modalidad de trabajo infantil

    Directory of Open Access Journals (Sweden)

    Angélica García Marbella

    2017-01-01

    Full Text Available En este trabajo se describen las causas y el proceso evolutivo del trabajo infantil en México; sin embargo, en la exposición se retoman elementos que identifican el problema en el contexto mundial. En ese sentido, se destaca que durante algún tiempo el quehacer de los infantes en el mercado de trabajo era considerado como un medio para que aprendieran determinado oficio, así como que dicha connotación no ha dejado de existir, pero ahora coexiste con otras tendencias asociadas a la delincuencia organizada, tales como prostitución, pornografía y turismo infantil; es decir, con actividades vinculadas estrechamente con la trata de personas. La pretensión es evidenciar el problema y las principales prácticas de quienes llevan a cabo dicho comportamiento; por lo que hubo necesidad de recurrir a la aplicación de una entrevista focalizada, basada en ocho informantes, con la finalidad de conocer la percepción de personas involucradas en dicha problemática. Al final del trabajo, lo observado es que la problemática en cuestión sigue creciendo en México; situación que es corroborada por los datos que aportan diversas instituciones, que señalan que en la actualidad este país ocupa el primer lugar en dicho comportamiento.

  19. Desequilibrios espaciales de población en la España de los siglos XIX y XX

    Directory of Open Access Journals (Sweden)

    JACINTO RODRÍGUEZ OSUNA

    1983-01-01

    Full Text Available La densidad de población varía mucho en España de una región a otra. Las grandes concentraciones se dan en torno a Madrid, Barcelona, Valencia y Bilbao, mientras que el interior está bastante deshabitado. Se analiza el proceso que ha llevado a esta situación desde 1857, fecha en la que se hizo el primer censo. Tras considerar varias teorías relevantes que expliquen este fenómeno, se analizan las diferencias provinciales. Se identifican cinco grupos diferenciados : muy dinámicos, dinámicos, estables, regresivos y muy regresivos. Según esa división se clasifican las provincias desde 1857 hasta 1975. Curiosamente, se observa que el mapa de 1857 se parece bastante al de 1975, con el matiz que desde 1950 la diferencia entre las distintas provincias está creciendo sostenidamente debido al tímido inicio del desarrollo económico. La distribución de la población está fuertemente correlacionada con ciertas variables económicas. Así, la densidad tiene mucho que ver con el tipo de actividad económica predominante, dependiendo del grado de industrialización de la provincia, y si su principal actividad es el turismo o la producción agrícola extensiva o intensiva.

  20. Vigilar y castigar: crisis y disciplinamiento en la Iglesia argentina en los años setenta

    Directory of Open Access Journals (Sweden)

    Obregón, Martín

    2006-06-01

    Full Text Available Since the middle of the 60’s, Catholicism experimented in Argentina a deep internal crisis: vast secular and ecclesiastic groups radicalized and their criticisms were growing in the following years. By the second middle of the 70’s the ecclesiastical hierarchy fixed on to reorganize the Church on Conservative grounds and to discipline the more radical groups inside the Catholic ground. I attempt to analyze the theological, liturgical, and pastoral characteristics of this process during the first years of the latter Military Dictatorship.

    Desde mediados de la década de 1960, el catolicismo argentino sufrió una aguda crisis interna, caracterizada por la radicalización de vastos sectores, tanto clericales como laicos, cuyos cuestionamientos fueron creciendo con el correr de los años. Desde los años setenta, la jerarquía eclesiástica estableció como objetivo central la reorganización de la Iglesia sobre bases conservadoras, lo que implicaba disciplinar a los sectores más radicalizados del campo católico. En este trabajo se analizan las características que adoptó dicho proceso en la teología, la liturgia y la pastoral durante los primeros años de la última dictadura militar.

  1. Aprender y enseñar matemáticas: desafío de la educación

    Directory of Open Access Journals (Sweden)

    Bertha Ivonne Sánchez Luján

    2017-10-01

    Full Text Available La edición de este número obedece a dos razones: por un lado posicionar a IE Revista de Investigación Educativa de la REDIECH en diversas comunidades educativas, y por otro mostrar la matemática escolar como un espacio de generación de conocimiento. Uno de los propósitos de la Red de Investigadores Educativos Chihuahua (Rediech es promover la producción y difusión de conocimientos en el campo educativo, y una de las acciones para cumplirlo es la publicación de esta revista, cuya inclusión en las bases de datos Latindex, Iresie, CLASE, SciELO, REDALyC, DOAJ, LatinREV y Dialnet representa una oportunidad de crecimiento y un reto para conservar las pautas de indexación y seguir creciendo. Para los autores implica mayor visibilidad de sus trabajos a nivel internacional, con opciones de citación, y la seguridad de publicar en una revista con altos estándares de calidad académica y editorial.

  2. ¿Necesitan los proveedores de outsourcing una metodología para la provisión de servicios?

    Directory of Open Access Journals (Sweden)

    Javier Sáenz

    2014-03-01

    Full Text Available El mercado de outsourcing ha estado creciendo en los últimos años y se espera que lo siga haciendo, pero este crecimiento se ha visto limitado por el fracaso de muchos proyectos. Estos fracasos se han debido en gran parte a los problemas con los proveedores: la falta de experiencia y capacidad para asumir los proyectos, y una comunicación difícil. Se han propuesto marcos de buenas prácticas para la gestión de proyectos de outsourcing desde el punto de vista del cliente, pero no ha sido así para los proveedores, que basan la prestación de servicios en su experiencia pasada y sus capacidades técnicas. El objetivo de este trabajo es establecer la necesidad de proponer una metodología que guíe a los proveedores a lo largo de todo el ciclo de vida del outsourcing y facilite la provisión de servicios de calidad y bien gestionados

  3. Bogotá: metrópoli de conflictos

    Directory of Open Access Journals (Sweden)

    Adriana Patricia López Velázquez

    2009-01-01

    Full Text Available En este ensayo se presentan dos aspectos de Bogotá. Por un lado, la metrópoli que está creciendo y que reporta cifras positivas en la tendencia del periodo analizado, en referencia a indicadores como el de las necesidades básicas insatisfechas (NBI, el índice de desarrollo humano (IDH, y la inversión extranjera directa. Es la Bogotá que disfruta de la exigencia y el acceso a los mercados más dinámicos y en general a la globalización. Por otro lado, la Bogotá de los que no tienen empleo, cuya capacidad de pago es bastante limitada, y viven en el sobresalto de la inseguridad. Este trabajo pretende mostrar –desde una perspectiva holística– que en el mismo espacio existen dos comunidades mutuamente complementarias y funcionales que, dentro del articulado teórico general del proyecto de investigación de Sanabria y López (2008, se conjugan para organizar los elementos comprensivos de la calidad de la vida.

  4. La escolarización en Gambia

    Directory of Open Access Journals (Sweden)

    Anna Farjas Bonet

    2002-01-01

    Full Text Available Actualmente en Gambia el número total de alumnos matriculados en escuelas de modelo británico es mucho más alto que en escuelas coránicas formales o madrasas. De todas formas, la popularidad de los centros coránicos formales va creciendo, aunque lentamente, en todo el país. Las escuelas de modelo británico aún son vistas por la población rural como un elemento extranjero. De hecho, la educación occidental ha sido vista como un elemento extranjero desde su introducción. Las escuelas, sobretodo de pueblos rurales sarahules, se encuentran en comunidades donde la religión organiza la vida social en un nivel muy alto y donde las autoridades religiosas son muy influyentes. Por consiguiente, la educación de modelo británico se encuentra con el problema de ser percibida como perjudicial o negativa y forastera a la cultura y a la religión de la gente. La competencia entre el sistema educativo de modelo británico y el coránico es evidente. Los maestros de las dos tipologías de escuela, utilizan distintas estrategias para atraer familias a sus centros.

  5. in Buenos Aires Province, Argentina

    Directory of Open Access Journals (Sweden)

    Vilma G. Rosato

    2006-01-01

    Full Text Available Los líquenes pueden afectar edificios y monumentos causando un impacto estético negativo, como también ocasionar deterioro por procesos mecánicos y químicos. Puesto que los morteros de cemento y hormigones han sido el material de construcción más utilizado en el mundo durante el siglo XX, es importante estudiar los líquenes que crecen sobre estos sustratos. En un estudio realizado en diferentes localidades de la Provincia de Buenos Aires, se hallaron 33 especies creciendo sobre morteros y hormigones, identificadas por medio de estudios morfológicos y químicos. Staurothele frustulenta es nueva para el país y Acarospora subcastanea es nueva para la Provincia. Se registró una alta proporción de líquenes foliosos (15 especies en total. Algunas de estas especies sólo se conocidas sobre cortezas de árboles, fueron encontradas colonizando materiales de cemento.

  6. Las redes de sensores inalámbricos y el internet de las cosas

    Directory of Open Access Journals (Sweden)

    Alejandro Cama

    2012-01-01

    Full Text Available El Internet de las cosas (IoT percibe un mundo donde los dispositivos que lo conforman pueden ser identificados en el Internet y está creciendo a un ritmo acelerado con nuevos dispositivos que se van conectando. En este sentido, las redes de sensores inalámbricos juegan un papel importante para incrementar la ubicuidad de las redes con dispositivos inteligentes de bajo costo y fácil implementación, con estándares como IEEE 802.15.4 en la capa física, 6LoWPAN en la capa de red, y RPL como protocolo de enrutamiento, que se integran en el concepto de IoT para traer nuevas experiencias en las actividades de la vida diaria, como por ejemplo en aplicaciones para hogares y oficinas confortables, salud, vigilancia del medio ambiente y ciudades inteligentes. En el presente artículo se relacionará a la red de sensores inalámbricos con el Internet de las cosas a través de estándares y protocolos.

  7. El escenario actual de la alimentación en México = The actual scene of the feeding in Mexico

    Directory of Open Access Journals (Sweden)

    Soria Sánchez, Graciela

    2014-01-01

    Full Text Available La soberanía alimentaria y la seguridad alimentaria en México son afectadas por múltiples factores, principalmente el mercado mundial. La población está creciendo y las tierras de cultivo están siendo utilizadas cada vez más para producir biocombustible, e n lugar de producir alimentos para consumo humano. Por otro lado, los acuerdos de libre comercio no han mejorado las condiciones de vida de los campesinos. Por el contrario, se ha generado mayor desigualdad económica y exclusión de la participación en el m ercado. Además, los programas de política pública diseñados para contrarrestar los problemas de abastecimiento de alimentos causados por el mercado, no han incluido estrategias de participación social. El presente trabajo analiza la situación actual de la alimentación en México y su precaria situación asociada principalmente al actual sistema económico neoliberal en donde la alimentación hoy en día representa únicamente un gran negocio

  8. Las Empresas Multinacionales (EMN Peruanas: una Exploración Conceptual

    Directory of Open Access Journals (Sweden)

    Oscar Malca Guaylupo

    2009-06-01

    Full Text Available Durante los últimos años (2000-2007, las exportaciones peruanas han tenido un excelente desempeño, de tal manera que el déficit constante de la balanza comercial no sólo se ha revertido, sino que además los saldos positivos vienen creciendo de manera sostenible.Sin embargo, las empresas exportadoras no son las únicas que han crecido, también las multinacionales peruanas lo han hecho. Tal es así, que algunas están actuando en diversos mercados de diferentes regiones del mundo.La EMN difiere de la empresa exportadora no solo por el hecho de actuar en destino, sino que para hacerlo debe diseñar estrategias relacionadas con la inversión directa extranjera (IDE y contar con otros atributos que le permitan competir directamente con las empresas locales en donde actúan.El presente artículo tiene por objetivo relacionar la teoría de la IDE y de las EMN con las EMN peruanas, explorar desde una base teórica el accionar de las EMN peruanas y ver en qué medida se cumplen las previsiones de las teorías disponibles sobre este punto.

  9. Redes sociales, políticas públicas y capital social

    Directory of Open Access Journals (Sweden)

    Lluís Ballester

    2014-04-01

    Full Text Available La comunidad, o en un espacio más amplio la propia sociedad, en cualquiera de sus dimensiones, no es un espacio cerrado sin conexiones e interconexiones; más bien puede concebirse como una red de relaciones. En este sentido, desde las Ciencias Sociales ha ido creciendo el interés por el estudio de las redes sociales; esto ha permitido comprender mejor como se construyen y mantienen las relaciones sociales entre la población. Junto al concepto de redes sociales aparece también el de capital social; un recurso creado por los propios individuos que representa un poder a la hora de ocupar espacios sociales, acceder a recursos, cubrir necesidades, resolver problemas sociales, etc. La existencia de redes sociales fuertes favorece los vínculos democráticos, el nexo entre los diversos agentes e instituciones del territorio, la coordinación de las acciones colectivas y, consecuentemente, la construcción de capital social.

  10. El TLCAN una forma de integración económica dualista: comercio externo e inversión extranjera directa

    Directory of Open Access Journals (Sweden)

    Cuauhtémoc Calderón Villarreal

    2011-01-01

    a través del movimiento de capitales y el comercio exterior. El TLCAN por su naturaleza "dual" favoreció en su interior la especialización de los flujos de comercio y de Inversión Extranjera Directa (IED entre los tres países; fortaleció entre México y los Estados Unidos la IED vertical, complementaria del comercio exterior que busca bajos salarios Y favoreció los flujos de IED de alta tecnología entre los Estados Unidos y Canadá con altos salarios. Además, desde la vigencia del tratado, los tres países mantuvieron tasas de crecimiento diferenciadas, siendo México el que mantuvo la tasa de crecimiento más baja. La brecha económica y tecnológica entre México y sus socios, los Estados Unidos y Canadá, fue creciendo desde la firma del TLCAN. En este trabajo se estudian los límites del TLCAN, analizando la interacción de los flujos de comercio intra-regional y la inversión extranjera directa en la región, durante el periodo de 1994 al 2008. Periodo en el cual la recesión norteamericana del 2001- 2002 constituyó un punto de infleción que modificó el comportamiento del flujo de IED en la región.

  11. ¿Cómo planear financiera y tributariamente una pyme?

    Directory of Open Access Journals (Sweden)

    Dilia Castillo

    2008-10-01

    Full Text Available Las Pyme son las unidades económicas más pequeñas, yen ellas germinan las grandes ideas empresariales. Nacen en el núcleo familiar y van creciendo a medida que el mercado demanda sus productos o servicios. En este nivel, su capital de trabajo es igual a los aportes del dueño o dueños junto con la escasa inversión en tecnología, investigación y desarrollo, y capital intelectual entre otras. En este trabajo se han recopilado algunas de las prácticas para la implementación de la cadena valor que permita el crecimientode las Pyme. La planeación financiera y tributaria se presenta dividida en tres etapas teniendo en cuenta: el tamaño, el valor del activo y el número de empleados. De igual manera, es subdividido en los siguientes subtemas de proyección: aporte social, constitución de la empresa, objetivo de creación, estructura de capital, los ingresos, los costos y gastos, los impuestos como gasto, los impuestos como beneficio fiscal, herramientas financieras para la permanente evaluación, la toma de decisiones y continuidad de la empresa, evitando así el cierre definitivo.

  12. Insuficiencia cardíaca y diabetes

    Directory of Open Access Journals (Sweden)

    Jorge Thierer

    2006-01-01

    Full Text Available La prevalencia de la insuficiencia cardíaca y la diabetes continúa creciendo. Ambas están fuertemente asociadas. La diabetes es un fuerte predictor de aparición de insuficiencia cardíaca. Las razones son la presencia de enfermedad coronaria y los trastornos metabólicos vinculados con la resistencia a la insulina que generan disfunción contráctil. Los pacientes con insuficiencia cardíaca que son diabéticos tienen peor evolución. Los Betabloqueantes, vasodilatadores y los inhibidores de la enzima convertidora ejercen una influencia favorable, en tanto que el uso de glitazonas todavía es controversial. La insuficiencia cardíaca puede a su vez generar diabetes, debido a la activación del sistema nervioso simpático y al efecto del tratamiento. La comprensión adecuada de estos hechos es fundamental para tomar decisiones correctas y mejorar la suerte de los pacientes.

  13. Home health care logistics management problems: a critical review of models and methods

    Directory of Open Access Journals (Sweden)

    Elena Valentina Gutiérrez

    2013-01-01

    Full Text Available Los servicios de Hospitalización Domiciliaria (HD se basan en una red de distribución, en la cual los pacientes son hospitalizados en sus casas y los prestadores de servicios de salud deben entregar cuidados médicos coordinados a los pacientes. La demanda de estos servicios está creciendo rápidamente y los gobiernos y proveedores de servicios de salud enfrentan el reto de tomar un conjunto de decisiones complejas en un sector con un componente logístico importante. En este artículo se presenta una revisión crítica de los modelos y métodos utilizados para darle soporte a las decisiones logísticas en HD. Para esto se presenta primero un marco de referencia, con el objetivo de identificar las oportunidades de investigación en el campo. Con base en dicho marco, se presenta la revisión de la literatura y la identificación de brechas en la investigación. En particular, se hace énfasis en la necesidad de desarrollar e implementar metodologías más integradas para dar soporte a las decisiones estratégicas y tácticas y de considerar puntos clave de los sistemas reales.

  14. Control de brazo electrónico usando señales electromiográficas

    Directory of Open Access Journals (Sweden)

    Jorge Andrés García-Pinzón

    2015-05-01

    Full Text Available Los trabajos enfocados en la extracción de patrones en señales electromiográficas (SEMG han venido creciendo debido a sus múltiples aplicaciones. En este artículo se presenta una aplicación en la cual se implementa un sistema electrónico para el registro de las SEMG de la extremidad superior en un sujeto, con el fin de controlar de forma remota un brazo electrónico. Se realizó una etapa de preprocesamiento de las señales registradas, para eliminar información poco relevante, y reconocimiento de zonas de interés; enseguida se extraen los patrones y se clasifican. Las técnicas utilizadas fueron: análisis wavelet (AW, análisis de componentes principales (ACP, transformada de fourier (TF, transformada del coseno discreta (TDC, energía, máquinas de soporte vectorial (MSV o SVM y redes neuronales (RNA. En este artículo se demuestra que la metodología planteada permite realizar un proceso de clasificación con un rendimiento superior al 95%. Se registraron más de 4000 señales.

  15. EL SISTEMA EUROPEO DE DERECHOS FUNDAMENTALES TRAS LA ENTRADA EN VIGOR DEL TRATADO DE LISBOA

    Directory of Open Access Journals (Sweden)

    Lorenzo Martín-Retortillo Baquer

    2011-07-01

    Full Text Available Resumen: En 1947 se pusieron las bases de lo que llegaría a ser la Unión Europea, a modo de organización comercial para sectores concretos, complejo que iría creciendo, ampliándose los fines y la organización, a la par que se fraguaba un complejo ordenamiento jurídico. Se hizo necesario alcanzar una declaración de derechos que incluyera los modernos derechos sociales. En el trabajo se estudia la compleja historia de la obtención de la declaración, la “Carta de Derechos Fundamentales de la Unión Europea”, que, al fin, entraría en vigor el 1.XII.2009, a la par que el último de los Tratados de la Unión, el Tratado de Lisboa.Abstract: The European Union was founded in 1947 as a concrete trade organization but it started to grown. The aims and the organization had increased and in the meantime a complex law system was set up. It was convenient to get a solid bill of rights including the modern social rights. The paper studies the complicate story of how to obtain the bill of rights –the “Carta of Fundamentals Rights of the European Union”- which formally came into effect the 1.XII.2099 at the same time that the last Treaty of the Union, the Treaty of Lison.

  16. Determinantes de la integración colombo-venezolana y perspectivas ante la dimisión de Venezuela a la CAN

    Directory of Open Access Journals (Sweden)

    Luis Nelson Beltrán Mora

    2008-01-01

    Full Text Available Este ensayo hace un balance del comercio colombovenezolano en el período 1990 - 2006, señalando que la integración aumentó los flujos de manufacturas, inversiones y puestos de trabajo para los dos países; la agenda económica se impuso a las agitadas relaciones políticas. Los logros de la integración económica están en peligro por la dimisión de Venezuela a la Comunidad Andina de Naciones – CAN en abril de 2006. A pesar de los síntomas de de intermediación privados, el comercio continúa creciendo como consecuencia de la coyuntura económica favorable para ambas naciones. La dimisión de Venezuela sólo traerá problemas en el corto plazo al comercio colombo-venezolano en la medida que el vecino país no respete el artículo 135 del Acuerdo de Cartagena; en el largo plazo el intercambio podría ser más promisorio si los dos Estados restablecen o generan nuevos acuerdos comerciales en el marco andino o bilateral.

  17. LE CORBUSIER: CÓMO CONCEBIR EL URBANISMO

    Directory of Open Access Journals (Sweden)

    Germán López Mena

    2011-11-01

    Full Text Available Descartes dijo que existe unidad entre las obras de la naturaleza y las obras del espíritu humano. Sin embargo la destrucción de paisaje, al menos en nuestro país, sigue siendo directamente proporcional a la construcción de ciudad. Y la ciudad sigue creciendo haciendo tabula rasa de lo que antes existía hasta llegar a los límites, o bien físicos, el mar la montañas, etc., o bien, establecidos jurídicamente, limites de espacios de protección. Como si ya hubiéramos definitivamente desechado la posibilidad de que en nuestras ciudades naturaleza y artificio puedan convivir. Actualmente nos encontramos en un punto aún peor para corregir esto que cuando Le Corbusier publicó en el año 1946 en París, en l´Architecture d´Aujourd´hui, su Manière de penser l`urbanisme, de la cual se ha publicado ya la sexta edición en castellano con el título de Cómo concebir el urbanismo de Ediciones Infinito, Buenos Aires.

  18. exploratorias y su relación con la edad

    Directory of Open Access Journals (Sweden)

    Iván Ricardo Perdomo

    2007-01-01

    Full Text Available La generalización del conocimiento sobre propiedades no obvias de los objetos a menudo involucra inferencia inductiva. Por ejemplo, al descubrir que un objeto particular puede producir un sonido, podríamos inferir que otros objetos de apariencia similar también lo hacen. En esta investigación, el juego exploratorio sirvió como una ventana a la capacidad inductiva temprana. A partir de los estudios realizados por Baldwin y cols. (1993, seis bebés entre los8 y los 16 meses exploraron pares de juguetes novedosos en tres condiciones de prueba: condición de expectativa satisfecha, de expectativa violada y de control de interés. Aunque en algunas ocasiones los infantes no lograron reproducir adecuadamente la propiedad no obvia de los juguetes, mostraron un interesante despliegue de comportamientos cuando exploraban los objetos. De igual forma, los resultados señalaron que el juego exploratorio es un elemento más evidente en los bebés de menor edad, pues a medida que los infantes van creciendo despliegan un menor número de comportamientos exploratorios probablemente como consecuencia de una mayor capacidad de inferencia.

  19. Juego exploratorio e inferencia temprana: un estudio descriptivo de las habilidades exploratorias y su relación con la edad

    Directory of Open Access Journals (Sweden)

    Mayra Alejandra Prieto

    2007-07-01

    Full Text Available La generalización del conocimiento sobre propiedades no obvias de los objetos a menudo involucra inferencia inductiva. Por ejemplo, al descubrir que un objeto particular puede producir un sonido, podríamos inferir que otros objetos de apariencia similar también lo hacen. En esta investigación, el juego exploratorio sirvió como una ventana a la capacidad inductiva temprana. A partir de los estudios realizados por Baldwin y cols. (1993, seis bebés entre los 8 y los 16 meses exploraron pares de juguetes novedosos en tres condiciones de prueba: condición de expectativa satisfecha, de expectativa violada y de control de interés. Aunque en algunas ocasiones los infantes no lograron reproducir adecuadamente la propiedad no obvia de los juguetes, mostraron un interesante despliegue de comportamientos cuando exploraban los objetos. De igual forma, los resultados señalaron que el juego exploratorio es un elemento más evidente en los bebés de menor edad, pues a medida que los infantes van creciendo despliegan un menor número de comportamientos exploratorios probablemente como consecuencia de una mayor capacidad de inferencia.

  20. Tipología socio-ambiental de las ciudades medias de Brasil: aportes para un desarrollo urbano sostenible

    Directory of Open Access Journals (Sweden)

    Fabio Angeoletto

    2016-05-01

    Full Text Available La urbanización global de los territorios, que es un fenómeno ecológico humano importante en curso, y cuyos impactos ambientales poseen niveles local, regional y mundial, presenta la característica notable de un crecimiento pronunciado de las ciudades pequeñas e intermedias, en las cuales la capacidad de planificación y gestión es usualmente ínfima, en comparación a las ciudades grandes. Es lo que se verifica en Brasil, donde las ciudades de tamaño medio, es decir, las que tienen poblaciones entre 100.000 y 500.000 habitantes están creciendo más rápidamente que las grandes ciudades, desde mediados de la década de 1990. El artículo tiene como objetivo trazar una tipología de las ciudades medias brasileñas por medio de análisis estadísticos multivariados. La tipología resultante señala dos tipos de ciudades, con demandas sociales, ambientales y de gestión diferentes. Algunas de estas ciudades se encuentran en hotspots de biodiversidad. En paralelo, hemos recopilado estadísticas sobre la gestión ambiental en marcha en estas ciudades. Nuestros resultados demuestran una baja efectividad de las acciones de gestión ambiental en estos municipios.

  1. INOCULACIÓN IN VITRO DE LA ROYA BLANCA (Puccinia horiana HENNINGS EN CRISANTEMO (Dendranthema grandiflora TZVELEV

    Directory of Open Access Journals (Sweden)

    C\\u00E9sar Vences-Contreras

    2008-01-01

    Full Text Available El presente estudio tuvo como finalidad el desarrollar la técnica de inoculación in vitro de la roya blanca, con el objeto de ahorrar tiempo y espacio en la caracterización de los distintos cultivares de crisantemo respecto al grado de susceptibilidad o resistencia a este patógeno. En Tenancingo, Estado de México, en el periodo 2004-2005 se colectaron hojas de crisantemo que presentaban daños por la enfermedad, se desinfectaron para posteriormente inocular las pústulas sobre plantas creciendo bajo condiciones in vitro. El recipiente de cultivo se mantuvo a una humedad relativa alrededor del 95% y temperaturas entre los 13 y 27 ºC, bajo condiciones de luz y oscuridad. Los daños por la enfermedad se manifestaron a los 20 días después de la inoculación. Los tratamientos a 17 ºC y oscuridad generaron un mayor número de pústulas (18,7. El diámetro de las pústulas fluctuó entre los 0,71 mm (tratamientos con 17 ºC y luz a los 1,79 mm en los tratamientos con 19 ºC y bajo oscuridad.

  2. Mixed methods en la investigación de la actividad física y el deporte

    Directory of Open Access Journals (Sweden)

    M. Teresa Anguera

    2014-01-01

    Full Text Available La lógica del procedimiento científico se ha desarrollado tradicionalmente desde planteamientos dicotómicos, y uno de los más influyentesfue la radical oposición entre paradigma cuantitativo vs. paradigma cualitativo. A finales del siglo XX irrumpe con fuerza la corriente de mixed methods,que ya no podemos considerar emergente, a pesar de que sigue creciendo con fuerza, porque está ya estabilizada. Su avance ha sido desigual en función de los ámbitos de conocimiento, y en el de actividad física y deporte ha sido relativamente tardía, pero últimamenteestá dando magníficos frutos. En este articulo se presenta la panorámica actual relativa a las etapas del proceso de investigación, relativa a diseños,como planificación empírica estratégica del problema de estudio, recogida de datos, que abarca un arco de diferentes posibilidades que hasta hace pocose hallaban en liza, y de análisis de datos, que nos conducte a planteamientos no esperables hace pocos años. Nos hallamos en un momento de especialpotencial de desarrollo metodológico en el marco de los mixed methods, y este articulo trata de impulsar las iniciativas en este sentido.

  3. Desempenho de cultivares de cebola em cultivo orgânico e tipos de solo no Vale do São Francisco Evaluation of onion cultivars under organic cultivation in two soil types in the São Francisco Valley, Brazil

    Directory of Open Access Journals (Sweden)

    Nivaldo D Costa

    2008-12-01

    Full Text Available Com o objetivo de avaliar a produtividade de cultivares de cebola em cultivo orgânico no Vale do São Francisco, conduziram-se dois experimentos, de maio a outubro de 2005, nos Campos Experimentais de Bebedouro, Petrolina-PE, e Mandacaru, Juazeiro-BA, em ARGISSOLO e VERTISSOLO respectivamente. O delineamento experimental utilizado foi em blocos ao acaso, utilizando-se dezoito e quatorze cultivares de cebola, respectivamente e quatro repetições. Em ARGISSOLO a produtividade total de bulbos variou de 13,52 a 39,52 t/ha. A produtividade comercial oscilou de 7,45 a 38,32 t/ha, sobressaindo-se como mais produtivas as cultivares Brisa IPA-12 (38,32 t/ha e São Paulo (35,86 t/ha que não evidenciaram diferenças significativas entre si, assim como as cultivares Botucatu-150 (26,41 t/ha e Pira Ouro (26,37 t/ha, e menos produtivas as cultivares Conquista (7,45 t/ha e Crioula Alto Vale (7,81 t/ha. Em VERTISSOLO a produtividade total de bulbos variou de 6,87 a 24,68 t/ha. Sobressairam-se com produtividade comercial as cultivares Texas Grano PRR (21,56 t/ha e IPA-10 (17,50 t/ha, que não diferiram entre si. As cultivares Crioula Alto Vale, CNPH-6348, CNPH- 6436 e CNPH-6206 não tiveram produção comercial de bulbos.In this research were evaluated the yield of onion cultivars under organic growth in the São Francisco Valley. Two field trials were evaluated, one at the Experimental Farm Station of Embrapa Tropical Semi-Arid, in Petrolina, in an ultisol type and the other at the Experimental Farm Station of Mandacaru, in Juazeiro, in a vertisol type, from February to October of 2005. The experimental design was of randomized complete blocks, with 18 and 14 cultivars, respectively, and four replications. In the ultisol, the total yield of bulbs ranged from 13.52 to 39.52 t/ha. The commercial yield ranged from 7.45 to 38.32 t/ha where the cultivars Brisa (38.32 t/ha and São Paulo (35.86 t/ha showed the highest yield without statistical difference

  4. Variabilidade genética e sensibilidade de acessos de Pistia stratiotes ao herbicida glyphosate Genetic variability and sensitivity of Pistia stratiotes accesses to glyphosate

    Directory of Open Access Journals (Sweden)

    E.A.S. Cícero

    2007-09-01

    Full Text Available A alface-d'água (Pistia stratiotes é uma das principais entre as macrófitas aquáticas que causam problemas em corpos hídricos no Brasil e são consideradas como plantas daninhas. O presente trabalho foi realizado com os objetivos de conhecer melhor a variabilidade genética dessa macrófita e relacionar essa variabilidade com a resposta à aplicação do herbicida glyphosate. Para isso, foram coletados indivíduos em 12 corpos hídricos em diferentes cidades do território nacional (Americana, Cambaratiba, Curitiba, Itapura, Jaboticabal, Lagoa Santa, Piraí, Rio Grande, Rubinéia, Salto Grande, Santa Gertrudes e Três Lagoas. Os acessos foram caracterizados pelo uso de marcadores RAPD (DNA Polimórfico Amplificado ao Acaso, que permitiram, com o auxílio de iniciadores aleatórios, a caracterização dos locos polimórficos identificados por uma matriz de ausência e presença de bandas. Utilizando essa matriz, a análise de agrupamento permitiu nítida classificação dos acessos em três grupos com diferenças genéticas entre eles. Um ensaio de controle químico, com plantas mantidas em vasos plásticos (5 L e pulverizadas com o herbicida glyphosate nas concentrações de 0,0, 0,6, 1,2, 1,8 e 2,4 kg ha-1, identificou, utilizando avaliações aos 7, 14 e 21 dias após aplicação, que as duas maiores doses promoveram melhor efeito herbicida. Foi verificado também que os acessos de Curitiba e Cambaratiba apresentaram menor suscetibilidade ao herbicida glyphosate. Não houve correspondência entre a estrutura de grupos dos acessos pela análise multivariada de agrupamento com a técnica RAPD e a suscetibilidade da alface-d'água ao glyphosate.Water lettuce (Pistia stratiotes is one the most important macrophytes, classified as weed and causing serious problems in watercourses in Brazil. The aim of this research was to evaluate the genetic variability of water lettuce and its relationship with this plant's susceptibility to glyphosate

  5. Characterization of native and oxidized starches of two varieties of Peruvian carrot (Arracacia xanthorrhiza, B. from two production areas of Paraná state, Brazil

    Directory of Open Access Journals (Sweden)

    Luciana Shizue Matsuguma

    2009-06-01

    Full Text Available Two commercial varieties of Peruvian carrot ('Amarela de Carandaí' and 'Senador Amaral' were processed into flour, starch and bagasse and chemically evaluated. The starch was extracted, modified with H2O2 and characterized by the physicochemical methods. By using the methylene blue dyeing, the granules of the modified starches showed intense blue color. The carboxyl content, the reducing power and the amount of the water liberated from the pastes after the freeze-thawing were higher for the oxidized starches and their pastes were clearer than those of the native starches of the two varieties from the two production areas. The RVA viscoamylography showed that the modified starches had lower viscosities with differences between the varieties. In the thermal analysis, the temperatures of the pyrolysis were higher for the native (310.37, 299.08, 311.18 ºC than for the modified starches (294.16, 296.65 e 293.29 ºC for both the varieties. This difference could be related with the larger surface of the granules due to the partial degradation promoted by the chemical modification. In almost all results, the differences were evident between the varieties but not for the cultivation places.No presente trabalho duas variedades comerciais de mandioquinha-salsa ('Amarela de Carandaí' e 'Senador Amaral' obtidas dos municípios de Castro e de Piraí do Sul (Paraná foram processadas para a obtenção de farinha, farelo e amido e essas três frações foram caracterizadas quimicamente. O amido foi extraído, modificado com H2O2 e caracterizado por meio de análises físico-químicas. Na coloração com azul de metileno os grânulos dos amidos oxidados apresentaram coloração azul mais intensa. O teor de carboxilas, o poder redutor e a quantidade de água liberada das pastas foram maiores para as amostras de amidos modificados. As pastas dos amidos modificados foram mais claras que as dos nativos. Na análise viscoamilográfica (RVA os amidos modificados

  6. Produção de bulbinhos de cebola em bandejas de isopor Production of onion bulb sets in styrofoam trays

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    1999-10-01

    Full Text Available Com o objetivo de estudar a viabilidade de produção de bulbinhos de cebola sob ambiente protegido em diferentes tipos de bandejas de poliestireno expandido foram instalados dois experimentos. No primeiro, trabalhando com a cultivar Serrana, foram avaliadas três tipos de bandejas com diferentes números de plantas por célula: uma planta/célula na bandeja de 288 células, três a cinco plantas/célula na de 128 e cinco a nove plantas/célula na de 72 células. No outro experimento, testaram-se nove cultivares, semeadas somente em bandejas de 128 células com três plantas por célula. Utilizou-se o delineamento em blocos ao acaso com quatro repetições no primeiro ensaio e cinco no segundo, sendo cada parcela constituída por uma bandeja. Observou-se que quanto maior a densidade de plantio menor o tamanho do bulbinho (diâmetro e peso. O manejo adequado de adubações em cobertura pode viabilizar, tecnicamente, a produção de cinco bulbinhos com 1,3 cm de diâmetro (2 g por célula, na bandeja de 128 células. Quanto ao ensaio de cultivares, ‘Crioula’ da Agroflora, ‘Crioula’ da Granja Lotário e ‘Houston’ apresentaram 83%, 67% e 81% de plantas bulbificadas, enquanto que nas demais (‘Aurora’, ‘Baia Periforme’, ‘Brownsville’, ‘Petroline’, ‘Pira Ouro’, ‘Pirana’ e ‘Serrana’ obteve-se 100% de bulbificação. As principais vantagens na produção de bulbinhos em bandeja foram: uniformidade, ausência de plantas daninhas e de patógenos. É um sistema que pode ser útil aos viveiristas que tem entressafra de mudas nos meses de agosto a novembro, período de produção dos bulbinhos. Poderá, também, ser uma alternativa na produção de bulbinhos para conserva, no controle de qualidade de lotes de sementes e em programas de melhoramento de cebola.One objective was to study the production of onion Allium cepa L.. bulb sets in a protected environment in a seedling system with trays with different number of

  7. Controle pós-emergente de plantas daninhas em cenoura Post-emergence weed control in carrot crop

    Directory of Open Access Journals (Sweden)

    Jeferson Zagonel

    1999-03-01

    Full Text Available O experimento foi conduzido em Piraí do Sul-PR no ano de 1995 em solo de textura argilo arenosa, tendo como objetivo avaliar a eficiência e a seletividade do herbicida propaquizafop no controle pós-emergente de plantas daninhas na cultura da cenoura. O delineamento experimental utilizado foi de blocos ao acaso com seis tratamentos e quatro repetições, quais sejam: propaquizafop (100, 125 e 150 g i.a./ha; fluazifop-p-butil (188 g i.a./ha; testemunha capinada e testemunha sem capina. A cultivar de cenoura utilizada foi Nantes Tim Tom semeada em 15 de junho, com espaçamento de 0,25 x 0,05 m, em parcelas com área útil de 5,00 x 1,00 m. As plantas daninhas predominantes foram Brachiaria plantaginea (capim-papuã, Digitaria horizontalis (capim-milhã e Eleusine indica (capim pé-de-galinha. As avaliações foram efetuadas aos 15, 30 e 45 dias após a aplicação dos tratamentos. Observou-se que o herbicida propaquizafop, nas doses de 100, 125 e 150 g i.a./ha foi eficiente no controle sobre capim-papuã, capim-milhã e capim pé-de-galinha. O controle de plantas daninhas realizado através de herbicidas proporcionou a mesma produção obtida com o controle manual. A perda na produção ocasionada pela presença de plantas daninhas foi da ordem de 76,4%. Não foram observados efeitos fitotóxicos nas plantas de cenoura que pudessem ser atribuídos aos produtos utilizados.The presented field trial was conducted in 1995 in Piraí do Sul, Paraná State, Brazil, on a sand-clay texture soil, to evaluate the efficiency and selectivity of propaquizafop on carrot crop weed control. The experiment was laid out in a randomized block design with six treatments and four replications, and 5.00 x 1.00 m plots. The treatmens were: propaquizafop (100, 125 and 150 g a.i/ha; fluazifop-p-butil (188 g a.i/ha; control with weeding and control without weeding. The carrot cultivar Nantes Tim Tom was sown on June 15 with plants spaced 0.25 x 0.05 m. The prevalent weeds

  8. A influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros: o caso dos Direitos Humanos na cidade Volta Redonda * La influencia de la Acción Catolica...

    Directory of Open Access Journals (Sweden)

    LUIZ FERNANDO MANGEA DA SILVA

    2014-09-01

    Full Text Available Resumo: O presente artigo faz uma análise da influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros de Novaes na Diocese de Barra do Piraí/Volta Redonda, tendo como base o contexto sociopolítico nacional e local do início da década de 1950 até 1968. Essa atuação se inicia a partir do episódio referente à violação dos direitos humanos, em que operários da Companhia Siderúrgica Nacional e intelectuais volta-redondenses foram presos após uma comemoração pelos 20 anos da Declaração Universal dos Direitos do Homem. No evento, também foram comemorados os dois anos da chegada e posse do bispo à diocese. Houve, por parte da organização do evento, a iniciativa de incluir dramatizações que simbolizavam o universo dos trabalhadores. Não podemos esquecer que Volta Redonda era uma cidade militarizada, por causa da instalação do 1º Batalhão de Infantaria Blindada em Barra Mansa, cidade vizinha. O serviço de espionagem do regime militar identificou as lideranças operárias e intelectuais, o que resultou nas prisões dos organizadores do evento. Foi nesse episódio que o bispo se declarou preso no batalhão, em protesto contra a detenção dessas lideranças.Palavras-chave: Waldyr Calheiros de Novaes – Ação Católica – Ditadura Militar e Direitos Humanos. Resumen: Este artículo analiza la influencia de la Acción Católica en el trabajo social y pastoral D. Waldyr Calheiros de Novaes en la Diócesis de Barra do Piraí/Volta Redonda, en función del contexto socio-político nacional y local de la década de 1950 hasta 1968 . Dicha acción se inicia desde el episodio relativo a la violación de los derechos humanos, en el que los trabajadores nacionales Steel Company y los intelectuales era redondenses fueron arrestados después de una celebración para el 20 aniversario de la Declaración universal de los derechos humanos. En el evento, también se celebraron dos años de la llegada e

  9. Accuracy of a self-collection kit for the microbiological study of the vaginal content

    Directory of Open Access Journals (Sweden)

    Mauro Romero L. Passos

    Full Text Available Diagnosis of vaginal discharge is frequently performed in an empirical way, leading to inadequate treatment. This study tested the accuracy of a self-collection kit for microbiological study of the vaginal content. One hundred and forty-two women of Family Health Program units in Niterói and Piraí cities were enrolled in order to have their vaginal content studied. A brief explanation and a self-collection kit were provided in order to sample the vaginal content. The self-collection kit was composed of one empty plastic tube, two glass slides, a long handle cytobrush, an identification card and guideline notes. The vaginal sample was applied on the glass slides by the women and stained by Gram technique. A second sampling was done by the medical personnel. The microbiological diagnosis in a blinded analysis was made under optical microscopy. A validation diagnosis test was done taking the medical collection results as a gold standard. A total of 106 women had followed the protocol and were included in the study. Microbiological analysis was unsatisfactory in 12 cases (6 cases of self-collection material and 6 cases of medical collection. The microbiological analyses in the self-collection and in the medical collection material were respectively: bacterial vaginosis in 21.7% and 17.9%, non bacillar flora in 10.3% and 11.3%, vaginal trichomoniasis in 5.66% and 5.6%, candidiasis in 3.78% and 2.8% and a normal microbiota in 52.8% and 56.6%. The Kappa coefficient suggested a "very good correlation" of the microbiological results between the two methods of collection (K=0.7945. The self-collection kit provides samples for microbiological analysis of the vaginal microbiota as good as medical collection.

  10. The BATENUS process for recycling mixed battery waste

    Science.gov (United States)

    Fröhlich, Siegmund; Sewing, Dirk

    The first large-scale battery recycling facility implementing the hydrometallurgical BATENUS technology is expected to go into operation by 1996. The plant will be situated in Schönebeck/Sachsen-Anhalt, and has a projected maximum capacity of 7500 tons of spent batteries per year. The engineering is being carried out by Keramchemie GmbH and the plant will be operated by Batterierecycling Schönebeck GmbH. The BATENUS process was developed by Pira GmbH, a research institute in Stühlingen, Germany, during a period of five years. This new process combines hydrometallurgical operations in a nearly closed reagent cycle that involves electrochemical and membrane techniques. Effluent emissions are minimized to the greatest possible extent. Process validity has been proven in a series of pilot plant testings. After mechanical separation of the casing materials like ferrous and nonferrous metals, paper and plastics, the subsequent hydrometallurgical recovery yields zinc, copper, nickel and cadmium. The other products are manganese carbonate and a mixture of manganese oxide with carbon black. Mercury is immobilized by absorption on a selective ion-exchange resin. The BATENUS process is a master process for the hydrometallurgical reclamation of metals from secondary raw materials. It has found its first application in the treatment of spent consumer batteries (i.e., mixtures of zinc-carbon, alkaline manganese, lithium, nickel-cadmium cells, etc.). As a result of its modular process design, the individual steps can be modified easily and adapted to accommodate variations in the contents of the secondary raw materials. Further applications of this highly flexible technology are planned for the future.

  11. West Coast U.S. : demand and prices

    International Nuclear Information System (INIS)

    Lund, P.G.

    1997-01-01

    The outlook for Canadian natural gas in Western U.S. markets through the winter of 1997 and 1998 was discussed. The effect of El Nino on West Coast gas pricing was noted, while also admitting that the best scientific minds are unable to determine what these effects actually are. Both the Cambridge Energy Research Associates (CERA) and PIRA predicted that Topock (the border pricing point) prices will track the NYMEX Henry Hub prices. The three points that were emphasized for the winter of 1997-1998 were: (1) Western U.S. pricing is higher than last year, (2) there is a surplus of gas in Canada relative to export capacity, and (3) differentials are anticipated to remain in excess of full transportation costs. The 1997 gas accord rates were also noted and its significance discussed. Increased electric load growth is likely to result in higher electricity prices which may drag gas prices along with them. Any new power generation facility is likely to be gas-fired, a fact which should also help to maintain natural gas prices. Transmission pricing is the major unknown variable. It is well known that from a capital cost perspective it is about four times more expensive to build a high -Kv transmission line than to build a gas pipeline to deliver the equivalent amount of energy. Therefore, to the degree that transmission pricing favours building new generation near load centres, gas should do well. If on the other hand, transmission pricing favours building generation plants near the fuel source, gas probably would not do nearly as well. The effects will not be known until the relevant decisions have been made. 6 figs

  12. Nuclear Safety R and D Programs and trend in the U. S. Utility Industry

    International Nuclear Information System (INIS)

    Kim, Jong Hyun

    1992-01-01

    First of all, the deterministic approach to safety analysis, which had dominated safety research in the earlier years, has given much ground to probabilistic approach. Secondly, human factors analysis has become an important part of safety research. Third, safety research relevant to reliability, or safety combined with reliability, are gradually taking place of purely safety-oriented or stand-alone safety research. More and more nuclear utilities in the U. S. are integrating safety with reliability. This evolution is in part due to the successful completion of major safety testing and analyses of deterministic nature, and partially due to the utility industry's desire to harvest synergistic nature, and partially due to the utility industry's desire to harvest synergistic results by combining safety with reliability, as the utility industry is more and more concerned about reducing operation and maintenance costs by enhancing reliability while maintaining plant safety. Nuclear safety is a complex and comprehensive concept, defying a simple categorization or interpretation. Thus, research and development in nuclear safety is necessarily diverse, and the program areas and trend presented in this paper are not meant to be all inclusive. For instance, there are some other active areas that were not mentioned, such as seismic risk assessment program and others. Nuclear safety research and development activities have undergone a perceptible shift of emphasis in recent years. They have become more focused and product-oriented. Also, except for the severe accident analysis, the emphasis on prevention and mitigation of accident, rather than analyzing the consequences of accident, is very much in evidence; that is, reliability-based technologies using PIRA methodology, and upgrading of instrumentation and control technologies are in the main stream of activities

  13. Association of kynurenine aminotransferase II gene C401T polymorphism with immune response in patients with meningitis

    Directory of Open Access Journals (Sweden)

    Leib Stephen L

    2011-04-01

    Full Text Available Abstract Background The kynurenine (KYN pathway has been shown to be altered in several diseases which compromise the central nervous system (CNS including infectious diseases such as bacterial meningitis (BM. The aim of this study was to assess single nucleotide polymorphisms (SNPs in four genes of KYN pathway in patients with meningitis and their correlation with markers of immune response in BM. Methods One hundred and one individuals were enrolled in this study to investigate SNPs in the following genes: indoleamine-2,3-dioxygenase (IDO1 gene, kynureninase (KYNU gene, kynurenine aminotransferase I (CCBL1 gene, and kynurenine aminotransferase II (AADAT gene. SNP analyses were performed by primer-introduced restriction analysis-PCR (PIRA-PCR followed by RFLP. Cytokines were measured using multiplex bead assay while immunoglobulins (IG by immunodiffusion plates and NF-kappaB and c-Jun by dot blot assay. Results The variant allele of SNP AADAT+401C/T showed prevalent frequency in patients with BM. A significant decrease (p AADAT+401C/T. Furthermore, a significant (p p KYNU+715G/A was found with low frequency in the groups, and the SNPs in IDO1+434T/G, KYNU+693G/A, CCBL1+164T/C, and AADAT+650C/T had no frequency in this population. Conclusions This study is the first report of an association of SNP AADAT+401C/T with the host immune response to BM, suggesting that this SNP may affect the host ability in recruitment of leukocytes to the infection site. This finding may contribute to identifying potential targets for pharmacological intervention as adjuvant therapy for BM.

  14. ECOLOGICAL FACTORS ASSOCIATED WITH THE ESTABLISHMENT OF RUSTIC SPECIES IN DISTURBED ECOSYSTEMS IN THE ATLANTIC FOREST, PIRAÍ, RIO DE JANEIRO STATE – BRAZIL

    Directory of Open Access Journals (Sweden)

    Hiram Feijó Baylão Junior

    2013-08-01

    Full Text Available http://dx.doi.org/10.5902/1980509810542 Disturbed ecosystems do not present original floristic composition. Their soils are depleted, shallow, stony, with low infiltration and present erosion with different levels of Geodynamics. The region has areas of pasture with sparse herbaceous vegetation which is weakened in every rain and fire, covering less ground. The individuals that colonized and settled in these environments were considered rustic species. This study raised and identified by census, the rustic species and their structure in the most degraded part (lower third of the watershed of Cacaria’s river at the base of the Serra do Mar, Piraí, Rio de Janeiro state, and evaluated the influence of ecological exposure, slope, elevation, topography and rock outcrops in the establishment and growth of these species. For the vegetation survey it was conducted census in an area of 22 hectares, where it was measured, geo-referenced and identified all spontaneous tree species that were isolated in a pasture area. Ecological factors exposure, elevation and slope were determined with a compass, altimeter and clinometer, respectively. We identified 131 individuals, representing 14 species, grouped into nine families. Tabernaemontana laeta Mart., Sparattosperma leucanthum (Vell. Schum., Machaerium hirtum (Vell. Stellfeld, Tabebuia chrysotricha (Mart. ex DC. Stan., Cecropia pachystachya Trec., Peltophorum dubium (Spreng. Taub., Guarea guidonia (L. Sleumer, Acacia polyphylla DC. and Psidium guajava L.were present in portions of the slope with exposure to the north, with altitudes from 60m to 80m and with slope strongly corrugated (20-45%, indicating a preference of these species for microhabitats with those characteristics. 

  15. VICHADA: LA HOSPITALIDAD DEL ORINOCO. Pag. 150-157

    Directory of Open Access Journals (Sweden)

    Wilmer Velandia

    2013-03-01

    Full Text Available Donde el cielo y la sabana se unen en el infinito, se vislumbra una sola montaña en la lejanía, parece un gigante, antiguo y oscuro al final de la inmensidad un “Tepuye”, después de unas cuantas horas de camino se acerca este gran anciano que data del precámbrico, pero no está solo. Se observan algunos compañeros iguales a él, se podrían considerar como los guardianes del imponente y hermoso Orinoko, considerado en lengua Sikuani como la gran serpiente enroscada acompañada de una gran riqueza paisajística cultural y biodiversa; bosques de galería, diferentes tipos de sabana, esteros, lagunas, morichales, bosques inundables, las que recorren aguas blancas, negras y mixtas, rodeadas por diferentes etnias y grupos indígenas como Piaroas, Sikuanis – Guahibos, Cuibas y Amoruas, que viven en forma pacífica con llaneros y colonos, orgullosos de estas tierras, amables y hospitalarios que desde hace muchos años comparten este paraíso con: bagres, pirañas, anguilas, rayas, arawanas, anacondas, ranas, sapos, caimanes, babos, iguanas, tortugas, loros, búhos, guacamayas, azucareros, pavones, paujiles, águilas, zamuros, aulladores, armadillos, ocarros, chigüiros, osos hormigueros, ocelotes, jaguares, nutrias, murciélagos, cuerpo espines, zorros, venados y delfines, que pasan sus días entre; cedros, moriches, saladillos, caraños, yarumos, laureles, caimos, guaduas, guamos, alcornoques, chaparros, arepillos, palmiches y gualtes.

  16. Manifestaciones muco cutáneas en anorexia nerviosa: Mucous and cutaneous manifestations of the anorexia nervosa

    Directory of Open Access Journals (Sweden)

    MB Leroux

    Full Text Available La anorexia nerviosa es una enfermedad psiquiátrica, cuya incidencia está creciendo en las últimas décadas. Afecta sobre todo a las adolescentes y mujeres jóvenes. Los signos clínicos son consecuencia de las carencias nutricionales y de los mecanismos de compensación, que el organismo implementa para conservar la vida. Las manifestaciones cutáneas y bucales son consecuencia de la desnutrición: vómitos autoprovocados, consumo de drogas o medicamentos no recetados y de la enfermedad psiquiátrica en sí misma. Se presentan diez pacientes, ocho mujeres y dos varones con signos cutáneos compatibles con anorexia nerviosa. El rango de edad es de 17 a 32 años. En orden de frecuencia se hallaron: acrocianosis, alopecia, acné, xerosis, palidez, hirsutismo, cambios en las membranas bucales y lesiones autoprovocadas. Creemos que el reconocimiento de estos signos cutáneos acompañado de un exhaustivo interrogatorio, puede colaborar en el diagnóstico de este trastorno alimentario.Anorexia nervosa is a psychiatric disease with an increasing incidence in the last decade, which affects principally adolescents and young women. Clinical signs are a consequence of malnutrition and the compensating mechanisms implemented to preserve life. Skin and oral lesions are caused by malnutrition, self-provoked vomiting, illegal drug consumption or therapeutic drugs utilization, and the psychiatric disease so far. Case reports: ten patients (eight females and two males with possible skin alterations due to anorexia nervosa, aged 17 to 32 yr. The most frequent signs, in order of priority were: acrocyanosis, alopecia, acne, xerodermia, pallor, hirsutism, oral injuries and self provoked injuries. We propose that the finding of these skin lesions plus an exhaustive questionnaire could aid to diagnose this eating disorder.

  17. Valoraciones y representaciones que guían las acciones de los cuadros de dirección y gerencia en microempresas y empresas pymes

    Directory of Open Access Journals (Sweden)

    Olga Lucía Anzola Morales

    2008-07-01

    Full Text Available Las pymes como estructura económica han venido creciendo y dominando el panorama empresarial; de forma paralela el Estado colombiano, como estrategia de crecimiento económico, renovó y fortaleció los programas de apoyo orientados a estas empresas. En consecuencia, hacia ellas se encamina la labor de algunas instituciones y centros de investigación, que pretenden aportar conocimiento tendiente a garantizar su perdurabilidad y desarrollo. Los análisis de los esquemas de competitividad de estas empresas han demostrado que los problemas centrales que las aquejan están relacionados con las valoraciones y las representaciones y de quienes las lideran. Debido a esto, el Grupo de Investigación Culturas Corporativas y Perdurabilidad Organizacional estableció un sub-proyecto de investigación tendiente al conocimiento de estos elementos. Participaron en esta investigación de tipo exploratorio y de carácter descriptivo los gerentes de 49 empresas legalmente constituidas, con antigüedad igual o mayor a 5 años y catalogadas como micro o empresas pymes. Para la recolección de la información se utilizó una entrevista semi-estructurada con 8 categorías de análisis: actividades gremiales y formas de relación con otras empresas, relaciones con el Estado, prácticas e imágenes con relación a los trabajadores y sus procesos de organización, actitudes hacia la innovación técnica y administrativa, formas de relación intraempresarial, relación con el exterior, visión prospectiva y dinámica entre empresas y consumidores. El objetivo del presente documento es presentar los hallazgos relacionados exclusivamente con la primera categoría de análisis.

  18. Monográfico Análisis del Discurso Digital · Presentación

    Directory of Open Access Journals (Sweden)

    Cristina Vela Delfa

    2016-04-01

    Full Text Available El interés por el estudio de los discursos digitales ha ido creciendo, hasta convertirse en un área de trabajo en completa ebullición. Desde distintas disciplinas, como la sociología, la semiología, la filosofía de la ciencia, la psicología, las ciencias de la información y de la comunicación, y la lingüística, han proliferado las investigaciones destinadas a entender este fenómeno comunicativo y discursivo. Los trabajos sobre estos entornos de interacción se multiplican en el ámbito internacional. De ello dan cuenta revistas como Journal of Computer-Mediated Communication, editado por S. Shyam Sundar (The Pennsylvania State University o Language@Internet!, editada por Susan C. Herring (Indiana University, Bloomington. Pensamos, no obstante, que todavía hay ciertas carencias en la investigación sobre el discurso digital en lengua española, a pesar de ser una de las más usadas en la red, entre la tercera y la cuarta posición, según datos recientes. Ello fue lo que nos movió a dedicar un número de la Revista Aposta al estudio del discurso digital en español, a fin de abordar la complejidad que entraña la trama de dispositivos, interfaces y plataformas que sirven de soporte a la comunicación digital.

  19. De las fosas comunes a los derechos humanos: El descubrimiento de las desapariciones forzadas en la España contemporánea1

    Directory of Open Access Journals (Sweden)

    Francisco FERRÁNDIZ

    2010-11-01

    Full Text Available Este texto se basa en una investigación de campo “multi–situada” de siete años sobre el impacto del ciclo más reciente de exhumaciones de fosas comunes de la Guerra Civil española, llevada a cabo en diversos escenarios: exhumaciones, actos conmemorativos, conferencias académicas sobre la memoria, presentaciones de libros, conciertos musicales, encierros universitarios, asambleas, diversas ONG, grupos de trabajo con apoyo institucional, laboratorios forenses, exposiciones de arte, manifestaciones, etc. Explora la forma en la que los discursos y conceptos transnacionales de los derechos humanos se han ido convirtiendo paulatinamente en guías fundamentales de la acción de muchas de las asociaciones que promueven la conocida como “recuperación de la memoria histórica”, a medida que el debate ha ido creciendo, se ha sofisticado, institucionalizado y, finalmente, judicializado. En este sentido, la secuencia de informes de Amnistía Internacional sobre el proceso o el auto dictado por Baltasar Garzón el 16 de septiembre de 2008, la controversia generada por él hasta su inhibición el 18 de noviembre de 2008, y los sucesos derivados del proceso que se le ha abierto en el Tribunal Supremo han actuado como catalizadores de esta irrupción de los derechos humanos en los debates sobre la memoria, a través de figuras jurídicas como las de los “crímenes contra la humanidad”, las “desapariciones forzadas”, y otras.

  20. The Woodlands: Una forma diferente de gobernar

    Directory of Open Access Journals (Sweden)

    Raquel Insa-Ciriza

    2010-06-01

    Full Text Available The Woodlands (Texas es uno de los mejores ejemplos de éxito de los partenariados público-privados entre el Departamento de Urbanismo y Vivienda Americano (Department of Housing and Urban Development, US - HUD y la empresa privada. The Woodlands, que fue creada como una «Nueva Ciudad» por la compañía Mitchell Energy & Development Corporation, ha ido creciendo y creando una masa crítica de residentes, trabajadores, su propio sentido de comunidad y lo más importante, su propia forma de gobierno. Es el único caso en Estados Unidos de ciudad gobernada por asociaciones privadas. Estas asociaciones, representadas por un Consejo de Administración, proveen la mayoría de los servicios públicos a los ciudadanos. En este artículo se muestra lo que llamo «complicidad ciudadana» basada en lo que el Nuevo Servicio Público define como gobierno basado en la comunidad. Ellos no están reinventando ninguna clase de gobierno, lo que están haciendo es crear una nueva forma de gobierno en la que los ciudadanos prefieren tomar el mando que servir. El estudio del caso que muestro nos ayuda a entender cómo una mayor participación de los ciudadanos en las tareas de la administración local puede hacer disminuir visiblemente el poder del promotor en el desarrollo de una Nueva Ciudad. Esta complicidad ciudadana se traduce en términos de implicación de los miembros de la comunidad en el crecimiento y en el Gobierno de la ciudad

  1. Presentación de caso de un Lipoma Calcificado

    Directory of Open Access Journals (Sweden)

    Pedro Rafael Casado Méndez

    2015-12-01

    Full Text Available El adipoma o lipoma es el tumor de partes blandas más frecuente en la población, pero sus complicaciones resultan ser de tal rareza que apenas el dos porciento de ellos las sufre. Se presentó el caso de un paciente masculino, de 53 años de edad, con antecedentes de una masa tumoral en la región mamilar derecha de más o menos seis años de evolución, que se mostró asintomático, pero que le preocupaba el tumor que le ha estado creciendo. Se le realizó examen físico completo y radiografía de tórax en dos vistas, resultando sugestivo de proceso tumoral de carácter neoplásico. El caso fue  remitido a la consulta de cirugía general, donde se le practicó Tomografía Axial Computarizada, no conclusiva, pero que sugirió proceso oncoproliferativo del tipo rabdomiosarcoma. El paciente fue intervenido quirúrgicamente mediante incisión losángica y se logró la exéresis total del tumor, que se envió para estudio anatomopatológico. Se envió pieza quirúrgica que, al ser seccionada a la mitad, se mostró de color blanco-nácar y consistencia dura y firme. El estudio reveló un lipoma calcificado. El pacientes fue dado de alta con reconsulta al mes, donde se le dio alta definitiva.

  2. LA CALIDAD DE LA DEMOCRACIA PARAGUAYA: UN AVANCE SOBRE CAMINOS TORTUOSOS

    Directory of Open Access Journals (Sweden)

    Mikel BARREDA

    2010-01-01

    Full Text Available En el marco de una preocupación cada vez mayor por analizar la calidad de las nuevas democracias, este artículo se ocupa de examinar el caso de Paraguay. Se trata de una democracia poco atendida en la literatura especializada aunque su interés está creciendo como consecuencia de la derrota electoral del Partido Colorado (en el poder desde 1947 en las presidenciales de abril de 2008. Para llevar a cabo este trabajo, se parte de una reflexión teórica y metodológica en torno a la noción y la medición empírica de la calidad democrática. Al realizar el análisis de la democracia paraguaya se atiende a cinco dimensiones fundamentales: derechos políticos y libertades civiles, Estado de Derecho, rendición de cuentas, responsiveness y participación. La conclusión general es que es una democracia de baja calidad, distanciada del promedio latinoamericano. Para explicar este bajo nivel de calidad democrática se presta atención a tres tipos de explicaciones, que están relacionadas: unas referentes a la estructura socioeconómica del país, otras a las características de sus instituciones políticas (sobre todo, la relevancia del clientelismo y, finalmente, otras relativas a los intereses y estrategias de los partidos políticos.

  3. La mujer y la investigación en tecnología educativa: Análisis de su presencia en la autoría de artículos científicos

    Directory of Open Access Journals (Sweden)

    Julio CABERO ALMENARA

    2011-07-01

    Full Text Available La figura de la mujer en el mundo de la tecnología ha ido creciendo poco a poco en las últimas décadas, reflejándose esta circunstancia en las publicaciones derivadas de sus trabajos tanto teóricos como investigadores. El presente artículo muestra la presencia del género femenino en la publicación de artículos realizados en la revista Píxel-Bit, Revista de Medios y Educación, a lo largo de sus 38 números de edición. Para la realización del mismo se ha empleado un sistema categorial, previamente elaborado y validado por expertos relacionados con las Tecnologías de la Información y la Comunicación y Metodología de Investigación. Con él, fueron codificados la totalidad de los artículos publicados. Realizándose a continuación un análisis descriptivo: univariante y relacional. Los principales resultados indican una constante presencia femenina en la autoría de los artículos, que abordan formatos de publicación tanto de reflexión como de investigación. Destacando el porcentaje de artículos de investigación realizados sobre la Aplicación de las TIC en la Universidad, encontrándose a continuación la formación del profesorado y la teleformación/e-learning.

  4. Características psicológicas asociadas a la incidencia de lesiones en deportistas de modalidades individuales

    Directory of Open Access Journals (Sweden)

    Rosendo Berengüí-Gil

    2013-10-01

    Full Text Available Las lesiones deportivas son una de las consecuencias más negativas que se derivan de la práctica deportiva. Son múltiples los factores que pueden estar en su origen, creciendo el interés en la búsqueda de las variables psicológicas que se encuentran asociados a su producción. En el presente estudio se evaluó a 84 deportistas de cuatro disciplinas individuales, de diferentes categorías de competición y nivel competitivo. Se registran 247 lesiones en el período de dos años, una media de 2.94 por deportista (1.47 por año, existiendo diferencias estadísticamente significativas entre las medias de lesiones de los cuatro deportes estudiados. Los deportistas de mayor edad sufren más lesiones, al igual que aquellos de mayor nivel de rendimiento. Mediante la administración del 16PF-5, IPED y SCAT, se obtiene que los deportistas con bajas puntuaciones en Estabilidad Emocional y Control de Afrontamiento Negativo, y altas en Ansiedad, presentan un mayor promedio de lesiones. Los sujetos sin lesiones se diferencian de los lesionados por mayores niveles de Estabilidad Emocional, Privacidad y Apertura al cambio, Control de Afrontamiento, y menores de Ansiedad. Existen correlaciones estadísticamente significativas entre el número de lesiones y las puntuaciones de Estabilidad Emocional, Tensión, Aprensión, Ansiedad, y ansiedad rasgo competitiva.

  5. DIVERSIDAD DE ABEJAS SIN AGUIJÓN (HYMENOPTERA:MELIPONINI UTILIZADAS EN MELIPONICULTURA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Guiomar Nates Parra

    2013-09-01

    Full Text Available En Colombia se conoce la existencia de cerca de 120 especies de abejas nativas sin aguijón, muchas de las cuales tienen importantes usos y representaciones para diversos grupos sociales y culturales. A pesar de que su cría y manejo (meliponicultura, es una actividad que viene creciendo y tecnificándose en Latinoamérica y otras regiones del mundo, sus características y desarrollo en Colombia han sido poco documentados. Se presentan los resultados de entrevistas y visitas a 75 personas en 16 departamentos de Colombia, que cultivan 25 especies de abejas sin aguijón, agrupadas en 12 géneros. Se encontraron al menos nueve especies más sin identificación completa, se reportan cuatro nuevos registros para el país y se amplía la distribución para 21 taxones. Se presenta información sobre la distribución regional y altitudinal, el cultivo urbano y las denominaciones locales para las abejas. Se revisan algunas características de los géneros cultivados más comunes (Tetragonisca, Melipona, Paratrigona, Scaptotrigona, y Nannotrigona y se discute la importancia del vínculo entre diversidad biológica y cultural que se manifiesta en los nombres locales reportados. Ante un escenario mundial de expansión de la meliponicultura, se resaltan necesidades de investigación y riesgos para la conservación y manejo de la diversidad de abejas sin aguijón y los conocimientos asociados.

  6. Importancia de las energías renovables en la seguridad energética y su relación con el crecimiento económico.

    Directory of Open Access Journals (Sweden)

    Lilian Paola Umbarila Valencia

    2015-12-01

    Full Text Available La creciente demanda de las necesidades sociales a nivel global, impulsada por los hábitos de vida y la forma en la que se organizan las regiones ha llevado al crecimiento paralelo de la industria y con ello al creciente aumento del consumo de energía. Este artículo de investigación reflexiona acerca de la relevancia que tienen las energías renovables para la seguridad energética, teniendo en cuenta la inestabilidad de los precios del petróleo y su influencia en el mercado de los hidrocarburos como fuente primaria de energía. Se evidencian los avances que han tenido las tecnologías de energías renovables a nivel global, regional y local y el rol que juegan en la independencia energética y en la mitigación del impacto ambiental. Se concluye que las naciones deben buscar la optimización de las energías renovables desde los ámbitos: local, regional y global propendiendo por su uso adecuado desde la legislación. El futuro de las energías renovables está dado por la rentabilidad, ya que para que el uso de éstas siga creciendo, deben seguir atrayendo capital lo cual significa que los inversores deben ver una rentabilidad competitiva. Otra recomendación importante es la integración de la energía renovable en la red, incluyendo fuentes de generación intermitentes e incluso imprevisibles. 

  7. UTILIZACIÓN DE IMÁGENES DIGITALES PARA MEDICIÓN DEL DIÁMETRO DE FRUTOS DE MANDARINA (Citrus reticulata EN CRECIMIENTO

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Padrón-Pereira

    2014-04-01

    Full Text Available El propósito de este trabajo fue usar imágenes digitales para medir el diámetro ecuatorial de frutos de mandarina durante el crecimiento en el árbol para construir curvas de crecimiento. El experimento se realizó en una parcela (9 m x 5 m, ubicada en Valencia (Venezuela y cultivada con árboles frutales (Acerola, limón, mandarina, palmeras creciendo naturalmente. Se seleccionaron dos frutos de la parte inferior de la copa (altura del suelo 2.5 m en crecimiento, de idéntico diámetro ecuatorial (39 mm y en la cercanía se colocó una referencia fija de medida. Se utilizó una computadora portátil, una cámara digital calibrada y un software de diseño gráfico. El ensayo se llevó a cabo durante 105 días y cada 4 a 5 días se fotografiaron los frutos. Las imágenes captadas se descargaron en la computadora y procesaron con el software CorelDRAW® X3. La medición de los frutos en las imágenes se realizó con una regla graduada virtual creada con el software y con los datos obtenidos se elaboraron curvas de crecimiento. Los dos frutos se comportaron de similar manera durante el crecimiento, con coincidencias en las mediciones los días 58 y 84 (44.25 y 50.50 mm, respectivamente, en este último día, aproximadamente se inició la fase 3, coincidiendo en ambos frutos. Los diámetros ecuatoriales alcanzados a los 105 días fueron 48.50 y 50.75 mm para el fruto 1 y 2, respectivamente. Fueron factibles las mediciones mediante el procedimiento utilizado.

  8. Especies del género Tamarix (Tamaricaceae invadiendo ambientes naturales y seminaturales en Argentina Tamarix species (Tamaricaceae invading natural and seminatural habitats in Argentina

    Directory of Open Access Journals (Sweden)

    E. S. Natale

    2008-07-01

    Full Text Available El género Tamarix incluye especies con antecedentes como invasores agresivos en ambientes naturales de Estados Unidos, México y Australia. Su presencia en Argentina es conocida desde hace mucho tiempo, cultivado como ornamental, cortina corta-vientos o para sombra o creciendo de manera espontánea. Estudios previos citan un número variable de especies del género como cultivadas en el país, este trabajo aclara confusiones relacionadas con sinonimias, confirmando la presencia de cuatro especies en el país: T. gallica, T. ramosissima, T. chinensis y T. parviflora, las tres primeras registradas colonizando ambientes naturales o seminaturales. Se describen las especies del género citadas para Argentina y se provee una clave para su identificación. Se presenta la distribución conocida hasta el momento del género y se incluyen mapas con la ubicación de poblaciones establecidas e invasoras de cada especie a nivel nacional.The genus Tamarix includes species behaving as aggressive invaders in the USA, México and Australia. Previous studies report a variable number of species of this genus cultivated in Argentina as ornamentals, wind-break or for shadow, or growing spontaneously. This work makes clear some confusion related to synonyms and confirms the presence of four species in our country: T. gallica, T. ramosissima, T. chinensis and T. parviflora, the former three recorded colonizing natural and semi-natural habitats. A description of these species is given, together with a key for their identification, and information of their geographical distribution in Argentina, including maps showing the occurrence of established and invasive populations.

  9. Bioinfo_eXtrema : un enfoque bioinformático para integrar información ambiental, bioquímica y genómica, enfocado en bioprospección y selección de consorcios de microorganismos con aplicaciones en biorremediación

    Directory of Open Access Journals (Sweden)

    Fabián Capdevielle

    2011-05-01

    Full Text Available La identificación de componentes funcionales clave para diversos bioprocesos de interés industrial ha permitido seleccionar aislamientosadaptados a condiciones ambientales extremas en tres especies de hongos del género Penicillium. Dichos aislamientos fueron evaluados in vitro para caracterizar su potencial como componentes de un consorcio microbiano aplicable en biorremediación de efluentes industriales que contienen residuos lignocelulósicos. Los resultados de la anotación de secuencias genómicas disponibles para una de las especies identificadas apuntan a la existencia de genes con alta similaridad respecto a los existentes en diversos hongos considerados como referencia en materia dedegradación de lignina en ambientes naturales. Las anotaciones funcionales propuestas a partir de secuencias accesibles –identificadasa través de la base de datos Fungal Oxidative Lignin Enzymes– podrían contrastarse con los resultados experimentales para cepas creciendo en diferentes medios con lignina, representando ambientes industriales extremos. Mediante este trabajo se propone el ensamblado de Bioinfo_eXtrema como parte de un enfoque bioinformático centrado en la selección de consorcios de extremófilos para aplicaciones en biotecnología industrial, combinando diversas técnicas de minería de datos –integradas a través del Waikato Environment for Knowledge Analysis– para facilitar la integración de información molecular disponible e indicadores funcionales relevantes para aplicaciones en biorremediación.

  10. El receptor de estrógenos alfa como mediador del efecto proliferativo de progestágenos en cáncer de mama

    Directory of Open Access Journals (Sweden)

    Sebastián Giulianelli

    2012-08-01

    Full Text Available En carcinomas mamarios murinos (C4-HD y en células de cáncer de mama humano (T47D observamos que el progestágeno sintético, acetato de medroxiprogesterona (MPA, induce la activación del receptor de estrógenos alfa (REa y su asociación nuclear con el receptor de progesterona (RP. En este trabajo postulamos que dicha interacción a nivel genómico sería fundamental para desarrollar respuestas proliferativas mediadas por progestágenos. Demostramos que el antiestrógeno fulvestrant (FUL, ICI182.780 indujo la regresión completa de tumores C4-HD creciendo con MPA. El progestágeno indujo la expresión temprana de CCND1 y MYC en células T47D y este efecto fue revertido al bloquear el REa. En células tratadas con MPA utilizamos ensayos de inmunoprecipitación de la cromatina (ChIP y corroboramos la colocalización nuclear de RP/REa en los mismos sitios de los promotores de CCND1 y MYC. El ICI no afectó la unión de RP a ambas secuencias regulatorias, pero sí inhibió la unión del REa. Confirmamos la interacción nuclear entre REa y RP en muestras de cáncer de mama humano. Los resultados demuestran que la presencia del REa, interactuando con el RP, en promotores de CCND1 y MYC es fundamental para la transcripción génica y la proliferación celular inducida por el progestágeno.

  11. La Silla RobÓTica SENA. Un Enfoque Basado en la Interacción Hombre-Máquina

    Directory of Open Access Journals (Sweden)

    J. González

    2008-04-01

    Full Text Available Resumen: El número de personas con problemas de movilidad está creciendo en los últimos años en los países desarrollados, como consecuencia de una mayor esperanza de vida y del gran número de accidentes de tráfico. La posibilidad de transferir y adaptar resultados del campo de la robótica a este colectivo resultaría de enorme interés toda vez que repercuta en una mejor calidad de vida y una mayor integración social. En este artículo presentamos la silla de ruedas robotizada SENA, que es el resultado de un proyecto de investigación desarrollado en el Dpto. de Ingeniería de Sistemas y Automática de la Universidad de Málaga (España. SENA se basa en una silla eléctrica comercial a la que se ha integrado una serie de sensores y dispositivos que son gestionados mediante un ordenador portátil. Este prototipo se caracteriza por su capacidad para la navegación autónoma en espacios interiores, así como por su facilidad para interactuar y cooperar con el usuario o personas del entorno gracias, entre otros, a una arquitectura software desarrollada específicamente para robots asistentes. En este artículo se describen los principales elementos hardware y software de SENA, se ilustra su funcionamiento y se exponen algunas de las reflexiones y conclusiones derivadas del desarrollo de este prototipo. Palabras Clave: Robots móviles, Robots asistentes, Integración Humano-Robot

  12. Análisis del sector manufacturero en las regiones españolas

    Directory of Open Access Journals (Sweden)

    Delgado Rodríguez, M. Jesús

    2007-01-01

    Full Text Available La industria manufacturera interviene de manera fundamental en la evolución económica. El modelo general de crecimiento experimentado por las economías desarrolladas ha ido acompañado, inicialmente, de determinados cambios en sus estructuras productivas: El aumento continuado de la participación de los servicios en los agregados económicos producción y empleo junto a la consolidación del incremento de la importancia de la industria en la economía; apoyados en la reducción del peso de la agricultura . En etapas posteriores la industria se ha estabilizado, mientras los servicios han continuado creciendo hasta llegar a un punto en que este crecimiento se produce a expensas de la industria. El fortalecimiento de la industria manufacturera es decisivo en todo este proceso de transformación y modernización de las estructuras productivas de las economías Por su influencia en la mejora de la competitividad de la economía y por favorecer los cambios para el progreso técnico, tiene un papel central en los procesos de crecimiento. En este trabajo se analiza trayectoria y situación de la industria manufacturera en las regiones españolas de 1995 a 2002, en relación con su grado de desarrollo económico, a través de su especialización productiva y de su eficiencia.

  13. A casual alien plant new to Mediterranean Europe: Ceiba speciosa (Malvaceae in the suburban area of Palermo (NW Sicily, Italy

    Directory of Open Access Journals (Sweden)

    Pasta, Salvatore

    2014-12-01

    Full Text Available The abiotic and biotic characteristics of the first sites where floss silk tree behaves as a casual alien plant in the Mediterranean Europe are described. The species was probably first planted in botanical gardens of southern France few decades before mid XIX century. It was introduced in Palermo in 1896, a city which appears to match very well its climatic requirements. According to the available information on its biology and ecology in both its original and secondary range, the floss silk tree should not become an invasive alien plant in the Mediterranean. Nevertheless, several gaps need to be filled in order to increase our understanding of future trends of Ceiba speciosa in southern Europe, in particular, the eventual role of pollinators and seed dispersers outside the species’ natural range.Se describen las caracteristicas abióticas y bióticas de los primeros sitios del mediterráneo europeo donde el árbol palo borracho se encuentra creciendo como especie alóctona casual. Con respecto a la historia de su introducción, esta especie fue probablemente plantada en los jardines botánicos del sur de Francia unos pocos decenios antes de la mitad del siglo XIX. En 1896, sin embargo, fue introducida en Palermo, ciudad que parece satisfacer muy bien sus requerimientos climáticos. De acuerdo con la información disponible, tanto dentro como fuera de su área de distribución natural, el palo borracho no debería convertirse en planta invasora en el mediterráneo. Sin embargo, algunos vacíos de información deben ser completados antes de establecer su potencial invasor de una manera definitiva, particularmente, el posible papel de agentes polinizadores y dispersores fuera del área de distribución natural de la especie.

  14. Energy in Latin America: Present and future

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, Johnny N; Sheffield, John W [University of Missouri-Rolla (United States)

    1997-07-01

    The primary focus of this paper is on the analysis of the current situation of energy production and consumption in the region as a whole, to examine the determinants of energy supply and demand growth, and to forecast the future growth of energy production, consumption, and balances. Since the growth of oil demand in Latin American countries themselves began to accelerate in the early 1990s, the lack of investment and development and the consequence shrinking base of Latin America's energy exports may pose serious challenges to North America, where dependence on the Middle Eastern oil and gas is growing. This paper attempts to present different scenarios and strategies to tackle the problem of Latin America's future net energy supply. [Spanish] El enfoque principal de este articulo es sobre la base de la situacion actual de la produccion y consumo de energia en la region como un todo, para examinar las determinantes del suministro de energia y el crecimiento de la demanda y la prediccion del crecimiento futuro de la produccion de energia, consumo y balances. Desde el crecimiento de la demanda del petroleo, en los paises latinoamericanos, ellos mismos empezaron a acelerar a principios de los 90s, la falta de inversion y desarrollo y la consecuencia del encogimiento de la base de las exportaciones de energia de Latinoamerica podrian imponer serios retos a Norte America, en donde la dependencia del petroleo y del gas del Medio-Oeste esta creciendo. Este articulo intenta presentar diferentes escenarios y estrategias para atacar el problema del suministro neto de energia de Latinoamerica.

  15. Reflexiones jurídicas sobre los costos ambientales Aumento de exploración de hidrocarburos no convencionales

    Directory of Open Access Journals (Sweden)

    Danielle Mendes Thame Denny

    2016-06-01

    Full Text Available El abaratamiento de la producción de energía a partir de la extracción de hidrocar- buros no convencionales, mediante el fracking, está creciendo de manera exponencial en los Estados Unidos y Canadá, con esto baja el precio de los hidrocarburos, que se vuelve más ventajoso en términos económicos y dificultando aún más la competitividad de las fuentes de energía renovables. Sus impactos son de interés comercial, pero también son de gran importancia para el medio ambiente, dado que la exploración de la forma en que se ha hecho, parece ser la causa de varios factores externos negativos, como el metano liberado durante la extracción y el posible deterioro de la calidad de los recursos hídricos, entre otros impactos ambientales. La investigación que apoya este artículo indica, hasta el momento, que el bajo precio de la energía de la fracturación hidráulica de esquisto solo se logra mediante el uso insostenible de los recursos naturales. En este sentido es oportuna la investigación legal de los costos ambientales de esa explotación, con la consideración de un posible “dumping ambiental” y, como tal susceptible de apreciación por el Sistema de Solución de Diferencias de la Organización Mundial del Comercio

  16. Microprocesadores AMD: pasado, presente y futuro

    Directory of Open Access Journals (Sweden)

    Reynaldo Hernández Perdomo

    2005-01-01

    Full Text Available La evolución de la humanidad y en particular de la electrónica de los últimos años ha estado basada en los constantes avances en la fabricación de chips. Los circuitos integrados se han ido incorporando a todo los que nos rodea hasta el punto de que la vida sin ellos parece imposible. El microprocesador es uno de los logros más sobresalientes del siglo XX. Esas son palabras atrevidas, y hace un cuarto de siglo tal afirmación habría parecido absurda. Pero cada año, el microprocesador se acerca más al centro de nuestras vidas, forjándose un sitio en el núcleo de una máquina tras otra. Su presencia ha comenzado a cambiar la forma en que percibimos el mundo e incluso a nosotros mismos. Cada vez se hace más difícil pasar por alto el microprocesador como otro simple producto en una larga línea de innovaciones tecnológicas. No obstante que reconocemos la penetración del microprocesador en nuestras vidas, ya estamos creciendo indiferentes a la presencia de esos miles de máquinas diminutas que nos encontramos sin saberlo todos los días. Así que, antes de que se integre de manera demasiado imperceptible en nuestra diaria existencia, es el momento de celebrar al microprocesador y la revolución que ha originado, para apreciar el milagro que es en realidad cada uno de esos chips de silicio diminutos y meditar acerca de su significado para nuestras vidas y las de nuestros descendientes.

  17. La producción de leche orgánica en la región Puno: una alternativa de desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Saúl Olarte Calsina

    2013-06-01

    Full Text Available El consumo de productos orgánicos viene creciendo en todo el mundo y la leche orgánica no es la excepción. En Puno, por sus características geográficas, culturales e históricas, la producción agropecuaria aún mantiene tecnologías de producción ancestrales, buscando el equilibrio con el medio ambiente, con un uso mínimo de fertilizantes y pesticidas, con lo que se muestra un enfoque en la sostenibilidad y una tendencia a producir orgánicamente. El objetivo de este trabajo fue determinar mediante una simulación la viabilidad económica y el riesgo de producir leche orgánica como una alternativa de desarrollo sostenible. Se consideró la producción por encima de los 3.000 metros de altura, área de 6,5 has, una vaca (criolla por hectárea produciendo 10 litros de leche/día. Los indicadores económicos resultaron positivos: el VAN fue S/. 2.916,38, TIR 24%, VAE S/. 866,33, ratio B/C S/. 1,48 (se aclaro en la metodología y el período de recuperación de la inversión resultó de 5,88 años, evidenciando que la producción de leche orgánica es económicamente viable pero con riesgo elevado: la simulación de Monte Carlo mostró que existe 71,43% de probabilidad de no resultar viable.

  18. Estrategias de salud electrónica en la región de Las Américas: Situación actual y perspectivas

    Directory of Open Access Journals (Sweden)

    Marcelo D’ Agostino

    Full Text Available El objetivo principal de la Estrategia y Plan de Acción Sobre eSalud (2012-2017 es contribuir al desarrollo sostenible de los sistemas de salud de los estados miembros. Con su adopción se busca mejorar el acceso a los servicios de salud y su calidad a través de la utilización de las tecnologías de la información y de las comunicaciones (TIC, la implementación de programas de alfabetización digital y el acceso a información de calidad que permita avanzar hacia sociedades más informadas, equitativas, competitivas y democráticas. La OPS/OMS considera que sociedades con acceso libre y equitativo a la información sobre salud debe ser un derecho fundamental de las personas. El acceso a información, intercambio de conocimientos y uso de las tecnologías de la información y la comunicación en el sector de la salud sigue creciendo y está impulsando cambios significativos en la manera en que la población interactúa con los servicios de salud y entre sí misma en las redes sociales y mediante el uso de dispositivos móviles (mSalud. Esta sociedad hiperconectada, o sociedad de la información, nos trae nuevos desafíos y oportunidades relacionadas con el uso de datos masivos (Big data que nos obliga a repensar nuestra relaciones con la realidad y la forma tradicional de manejo de información en salud

  19. Energy in Latin America: Present and future

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, Johnny N; Sheffield, John W [University of Missouri-Rolla (United States)

    1997-07-01

    The primary focus of this paper is on the analysis of the current situation of energy production and consumption in the region as a whole, to examine the determinants of energy supply and demand growth, and to forecast the future growth of energy production, consumption, and balances. Since the growth of oil demand in Latin American countries themselves began to accelerate in the early 1990s, the lack of investment and development and the consequence shrinking base of Latin America's energy exports may pose serious challenges to North America, where dependence on the Middle Eastern oil and gas is growing. This paper attempts to present different scenarios and strategies to tackle the problem of Latin America's future net energy supply. [Spanish] El enfoque principal de este articulo es sobre la base de la situacion actual de la produccion y consumo de energia en la region como un todo, para examinar las determinantes del suministro de energia y el crecimiento de la demanda y la prediccion del crecimiento futuro de la produccion de energia, consumo y balances. Desde el crecimiento de la demanda del petroleo, en los paises latinoamericanos, ellos mismos empezaron a acelerar a principios de los 90s, la falta de inversion y desarrollo y la consecuencia del encogimiento de la base de las exportaciones de energia de Latinoamerica podrian imponer serios retos a Norte America, en donde la dependencia del petroleo y del gas del Medio-Oeste esta creciendo. Este articulo intenta presentar diferentes escenarios y estrategias para atacar el problema del suministro neto de energia de Latinoamerica.

  20. Nurse effect in seedling establishment: facilitation and tolerance to damage in the Andes of central Chile Efecto nodriza en el establecimiento de plántulas: facilitación y tolerancia al daño en los Andes de Chile central

    Directory of Open Access Journals (Sweden)

    IAN S ACUÑA-RODRÍGUEZ

    2006-09-01

    ás relevante en ambientes estresantes. Este efecto sería particularmente importante durante el periodo de establecimiento de las plántulas debido a su alta vulnerabilidad a factores bióticos y abióticos como herbivoría y desecación. La tolerancia a la herbivoría evidencia la capacidad de las plantas de recrecer y reproducirse después del daño, pero esta capacidad es recurso-dependiente. En los Andes de Chile central, la planta en cojín Laretia acaulis (Apiaceae atenúa el efecto del estrés ambiental, aumentando la supervivencia de diversas especies de plantas asociadas. Proponemos que las plántulas que se encuentren creciendo dentro de los cojines de L. acaulis deberían evidenciar niveles mayores de tolerancia en relación a aquellas plántulas creciendo fuera de los cojines. Para probar esta hipótesis se llevó a cabo un experimento de campo con dos especies nativas perennes: Hordeum comosum (Poaceae y Haplopappus anthylloides (Asteraceae. Plántulas de ambas especies fueron sembradas dentro y fuera de los cojines de L. acaulis, y la mitad de ellas recibieron daño manual (50 % tejido foliar removido. En general, las plántulas que se encontraron creciendo dentro del cojín evidenciaron una mayor supervivencia independientemente del tratamiento de daño. A pesar de que la ubicación de las plántulas no afectó la respuesta en tolerancia por parte de H. anthylloides, sí afectó significativamente la tolerancia de H. comosum. Por lo tanto, encontramos valores similares para la supervivencia de plántulas de H. comosum dentro de los cojines, pero la supervivencia de plántulas dañadas fuera de los cojines fue significativamente menor que la de plántulas control. Se pudo evidenciar la ocurrencia de efecto nodriza por parte de L. acaulis sobre el establecimiento de ambas especies y conjuntamente un aumento en la tolerancia al daño para H. comosum en este hábitat estresante

  1. Selected Abstracts of the 11th International Workshop on Neonatology; Cagliari (Italy; October 26-31, 2015

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2015-10-01

    . Piras, A. Ravarino, R. Ambu • Cagliari and Pisa (Italy ABS 18. Pulmonary atresia: the importance of prenatal diagnosis • A.L. Costa, H. Soares, A.L. Neves, C. Moura, J.C. Areias, A.C. Fragoso, J. Estevão-Costa, H. Guimarães • Porto (Portugal ABS 19. The use of hypothermia in preterm asphyxiated neonate: new results from a metabolomics point of view • E. d’Aloja, A. Noto, E. Locci, C. Dalmazzo, G. Pomero, A. Dessì, V. Fanos, P. Gancia • Cagliari and Cuneo (Italy ABS 20. Alopecia areata in a child: case report, management and therapy • F. Farnetani, V.D. Mandel, G. Pellacani • Modena (Italy ABS 21. Physiological and therapeutic roles of mesenchymal stem cells. Is there a gap? • U. Galderisi, F. Pentimalli, A. Giordano • Philadelphia (PA, USA, Naples and Siena (Italy, Kayseri (Turkey ABS 22. Esophageal impedance baseline is correlated with exposure to reflux in newborns with GERD symptoms • F. Cresi, E. Locatelli, E. Maggiora, A. Pirra, C. Peila, E. Bertino • Turin (Italy ABS 23. Analytical pitfalls and future perspectives in the measurement of bone metabolism biomarkers • A. Fortunato • Vicenza (Italy ABS 24. Genetic analysis of surfactant proteins genes in premature newborn infants with severe respiratory distress syndrome • M. Somaschini, S. Presi, M. Ferrari P. Carrera • Milan (Italy ABS 25. Child abuse and neglect: an increasing childhood’s condition • S. Cherubini • Busto Arsizio (Italy ABS 26. When a newborn dies: European approaches to responsibility • F. Tregnaghi, R. Carter, J. Ferguson, K. Nijs • Verona (Italy, Devon (UK, and Leuven (Belgium ABS 27. NMR-based screening possibilities in the neonate and comparison to mass spectral methods • M. Spraul, C. Cannet, H. Schäfer • Rheinstetten (Germany ABS 28. Our team project: learning from mistakes • M. Susi, E.M. Padovani, A. Bertolini, M. Lavarini, S. Tardivo • Verona (Italy ABS 29. Peripheral intravenous catheters in neonates • M. Zicchi, A. Farbo • Sassari

  2. Diverse Early Life-History Strategies in Migratory Amazonian Catfish: Implications for Conservation and Management.

    Directory of Open Access Journals (Sweden)

    Jens C Hegg

    Full Text Available Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii, Piramutaba (Brachyplatystoma vaillantii, and Piraíba (Brachyplatystoma filamentosum. We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87Sr/(86Sr recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87Sr/(86Sr isotope values using a regression-based approach that related

  3. Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010

    International Nuclear Information System (INIS)

    Scheinost, Andreas C.; Baehtz, Carsten

    2011-01-01

    be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.

  4. Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010

    Energy Technology Data Exchange (ETDEWEB)

    Scheinost, Andreas C; Baehtz, Carsten [eds.

    2011-07-01

    be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.

  5. Dot-ELISA-IgM in saliva for the diagnosis of human leptospirosis using polyester fabric-resin as support (Preliminary Report Dot-ELISA-IgM em saliva para diagnóstico da leptospirose humana, empregando como suporte tecido de poliéster-resina (Nota Prévia

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius da Silva

    1994-10-01

    Full Text Available In order to improve the diagnosis of human leptospirosis, we standardized the dot-ELISA for the search of specific IgM antibodies in saliva. Saliva and serum samples were collected simultaneously from 20 patients with the icterohemorrhagic form of the disease, from 10 patients with other pathologies and from 5 negative controls. Leptospires of serovars icterohaemorrhagiae, canicola, hebdomadis, brasiliensis and cynopteri grown in EMJH medium and mixed together in equal volumes, were used as antigen at individual protein concentration of 0.2 µg/µl. In the solid phase of the test we used polyester fabric impregnated with N-methylolacrylamide resin. The antigen volume for each test was 1µl, the saliva volume was 8 µl, and the volume of peroxidase-labelled anti-human IgM conjugate was 30 µl. A visual reading was taken after development in freshly prepared chromogen solution. In contrast to the classic nitrocellulose membrane support, the fabric support is easy to obtain and to handle. Saliva can be collected directly onto the support, a fact that facilitates the method and reduces the expenses and risks related to blood processing.Com a finalidade de melhorar o diagnóstico da leptospirose humana, padronizou-se o teste dot-ELISA para a pesquisa de anticorpos específicos da classe IgM na saliva. Empregaram-se amostras de saliva e soro coletadas simultaneamente de 20 pacientes com a forma ictero-hemorrágica da doença, de 10 pacientes com outras patologias e 5 controles negativos. Culturas de Leptos-pira em meio EMJH, dos sorovares: icterohaemorrhagiae, canicola, hebdomadis, brasiliensis e cynopteri, foram utilizadas como antígeno, na concentração proteica individual de 0,2 µg/µl, misturadas em volumes iguais. Na fase sólida do teste empregou-se tecido de po-liéster impregnado com resina de N-metilol-acrilamida. O volume do antígeno para cada teste foi de 1µl, o de saliva 8µl, o de conjugado anti-IgM humana marcada com peroxidase, de

  6. CC genotype of anti-apoptotic gene BCL-2 (-938 C/A) is an independent prognostic marker of unfavorable clinical outcome in patients with non-small-cell lung cancer.

    Science.gov (United States)

    Javid, J; Mir, R; Mirza, M; Imtiyaz, A; Prasant, Y; Mariyam, Z; Julka, P K; Mohan, A; Lone, M; Ray, P C; Saxena, A

    2015-04-01

    B cell lymphoma 2 (BCL-2) gene is a well-known regulator of apoptosis and a key element in cancer development and progression. A regulatory (-938C>A, rs2279115) single-nucleotide polymorphism in the inhibitory P2 BCL-2 gene promoter generates significantly different BCL-2 promoter activities and has been associated with different clinical outcomes in various malignancies. The aim of the present study was to analyze the possible influence of the (-938C>A) SNP on the risk and survival of Indian patients suffering from NSCLC. A hospital-based case-control study of 155 age- and sex-matched patients diagnosed with NSCLC and 155 cancer-free controls was conducted and genotyped by performing PIRA-PCR to elucidate the putative association between clinical outcome and genotypes of BCL-2 (-938C>A, rs2279115). The association of the polymorphism with the survival of NSCLC patients was analyzed by Kaplan-Meier curves. In Indian NSCLC, patients increased risk of developing NSCLC was found to be associated with BCL-2 (-938) CC genotype, [OR 3.68 (1.92-6.79), RR 1.87 (1.35-2.57) and RD 31.03 (16.79-45.27) p 0.00006 for CC and OR 2.08 (1.18-3.66), RR 1.36 (1.08-1.71) and RD 17.74 (4.68-30.81) p 0.01 for AC genotype]. Patients homozygous for C allele exhibited a significant poor overall survival compared with patients displaying AC + CC or AC or AA genotype [median survival (months) 8 vs. 11 vs. 14 vs. 35.5 (p A) polymorphism. Genetic polymorphism in the inhibitory P2 promoter region of anti-apoptotic BCL-2 genes contributes to the risk of developing non-small-cell lung cancer in Indian population. BCL-2 (-938CC) genotype was an independent adverse prognostic factor for patients with NSCLC.

  7. Detection of sdhB Gene Mutations in SDHI-Resistant Isolates of Botrytis cinerea Using High Resolution Melting (HRM) Analysis.

    Science.gov (United States)

    Samaras, Anastasios; Madesis, Panagiotis; Karaoglanidis, George S

    2016-01-01

    Botrytis cinerea , is a high risk pathogen for fungicide resistance development. Pathogen' resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM) analysis for the identification of P225H/F/L//T, N230I, and H272L/R/Y mutations. Based on the sequence of sdh B subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant's DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the four mutations located at codon 225, the N230I mutation, the three mutations located in codon 272, and the non-mutated isolates (isolates of wild-type sensitivity). Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdh B mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping-off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I, and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate, and rapid identification of several sdh B mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of anti-resistance strategies implemented in

  8. Diverse Early Life-History Strategies in Migratory Amazonian Catfish: Implications for Conservation and Management.

    Science.gov (United States)

    Hegg, Jens C; Giarrizzo, Tommaso; Kennedy, Brian P

    2015-01-01

    Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii), Piramutaba (Brachyplatystoma vaillantii), and Piraíba (Brachyplatystoma filamentosum). We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87)Sr/(86)Sr) recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87)Sr/(86)Sr isotope values using a regression-based approach that related the geology

  9. Sinopsis del mundo Piro: Ética y estética en el arte Piro. Modificaciones en las estructuras de parentesco Piro durante el auge del caucho (1885-1915. Los asentamientos Piros y la persistencia de su identidad

    Directory of Open Access Journals (Sweden)

    Luis Román Villanueva

    1985-12-01

    Full Text Available Los tres artículos que a continuación presentamos tienen como objeto detallar tres aspectos fundamentales de la cultura Piro. Este grupo etno-linguistico, pertenece a la familia Arahuaca, al igual que los Campa, Machiguenga y Amuesha, se ubica principalmente en las riberas del río Urubamba perteneciente al distrito de Echarate, Provincia de la Convención, Departamento del Cusco y el Distrito de Sepahua, Provincia de Atalaya, Departamento de Ucayali. La población estimada para este grupo es de 1600 habitantes (Wise, M.R. 1972 que se distribuye en 12 comunidades nativas, de las cuales la mitad están tituladas por el Estado peruano. Sobre este grupo existe regular bibliografía principalmente en lo referido a lingüística, relatos de viajeros y misioneros de diversas órdenes y en menor escala trabajos etnográficos y etno-históricos. En esta serie de artículos los autores pretenden una aproximación en detalle para profundizar el conocimiento que de esta etnia se tiene. Para ello utilizaremos los trabajos anteriores a los cuales sumaremos nuestras notas y apreciaciones recogidas durante cuatro años de trabajo en la zona. El primer artículo de L. Komán pretende explicar la relación entre lo ideológico y lo estético para lo cual se remite a la mitología y las manifestaciones estéticas del grupo piro. En el segundo artículo el mismo autor señala una transformación estructural en el sistema de parentesco piro durante el auge de la explotación del caucho, dando lugar a una variación del modelo original, que garantiza la reproducción biológica y cultural del grupo. El artículo final de V. de Szyzslo describe la forma cómo cada una de las familias de la comunidad pira de Miaría, en el Urubamba, dispone del espacio para la construcción de sus viviendas y locales comunales. Los tres artículos, por lo tanto son complementarios para obtener una visión en detalle de los aspectos ideológicos, socio-políticos y tecnológicos q u

  10. Prospective study on prevalence, intensity, type, and therapy of acute pain in a second-level urban emergency department

    Directory of Open Access Journals (Sweden)

    Mura P

    2017-12-01

    Full Text Available Paolo Mura,1 Elisabetta Serra,1 Franco Marinangeli,2 Sebastiano Patti,3 Mario Musu,1 Ilenia Piras,3 Maria Valeria Massidda,1 Giorgio Pia,3 Maurizio Evangelista,4 Gabriele Finco1 1Department of Medical Sciences “M. Aresu”, University of Cagliari, Cagliari, Italy; 2Department of Anesthesiology, Intensive Care and Pain Medicine, University of L’Aquila, L’Aquila, Italy; 3Department of Emergency Medicine, Santissima Trinità Hospital, Cagliari, Italy; 4Department of Anesthesiology and Pain Medicine, Cattolica University, Rome, Italy Aim: Pain represents the most frequent cause for patient admission to emergency departments (EDs. Oligoanalgesia is a common problem in this field. The aims of this study were to assess prevalence and intensity of pain in patients who visited a second-level urban ED and to evaluate the efficacy of pharmacological treatment administered subsequent to variations in pain intensity. Methods: A 4-week prospective observational study was carried out on 2,838 patients who visited a second-level urban ED. Pain intensity was evaluated using the Numeric Rating Scale at the moment of triage. The efficacy of prescribed analgesic therapy was evaluated at 30 and 60 minutes, and at discharge. Data concerning pain intensity were classified as absent, slight, mild, or severe. Pain was evaluated in relation to the prescribed therapy. Results: Pain prevalence was 70.7%. Traumatic events were the primary cause in most cases (40.44%, followed by pain linked to urologic problems (13.52%, abdominal pain (13.39%, and nontraumatic musculoskeletal pain (7.10%. Only 32.46% of patients were given pharmacological therapy. Of these, 76% reported severe pain, 19% moderate, and 5% slight, and 66% received nonsteroidal anti-inflammatory drugs or paracetamol, 4% opioids, and 30% other therapies. A difference of at least 2 points on the Numerical Rating Scale was observed in 84% of patients on reevaluation following initial analgesic therapy

  11. Detection of sdhB gene mutations in SDHI-resistant isolates of Botrytis cinerea using high resolution melting (HRM analysis

    Directory of Open Access Journals (Sweden)

    Anastasios Samaras

    2016-11-01

    Full Text Available Botrytis cinerea, is a high-risk pathogen for fungicide resistance development. Pathogen` resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM analysis for the identification of P225H/F/L//T, N230I and H272L/R/Y mutations. Based on the sequence of sdhB subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant`s DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the 4 mutations located at codon 225, the N230I mutation, the 3 mutations located in codon 272 and the non mutated isolates (isolates of wild type sensitivity. Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdhB mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate and rapid identification of several sdhB mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of antiresistance strategies implemented in

  12. Consumo ilimitado, eficiencia y desigualdad urbana. Definición socioecológica del consumo urbano desde las perspectivas del marxismo y el metabolismo

    Directory of Open Access Journals (Sweden)

    Rubén Miguel Águeda

    2015-12-01

    Full Text Available Resumen Las mejoras en la eficiencia de los sistemas urbanos pueden resultar insuficientes en la búsqueda de una ciudad más respetuosa con el medio natural si el consumo en el interior de las ciudades sigue creciendo sin control y, especialmente, si este incremento no es consecuencia directa del comportamiento de los consumidores. Para explicar cómo la estructura de la ciudad interviene en el consumo se recurre a dos formas diferentes de entender el espacio urbano. Por un lado el estudio del metabolismo urbano cuantifica los componentes que intervienen en el consumo, por otro, las interpretaciones marxistas de la ciudad tratan de explicar las estructuras sociales, políticas y económicas que lo condicionan. El resultado es una teoría conjunta que permite interpretar todos los fenómenos y actividades que engloba el término consumo, aglutinando tanto la dimensión ecológica de éste como los aspectos sociales y políticos que intervienen en el mismo. Palabras clave Estructura urbana, sostenibilidad, flujos de circulación, escasez, desequilibrios sociales y ambientales Abstract Improving the efficiency of urban systems may prove insufficient in the pursuit of a friendlier city with the environment if consumption within cities continues growing out of control and, in particular, if this increase is not a direct consequence of consumers’ behavior. For explaining how the structure of the city intervenes in consumption we can use two different ways of understanding urban space. On one hand urban metabolism quantifies the components involved in consumption, on the other Marxist interpretations of the city try to explain the social, political and economic structures that condition it. The result is a joint theory that allow us to interpret every phenomenon and activity within the term consumption and that bring together both ecological, political and social dimensions involved. Keywords Urban structure, sustainability, circulation fluxes

  13. Comparación de algoritmos basados en la criptografía simétrica DES, AES y 3DES

    Directory of Open Access Journals (Sweden)

    Yuri Tatiana Medina Vargas

    2015-12-01

    Full Text Available RESUMEN La seguridad es uno los aspectos más desafiantes de la internet y las aplicaciones de red. Las cuales están creciendo muy rápido, por lo que la importancia y el valor de los datos intercambiados a través de Internet u otros tipos de medios están aumentando. De ahí la búsqueda de la mejor solución para ofrecer la protección necesaria contra ataques de intrusos a nuestros datos, junto con la prestación de estos servicios en el tiempo es uno de los temas más interesantes en las comunidades relacionadas con la seguridad. La criptografía es la una de las principales categorías de la seguridad informática que convierte la información de su forma normal en un formato ilegible. Las dos características principales que identifican y diferencian algoritmo de cifrado uno de otro son su capacidad para asegurar los datos protegidos contra ataques y su velocidad y eficiencia en hacerlo. Este artículo ofrece una comparación equitativa de tres algoritmos de criptografía de clave simétrica más comunes: DES, AES y 3DES. ABSTRACT Security is one of the most challenging aspects of the internet and network applications. Which are growing very quickly, so that the importance and value of the data exchanged via the Internet or other media types are increasing. Hence the search for the best solution to provide the necessary protection against attacks by intruders to our data, together with the provision of these services in the time it is one of the most interesting topics in the communities related to security. Cryptography is the one of the major categories of computer security that converts the information from its normal form in an unreadable format the two main characteristics that identify and differentiat encryption algorithm from one another are its ability to ensure the data protected against attacks and their speed and efficiency to do so. This article provides a fair comparison of three algorithms for symmetric key cryptography

  14. Comunicación 2.0, visibilidad e interactividad: fundamentos de la imagen corporativa de las Universidades Públicas de Madrid en YouTube

    Directory of Open Access Journals (Sweden)

    Oliva Marañón, Carlos

    2012-12-01

    Full Text Available En español: En los últimos años, el marketing en la Educación Superior ha ido creciendo en interés no sólo por su valor económico y comercial, sino por su carácter estratégico y por la promoción, la formación y el fortalecimiento de la comunicación de la marca “Universidad”. La plataforma YouTube se ha posicionado como un medio audiovisual de referencia en la que el usuario decide qué contenidos quiere ver, dónde y cuándo. Los objetivos de esta investigación son analizar la Publicidad Institucional Audiovisual de las Universidades Públicas de la Comunidad de Madrid y verificar la idoneidad de YouTube como medio de comunicación de estas Instituciones. Oferta académica adaptada al Espacio Europeo de Educación Superior (EEES e instalaciones de vanguardia configuran las señas de identidad de estos centros. Los resultados confirman la consolidación de YouTube como canal audiovisual para la transmisión de los mensajes corporativos de estas Universidades a su público objetivo.In english: In recent years, marketing in Higher Education has been growing interest not only for its economic and commercial value but for its strategic and promotion, training and strengthening the brand communication "University". The platform YouTube has positioned itself as an audiovisual medium of reference in which the user decides what content you want to see, where and when. The objectives of this research are to analyze the audiovisual institutional advertising of the Public Universities of Madrid and verify the adequacy of YouTube as a communication from these Universities. Degrees adapted to the European Higher Education Area (EHEA and modern installations make up the identity of these Universities. The results confirm the consolidation of YouTube as a channel for transmitting audiovisual corporate messages of these Universities to their target audience.

  15. Macroeconomíc aspects of the development plan Aspectos macroeconómicos del plan de desarrollo

    Directory of Open Access Journals (Sweden)

    Lorente Luis

    1999-06-01

    Full Text Available Shortly after the economic opening, the economy began a cycle of rapid growth and accumulation of deficits, followed by another stage of monetary correctives which brake growth, but don't eliminate the causes of the disequilibrium. The Development Plan reduces the fiscal deficit and it is probable that the next expansion phase will last three years, instead of the barely one year that the previous expansion lasted. But the current account deficit of the balance of payments persists, and willgrow when privatizations slow down toward the third year of the Plan. The country needs outside capital to sustain its growth and modernize its production; thus private debt and foreign investment will continue togrow, along with foreign debt servicing and the repatriation of the profits of capital. Reducing the trade deficit to almost zero by 2002 is not enough; a surplus must be generated, that is, in addition to increasing exports we must substitute imports, but without the simplistic protectionism of the pasto instead of high tariffs, sources of risk capital must be created which are willing to finance new firms, technological innovations, and production of goods with sufficient quality and pricesto substitute for a good part of what we now import.Poco despues de la apertura, la economia inicio un ciclo de crecimiento rapido y acumulacion de deficits, seguido por otra etapa de correctivos monetarios que frenan el crecimiento, pero que no eliminan las causas del desequilibrio. El plan de desarrollo reduce el deficit fiscal y es probable que la proxima fase de expansion dure tres años, en lugar del año escaso que duro el anterior. Pero subsiste el deficit de cuenta corriente de balanza de pagos, que crecera cuando bajen las privatizaciones hacia el tercer año del plan. El pais necesita del capital externo para sostener su crecimiento y modernizar su produccion, asi que seguiran creciendo la deuda privada y la inversion extranjera y, con ellas, el

  16. Análisis sobre exposición de personas a campos electromagnéticos emitidos por redes celulares desplegadas en ambientes urbanos

    Directory of Open Access Journals (Sweden)

    Oscar N. Martínez

    2017-03-01

    Full Text Available El despliegue de las redes de telecomunicaciones inalámbricas de tipo móvil en América Latina han tenido un auge en su implementación en la última década, tales como las redes basadas en los estándares GSM, UMTS, HSDPA, LTE y WiMax son las tecnologías de redes inalámbricas que operan en nuestros países y el resto del mundo creciendo continuamente por la alta demanda de sus servicios. Esto provoca una exposición humana a los campos electromagnéticos (CEM emitidos por dichas redes cada vez mayor, despertando desconfianza en las personas sobre el posible efecto nocivo de las emisiones electromagnéticas generadas por las antenas de redes celulares, así como el uso del equipo móvil en la salud humana. En este trabajo presentamos los resultados de la simulación desarrollada en Matlab® considerando escenarios extremos de operación para evaluar el cumplimiento de los límites de exposición de personas a CEM provenientes de redes celulares basados en la recomendación UIT-T K52. De los resultados obtenidos comprobamos que debido a la baja potencia de los radiotransmisores de las redes celulares, los tipos de antenas y las bandas de operación (850, 1,900, 2,500 MHz, la tasa de absorción específica (SAR, por sus siglas en inglés y la energía absorbida por una persona sometida a exposición de CEM no sobrepasa el 2.1% y el 4.6% respectivamente del límite establecido para un emplazamiento. Para un patrón de reuso de 7/21 el SAR es del 7.2% y la energía es de 13.8%.

  17. Hacia las unidades de bibliometría en las universidades: modelo y funciones

    Directory of Open Access Journals (Sweden)

    Jiménez-Contreras, Evaristo

    2012-09-01

    Full Text Available In recent years, bibliometric indicators have been firmly established as a tool for research management and decision-making in the context of scientific policy. Spanish universities represent one sector that has seen signifi cant growth in the use of indicators. These institutions now find themselves in an ever more competitive environment and therefore have a greater need to have knowledge of the performance of their researchers. Against this background, this paper presents a proposal for the creation of Bibliometric Units in Spanish universities and attempts specifically to illustrate both the model and functions of these units based on three pillars: control of information sources related to research, preparing reports, and advice/training. In addition to the theoretical proposal we present different examples from the universities of Navarra and Granada. The text concludes that such units could represent an important opportunity for jobs in the fi eld of Information Science.

    En los últimos años la bibliometría evaluativa se han consolidado firmemente como herramienta en la gestión de la investigación y toma de decisiones en el ámbito de la política científica. Una de las instituciones donde más está creciendo este uso es en las universidades españolas que cada vez se encuentran en un entorno más competitivo y tienen una mayor necesidad de conocer el rendimiento de sus investigadores. Teniendo en cuenta este contexto en el presente trabajo se expone una propuesta para la creación de unidades de bibliometría en las universidades españolas. El objetivo específico es, por tanto, ilustrar el modelo y funciones de dichas unidades que han de basarse en tres pilares fundamentales: control de las fuentes de la información, realización de informes y asesoramiento y formación. Además de la propuesta teórica se presentan diferentes ejemplos llevados a cabo en las Universidades de Navarra y Granada. El texto concluye subrayando

  18. Ni bandas, ni linchamientos: Un estudio de caso sobre la resolución de conflictos en el sur de la Ciudad de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Guadalupe Basualdo

    2017-02-01

    Full Text Available Durante las últimas décadas, la llamada “inseguridad”, que hace alusión a un aumento de las actividades criminales, continuó creciendo como una cuestión social problemática. La presencia del “crimen organizado” así como las “disputas por el territorio” se fueron instalando como recursos explicativos recurrentes, muchas veces sin suficiente soporte empírico. Este artículo, escrito desde una perspectiva etnográfica, analiza las prácticas de los actores sociales que se involucraron en un conflicto violento de un barrio pobre de la ciudad de Buenos Aires. Al mismo tiempo, analiza la forma en la cual los habitantes administran los conflictos entre sí y las relaciones que establecen con las fuerzas de seguridad estatales, prestando especial atención a los valores morales.  Nas últimas décadas, a chamada "insegurança" que faz alusão a um aumento das atividades criminosas cresceu de forma consistente como uma questão social problemática. A presença do "crime organizado" e as "disputas sobre o território" foram os principais recursos apresentados para explicar esses fenômenos, embora muitas vezes sem apoio empírico suficiente. Este artigo analisa as práticas dos atores sociais que se envolveram em um conflito violento em um bairro pobre da cidade de Buenos Aires. Analisa também como os moradores desses bairros administram seus conflitos sociais e as relações que estabelecem com as forças de segurança do Estado.Palavras-chave: polícia comunitária, segurança, conflitos, bairros populares, moralidades During the last decades, the so called “lack of safety”, which alludes to a rise in criminal activities, grew consistently as a problematic social issue. The presence of “organized crime” and the “fight to control certain territories” were the main explanatory resources put forward to understand these phenomena, although frequently without enough empirical support. This paper, written from an

  19. La Teoría Fundamentada: un estudio bibliométrico de la enfermería brasileña The Grounded Theory: a bibliometric study of Brasilian nursing

    Directory of Open Access Journals (Sweden)

    Gabriela Marcellino de Melo Lanzoni

    2011-09-01

    Full Text Available El objetivo fue identificar las disertaciones y tesis en enfermería brasileña que usaron el método Teoría Fundamentada en Dados (TFD. Estudio bibliométrico de tesis y disertaciones de enfermería defendidas hasta 2009, disponible en: Banco de las tesis de la Coordinación de Perfeccionamiento de la Educación Superior, Colección de la Asociación Brasileña de Enfermería, Biblioteca Digital Brasileña de Tesis y Disertaciones y sitios institucionales. Para la búsqueda de los datos se utilizaron las palabras clave: "Grounded Theory" y "Teoría fundamentada" de forma individual junto a la "Enfermería". Se encontraron 124 estudios, 63 de maestría y 61 de doctorado, provenientes principalmente del sur y sureste del Brasil. El referencial teórico utilizado predominantemente fue el Interaccionismo Simbólico (71,77%. El uso de la TFD en las tesis y disertaciones de enfermería está creciendo y se demuestra que se puede aplicar en el nivel stricto senso de la formación para la elaboración de constructos teóricos.The aim of this study was to identify brazilian nursing dissertations and theses who used the methodological Grounded Theory (GT. The metodology used was bibliometric study of nursing theses and dissertations defended until 2009, available on theses database of the Coordination of Improvement of Higher Education (CAPES, the achievements of the Brazilian Nursing Association (CEPEn, the Brazilian Digital Library of Theses and Dissertations (BDTD and institutional sites. For search of the data we used the keywords: "Grounded Theory" and "Grounded Theory" coupled individually to "Nursing". We found 124 studies, 63 (50,81% of masters and 61 (49,19% of doctors, coming mainly from South and Southeast of Brazil. The theoretical framework used was predominantly Symbolic Interaction (71,77%. The use of PDT in theses and dissertations in nursing is growing and it is shown that can be applied at both levels of training in the strict sense

  20. Internet Use and the Political Knowledge Gap in Spain

    Directory of Open Access Journals (Sweden)

    Anduiza, Eva

    2012-04-01

    Full Text Available Media availability and fragmentation and the resulting possibilities of content selection have risen dramatically with the expansion of new digital media. Previous research has found that this may increase knowledge gaps among citizens with different resources and motivations. This article analyses how Internet use affects political knowledge gaps due to education and to political interest in Spain. As expected, frequent Internet users are more knowledgeable about politics than non-users. Furthermore, Internet use increases knowledge more for the highly educated than for citizens with lower levels of education. Thus, the political knowledge gap related to education seems to be growing with the introduction of new media. However, the knowledge gap between citizens with high and low levels of political interest is smaller for frequent Internet users than for non-users. These findings provide a complex picture and partially contradict the pessimistic theory about the impact of increasing media choice on political knowledge.

    La disponibilidad y fragmentación de medios de comunicación y las posibilidades de elegir contenidos han aumentado en gran medida a raíz de la expansión de los medios digitales. Éstos pueden, según investigaciones anteriores, incrementar las diferencias en los niveles de conocimiento entre ciudadanos con distintas características. En este artículo se analiza cómo el uso de Internet afecta a las diferencias en el conocimiento político según el nivel educativo y el interés por la política en España. Los usuarios frecuentes de Internet saben más sobre política que los no usuarios, como era de esperar. Además, el uso de Internet incrementa el conocimiento político de manera más intensa para los usuarios con niveles educativos más elevados. Por tanto, parece que las diferencias en los niveles de conocimiento pueden estar creciendo con la expansión de los medios digitales. Sin embargo, las diferencias

  1. The quality of democracy in Paraguay: progress on winding roads La calidad de la democracia paraguaya: un avance sobre caminos tortuosos

    Directory of Open Access Journals (Sweden)

    Mikel BARREDA

    2011-03-01

    Full Text Available Within the framework of growing concern for analyzing the quality of young democracies, this article focuses on the Paraguayan case. A democracy sometimes neglected by the academic literature. However, Paraguay is drawing attention as a consequence of Colorado’s Party defeat (in office since 1947 in the 2008 presidential election. A theoretical and methodological thinking about the concept of the quality of democracy together with an empirical research have been done in this article. Five essential dimensions have been taken into consideration: political rights and civil liberties; rule of law; accountability; responsiveness and political participation. The main conclusion is that Paraguay has a low quality democracy, far away from the rest of Latin American countries. This statement is backed up by three different explanations that are, at the same time, interlinked. These are the following: socioeconomic factors, features of its own political institutions (above all, the widespread clientelism and, finally, political parties’ interests and strategies.En el marco de una preocupación cada vez mayor por analizar la calidad de las nuevas democracias, este artículo se ocupa de examinar el caso de Paraguay. Se trata de una democracia poco atendida en la literatura especializada aunque su interés está creciendo como consecuencia de la derrota electoral del Partido Colorado (en el poder desde 1947 en las presidenciales de abril de 2008. Para llevar a cabo este trabajo, se parte de una reflexión teórica y metodológica en torno a la noción y la medición empírica de la calidad democrática. Al realizar el análisis de la democracia paraguaya se atiende a cinco dimensiones fundamentales: derechos políticos y libertades civiles, Estado de Derecho, rendición de cuentas, responsiveness y participación. La conclusión general es que es una democracia de baja calidad, distanciada del promedio latinoamericano. Para explicar este bajo nivel de

  2. Distribución de materia seca y nutrimentos en árboles de limón 'persa' (citrus latifolia tan. en Veracruz, México

    Directory of Open Access Journals (Sweden)

    E. Contreras-Morales

    2007-01-01

    Full Text Available El presente estudio se llevó a cabo en dos huertas de limón 'Persa' cada una en diferente tipo de suelo, con la finalidad de conocer la distribución de materia seca y nutrimentos en los órganos de cítricos y determinar su estado nutrimental. La huerta 1 de 12 años de edad estaba creciendo en suelo arcillo-migajón arenoso y la huerta 2, de 9 años de edad, en suelo arcilloso. El método de estudio consistió en extraer completamente cuatro árboles por huerta y fraccionarlos en sus diferentes órganos: hoja, flor, fruto, ramas, tronco y raíces. Las variables determinadas fueron: peso fresco y peso seco de cada órgano. Se determinó la concentración de nutrimentos por análisis químicos: N, P, K, Ca, Mg, B, Cu, Fe, Mn y Zn. Los datos de ambas huertas fueron sometidos a análisis de varianza y prueba de comparación de medias por separado. Las raíces fibrosas (< 1 mm de diámetro para ambas huertas presentaron concentraciones altas de micronutrimentos destacando Fe y Mn. Para ambas huertas los nutrimentos extraídos en mayor cantidad por el fruto fueron K y Ca; y en menor cantidad Zn y Cu. Con relación a la distribución de biomasa, el tronco y ramas aportaron el 60.32 %; el conjunto de raíces el 26.93 % y las hojas el 9.41 % de la materia seca total del árbol, mientras que el N en hojas representó el 17.5 % del total de la planta, en la huerta1. Esto representó 1.85 veces más de nitrógeno, con relación al peso seco de las hojas. Datos similares se tuvieron en la huerta 2. Para ambas huertas el Cu y el N fueron los nutrimentos más requeridos.

  3. Enfrentando la ausencia de los padres: recursos psicosociales y construcción de bienestar

    Directory of Open Access Journals (Sweden)

    Diana Marcela Montoya Zuluaga

    2016-01-01

    Full Text Available De acuerdo con los resultados de la encuesta de Profamilia (2010 y del Mapa Mundial de la Familia (Trends, 2013 los niños y jóvenes están creciendo con la ausencia física de alguno de los padres y algunos, a pesar de la presencia física de ellos, experimentan sentimientos de ausencia, pues al parecer han cambiado las formas de acompañamiento. Se hace necesario indagar por los recursos alternativos a la familia con los que están contando las nuevas generaciones, con el fin de ofrecer otras posibilidades desde lo social, institucional, personal, familiar, comunitario, que permita la construcción de bienestar en las personas. El objetivo del presente artículo de revisión es mostrar las diferentes investigaciones de los últimos diez años relacionadas con recursos psicosociales, bienestar subjetivo y sentimientos de ausencia. La metodología utilizada fue el rastreo de fuentes bibliográficas producto de investigación y de revisión teórica. Los resultados revelan que las personas cuentan con instituciones, grupos, comunidades y recursos internos que les permiten construir un proyecto de vida que genere bienestar. Abstract According to the results found on the Profamilia survey (2010 and the World Family Map (Trends, 2013, children and young people are growing with the physical absence of either of their parents and some, in spite of their physical presence, experience feelings of absence, since it seems that forms of accompaniment have changed. It has become necessary to look into the resources, alternative to the family, new generations draw on, so that social, institutional, personal, family, and community options are available for the building of well-being among people. The purpose of the present revision paper is to show different studies carried out in the last ten years, which are related to psychosocial resources, subjective well-being and feelings of absence. The methodology used was the tracking of bibliographical references

  4. Gestión del conocimiento: mayor producción y competitividad. Perspectivas para los sistemas de producción ovino-caprinos

    Directory of Open Access Journals (Sweden)

    Óscar Ospina

    2011-12-01

    Full Text Available Los ovinos se presentan hoy día en Colombia como una de las especies promisorias para el sector pecuario, con un despertar en la actividad que se manifiesta con un incremento del inventario, que según Faostat (datos debatibles, ha pasado de 2’400.000 cabezas en el año 2000 a 3’400.000 para el 2008; por su lado, las cabras han pasado de 1’200.000 a 1’300.000 cabezas en el mismo periodo, creciendo, aunque con un ritmo menor que el de las ovejas. Según esta base de datos, la misma tendencia se observa en el consumo per cápita de carne ovino-caprina que partiendo de 270 g/persona/año para el 2000 llega a 370 g/persona/año para el 2008. Este crecimiento en el inventario y el consumo per cápita del ovino-caprino impulsa la necesidad de aprovechar no solo las ventajas comparativas, sino también la generación de ventajas competitivas que lleven a la ovino-cultura y la caprino-cultura colombiana por el camino de la competitividad y la globalización, aprovechando las oportunidades en el mercado nacional y de exportación. El eficaz aprovechamiento de dichas ventajas implica la incorporación de los datos, la información y el conocimiento como factores de producción dentro de un proceso ordenado, bajo el marco de un sistema de “gestión de conocimiento”. El presente documento trata los fundamentos teóricos sobre los cuales se discute la manera como los datos, la información y el conocimiento se transforman en productividad y competitividad; se tratan los temas del “Big-Bang”, la entropía y neguentropía, la complejidad, la teoría de sistemas, la teoría del conocimiento, la epistemología, el management, la economía del conocimiento, la planeación estratégica, la espiral del conocimiento en las organizaciones, y la gestión del conocimiento, procurando algunas aproximaciones al sector agropecuario y la contextualización de la gestión del conocimiento en la ovino-cultura y caprino-cultura colombiana.

  5. Construcción sostenible y madera: realidades, mitos y oportunidades

    Directory of Open Access Journals (Sweden)

    Rolando Fournier Zepeda

    2008-04-01

    Full Text Available La construcción biológica sostenible se basa en el estudio de las interrelaciones entre el ser humano, el ambiente construido y su entorno. Es una filosofía de construcción que busca edificar espacios saludables, mejorar la calidad de vida, preservar la especie humana y el ambiente, conceptualizando la vivienda como nuestra tercera piel.La bioarquitectura tiene como propósito promover el estudio de materiales, elementos, componentes de construcción, viviendas y edificios que propicien el desarrollo, mejoramiento y uso de materiales compatibles con la vida, frente a otros que no lo son tanto.El avance de la tecnología y la versatilidad de los materiales, especialmente de la gama de plásticos, concreto y acero, ha hecho posible que los sistemas de construcción hayan variado mucho en pocas décadas.La disminución del uso de la madera no ha sido ajena a este hecho. Se ha olvidado casipor completo el conocimiento tradicional acerca de su uso, dando por consecuenciasu desprestigio.La madera es el material más noble, renovable, sano, sostenible, estético y confortable de la construcción. Prácticamente todas las culturas de la humanidad la han empleado en sus obrasconstructivas. En la medida en que la sensibilidad proteccionista de los bosques autóctonos y en especial, de los tropicales, vaya creciendo, también la industria de la madera irá tomando el tren de la tecnología, adaptándose a los nuevos tiempos. El conocimiento de la madera y el desarrollo de su tecnología en los aspectos de plantación, secado, técnicas de tratamiento y transformación permitirán garantizar el éxito de su utilización en el Sector de la Construcción, lo que la convertirá a corto plazo en el material del futuro. La madera es un material paradigmático en cuanto a su adecuación a los objetivos del respeto al medio ambiente.

  6. Optimización del registro de muerte por enfermedad renal crónica en las comunidades agrícolas de América Central

    Directory of Open Access Journals (Sweden)

    José Antonio Escamilla-Cejudo

    Full Text Available RESUMEN En varios países centroamericanos se observa que el número de muertes por enfermedad renal crónica asociada a causas no tradicionales (ERCnt entre trabajadores del campo continúa creciendo y existe un subregistro. Se presenta el resultado de un proceso de consenso coordinado por la Organización Panamericana de la Salud/Organización Mundial de la Salud (OPS/OMS, el Centro para el Control de Enfermedades de los Estados Unidos (CDC y la Sociedad Latinoamericana de Nefrología e Hipertensión Arterial (SLANH. Este consenso busca aumentar la probabilidad de detectar y registrar las muertes por estas causas. Se reconoció el impacto negativo que tiene la falta de un instrumento estandarizado y la baja capacitación que se tiene en la profesión médica para un registro adecuado de la o las causas de muerte. Como resultado del consenso, se propone el uso de un código de la Lista para Propósitos Especiales (de manera temporaria dentro de la Clasificación Internacional de Enfermedades (CIE-10, continuar con la promoción del uso del instrumento internacional estandarizado de la OMS para el registro de causas y eventos antecedentes relacionados con la muerte, aumentar el entrenamiento de los médicos responsables por el llenado del certificado de defunción, la realización de acciones para aumentar la completitud y calidad de la información de mortalidad, un algoritmo de decisión para facilitar la selección de la ERCnt como causa específica de muerte, presentando el papel que debieran tener los diferentes mecanismos regionales y subregionales en la región de las Américas para mejorar la situación del registro de mortalidad por ERC y ERCnt.

  7. Crecimiento de una ciudad dispersa: análisis y reflexiones del caso de la ciudad de Comodoro Rivadavia

    Directory of Open Access Journals (Sweden)

    Natalia Usach

    2015-04-01

    Full Text Available En diferentes contextos numerosas ciudades alrededor del mundo han experimentado, desde mediados del siglo pasado, nuevos patrones de crecimiento urbano. Bautizados estos fenómenos bajo distintas denominaciones, contraurbanización, desurbanización, difusión o dispersión urbana, han dado cuenta de un proceso de difusión poblacional por fuera de las áreas centrales tradicionales. En muchas ocasiones, las pautas de crecimiento urbano no sólo han consistido en la pérdida de población del área central y de algunas áreas suburbanas tradicionales; sino que han comportado incluso la disolución de la ciudad compacta tradicional por la ocupación discontinua del territorio.Estos fenómenos de crecimiento disperso no resultan novedosos para el caso de ciudades que, como Comodoro Rivadavia en la Patagonia argentina, han crecido históricamente a partir de la localización y consolidación de los asentamientos de trabajadores en torno a las extensas áreas de explotación petrolera a importantes distancias del casco central. En efecto, en esta ciudad puede reconocerse un territorio urbano disperso y fragmentado, atravesado por numerosos conflictos urbanísticos, sociales, económicos y ambientales; cuya impronta ha venido marcada por el devenir de la actividad extractiva.El presente trabajo tiene por objetivo analizar y caracterizar la dinámica reciente del crecimiento urbano en Comodoro Rivadavia. Nos preguntamos hacia dónde está creciendo la ciudad, cuáles son las zonas que evidencian un mayor dinamismo poblacional y cuáles son las características de este crecimiento en función no sólo a los cambios morfológicos sino también a las particularidades de la población implicada en este crecimiento.

  8. Perfil de los adultos mayores usuarios de atención primaria

    Directory of Open Access Journals (Sweden)

    Fabianne de Jesus Dias de Sousa

    2017-05-01

    Full Text Available Introducción: Las proyecciones indican que Brasil será el sexto país del mundo con el mayor número de adultos mayores. El objetivo de este estudio fue caracterizar las condiciones de perfil y de vida socio-demográficos y de salud de los usuarios adultos mayores de la atención primaria de un municipio en la región amazónica del Brasil. Es oportuno porque el envejecimiento de la población está creciendo rápidamente, especialmente en países en desarrollo como el Brasil. Materiales y Métodos: Estudio transversal con una muestra de 441 individuos con edad inferior a 60 años de la población de usuarios de la atención básica en el municipio de Benevides, en la Amazonia brasileña. Os datos fueron obtenidos a través del Elder notebook, un protocolo clínico del Ministerio de la Salud. La prueba del chi-cuadrado con un nivel de significancia de 5% para explorar fue utilizada las asociaciones entre las variables de las condiciones de salud y de vida, y las variables socio-demográficas. Resultados: Se presentaron un perfil predominantemente joven adultos mayores (46.0%, que no practican actividad física (p<0.02, con condiciones crónicas y uso de drogas para inducir el sueño (p<0.05. Discusión y Conclusiones: El perfil de vida desfavorable y de salud encontrados en adultos mayores exige la adopción de medidas reforzadas, sobre la salud y los presupuestos de atención integral como un desafío para efectuar la colocación de sus necesidades, principalmente por la enfermería, en la Atención Básica de Salud en áreas más necesitadas de la región amazónica. Cómo citar este artículo: Sousa FJD, Andrade FS. Perfil de los adultos mayores usuarios de atención primaria. Rev Cuid. 2017; 8(2: 1573-81. http://dx.doi.org/10.15649/cuidarte.v8i2.376

  9. Flipped Classroom en un aula de música de Primaria: implementación y análisis de una experiencia de innovación docente.

    Directory of Open Access Journals (Sweden)

    Francisco Jesús Parra Giménez

    2017-05-01

    Full Text Available Con el avance tecnológico y su integración en los procesos de enseñanza - aprendizaje en los centros educativos, aparecen nuevas metodologías apoyadas en las tecnologías de la información y comunicación (TIC de aquí en adelante, entre la que se encuentra Flipped Classroom o Aula Invertida. Nuevos escenarios de enseñanza y aprendizaje, que con el apoyo de las TIC,  permiten una educación centrada en el alumnado y  una educación acorde con la sociedad actual. La metodología de trabajo Flipped Classroom permite  enseñar a los alumnos con las herramientas telemáticas que forman parte de su realidad más próxima y entre las que están creciendo. Por ello, con este artículo se pretende dar a conocer los resultados de una experiencia de innovación docente basada en la metodología Flipped Classroom en el área de Educación Musical, con el alumnado de 4º curso de Educación Primaria. Tras el diseño y puesta en práctica de la Unidad Didáctica “Célebres Compositores”, se han obtenido una serie de resultados a través de diversas técnicas e instrumentos de recogida de información, como son los cuestionarios y la ficha de observación, que han permitido una evaluación positiva de dicha experiencia, así como comprobar que la metodología Flipped Classroom resulta interesante para futuras investigaciones y estudios en Educación Primaria. A continuación, se exponen los datos más relevantes y los resultados obtenidos de dicha experiencia.

  10. On the likelihood of future eruptions in the Chilean Southern Volcanic Zone: interpreting the past century's eruption record based on statistical analyses Probabilidades de futuras erupciones en la Zona Volcánica del Sur de Chile: interpretación estadística de la serie temporal de erupciones del siglo pasado

    Directory of Open Access Journals (Sweden)

    Yvonne Dzierma

    2012-09-01

    Full Text Available A sequence of 150 explosive eruptions recorded during the past century at the Chilean Southern Volcanic Zone (SVZ is subjected to statistical time series analysis. The exponential, Weibull, and log-logistic distribution functions are fit to the eruption record, separately for literature-assigned volcanic exploslvlty indices (VEI ≥ 2 and VEI ≥ 3. Since statistical tests confirm the adequacy of all the fits to describe the data, all models are used to estimate the likelihood of future eruptions. Only small differences are observed between the different distribution functions with regard to the eruption forecast, whereby the log-logistic distribution predicts the lowest probabilities. There is a 50% probability for VEI ≥ 2 eruptions to occur in the SVZ within less than a year, and 90% probability to occur within the next 2-3 years. For the larger VEI ≥ 3 eruptions, the 50% probability is reached in 3-4 years, while the 90% level is reached in 9-11 years.Se presenta un análisis estadístico de la serie temporal de 150 erupciones volcánicas explosivas registradas durante el siglo pasado en la Zona Volcánica del Sur de Chile. Se modeló el conjunto de erupciones mediante la distribución exponencial, de Weibull y log-logística, restringiendo el análisis a erupciones de índice de explosividad volcánica (IEV mayores a 2 y 3, respectivamente. Como los modelos pasan las pruebas estadísticas, los tres modelos se aplican para estimar la probabilidad de erupciones futuras. Se observan solo diferencias menores entre las predicciones mediante los distintos modelos, con la distribución log-logística dando las probabilidades más bajas. Para erupciones de IEV ≥ 2, la probabilidad de producirse una erupción dentro de un año es más del 50%, creciendo al 90% en 2-3 años. Para erupciones más grandes, de IEV ≥ 3, el 50% de probabilidad se alcanza dentro de 3-4 años, y el 90% dentro de 9-11 años.

  11. El problema del crecimiento sostenible ¿cómo crecer sin destruirse?

    Directory of Open Access Journals (Sweden)

    Jorge Saravia Rios

    2010-08-01

    Full Text Available De una u otra forma las organizaciones perciben el crecer como una meta necesaria en la planeación estratégica y cuando se logra el crecimiento buscado se supone una gestión exitosa. Sin embargo, en ocasiones no hay claridad sobre lo que significa crecer, cuáles son sus efectos y no se comprende con profundidad el significado de una buena gestión. Es común ver a las organizaciones formular preguntas como:¿Crecer significa vender más?, ¿Hasta dónde puedo crecer? ¿Crecer es tener mayor infraestructura y personal? ¿Qué tan rentable seré creciendo? o presentando afirmaciones como: “la meta del plan estratégico para este año es crecer un 20%, eso nos posicionará como el número uno en el sector”. La meta de una organización debe ser: ser sostenible y el crecer, puede ser una estrategia para lograrla, sin embargo, el crecer por sí mismo no necesariamente genera sostenibilidad, por esto, si una organización lo entiende como su meta puede comprometer su viabilidad. El problema del crecimiento tiene varias dimensiones de análisis que involucran todas las instancias de una organización, por ejemplo, se necesita tener acceso a la información del mercado y el entorno, se necesita tener la inteligencia para comprender esta información, se necesita una estructura organizacional dinámica, flexible e innovadora, es necesario comprender cómo los diferentes procesos interactúan y qué recursos necesitan. Para entender el crecer como una estrategia, se hace necesaria su formalización, y el uso de herramientas que permitan su manejo, estas herramientas deberán incluir las diferentes dimensiones de análisis. Mediante el uso de estos modelos, una organización puede diseñar una estrategia de crecimiento coherente con sus metas, y sin el riesgo de comprometer su estabilidad.

  12. Los modelos de simulación de eventos discretos en la evaluación económica de tecnologías y productos sanitarios Discrete-event simulation models in the economic evaluation of health technologies and health products

    Directory of Open Access Journals (Sweden)

    José Manuel Rodríguez Barrios

    2008-04-01

    Full Text Available El uso de modelos matemáticos como instrumentos de evaluación de alternativas está teniendo una importancia cada vez mayor en el terreno de la evaluación económica de servicios y tecnologías sanitarias, con un papel cada vez más relevante como ayuda en la toma de decisiones en la gestión sanitaria. Hasta ahora se han usado fundamentalmente 2 tipos de modelos, en parte en función de la enfermedad estudiada. De esta forma, los árboles de decisión han sido muy utilizados para las enfermedades de carácter agudo y los modelos de Markov han sido usados en enfermedades crónicas o que presentan estados de salud recurrentes. Sin embargo, tanto unos como otros presentan importantes limitaciones a la hora de modelar de forma realista ciertos procesos o enfermedades, y por ello está creciendo el interés y el uso de los modelos de simulación de eventos discretos. El objetivo del presente artículo es describir las principales características que presentan los modelos de simulación de eventos discretos, describir las últimas novedades, así como presentar qué ventajas aportan con respecto a los otros tipos de modelos en economía de la salud y, especialmente, en la evaluación económica de tecnologías y productos sanitarios.The use of mathematical models to assess therapeutic alternatives is increasing in the economic evaluation of health technologies and services and these models are becoming an increasingly important aid to decision making in health care. Until now, 2 types of model have been used, depending to some extent on the disease to be studied: decision trees have been used for acute diseases and Markov models in chronic or recurrent diseases. However, both models present major limitations when addressing complex processes or diseases. Consequently, interest in, and the use of, discrete-event simulation is growing. The present article aims to describe the main characteristics of discrete-event simulation, the state of the art

  13. Apps y gestión de marca ¿es indispensable ser mobile?

    Directory of Open Access Journals (Sweden)

    Zahaira González Romo

    2011-05-01

    Full Text Available La gestión estratégica de la marca a través de los medios de comunicación digital ha cobrado especial relevancia en los últimos años, y prácticamente todas las empresas que se aprecien de llevar una comunicación acorde a sus públicos han desarrollado herramientas y adaptado su comunicación de marca a los diferentes soportes, medios y entornos que han ido emergiendo, hasta el punto de que este proceso ha sufrido una metamorfosis que no todas las empresas consiguen asumir y entender. No sólo hablamos de un replanteamiento y adaptación a las nuevas tecnologías, sino una “nueva forma” de pensar las marcas y su repercusión e imagen en la mente de los consumidores. Tal es el caso de las aplicaciones para los smartphones, que se han desarrollado con una virulencia impresionante, aproximadamente 200.000 actualmente, y el número continúa creciendo. Este estudio pretende ser una primera aproximación a la aparición de las marcas en las aplicaciones para móviles, específicamente en las aplicaciones destinadas a iPhone.Gracias esta investigación sabemos que es indispensable tener en cuenta tres criterios básicos en el desarrollo de aplicaciones; el primero y más importante es que los anunciantes deben centrarse en el análisis de las necesidades de los usuarios, determinar sus objetivos, elaborar planes de integración y sobre todo preparar los medios de comunicación multicanal y de apoyo a la comercialización. Si la aplicación es correcta pero no funciona adecuadamente, deteriora la imagen de la marca de cara al cliente. En segundo lugar, la experiencia del usuario en las aplicaciones móviles debe ser complementaria y coherente con su experiencia a través de otros canales, es decir, debe mantenerse fiel a la marca y a la identidad de la empresa. Y el tercer criterio, es importante para la marca ir adaptándose a las nuevas tecnologías, pues una incorporación precaria y mal desarrollada puede ser más perjudicial que no el

  14. LA ACCIÓN Y EL ENFOQUE PSICOSOCIAL DE LA INTERVENCIÓN EN CONTEXTOS SOCIALES: ¿PODEMOS PASAR DE LA MODA A LA PRECISIÓN TEÓRICA, EPISTEMOLÓGICA Y METODOLÓGICA?. THE ACTION AND THE PSYCHOSOCIAL APPROACH OF THE INTERVENTION IN SOCIAL CONTEXTS: CAN WE MOVE FROM THE FASHION TO THE THEORETICAL, EPISTEMOLOGICAL, AND METHODOLOGICAL PRECISION?.

    Directory of Open Access Journals (Sweden)

    Juan David Villa Gómez

    2012-12-01

    Full Text Available El siguiente artículo derivado de investigación, se plantea la pregunta en torno a una realidad que viene creciendo en Colombia: el incremento de los proyectos de intervención psicosocial en diversos sectores sociales, especialmente con víctimas del conflicto armado, violencia social, violencia de género e intrafamiliar, entre otras; además de población en situación de pobreza extrema, desplazamiento forzado y víctimas de catástrofes naturales. En relación con esta lógica de intervención y de acción, la reflexión académica aún sigue siendo escasa, poco clara y repetitiva de concepciones y disquisiciones internas de las disciplinas sociales, especialmente de la psicología. Por lo tanto, desde la experiencia de trabajo, desde la propia investigación y desde los procesos de acompañamiento psicosocial desarrollados por cerca de 15 años, el autor presenta una propuesta de reflexión, que implica una mirada desde el pensamiento crítico social y una postura que permita darle un marco a la acción psicosocial en una perspectiva emancipatoria.The following article, derived from research, poses the question about a growing issue in Colombia: the increase in projects of psychosocial intervention in diverse social sectors, particularly with victims of the armed conflict, social violence, violence of gender and family, etc., as well as population in a situation of extreme poverty, forced displacement and victims of natural disasters. In relation to this logic of intervention and action, the academic reflection tends to be scarce, unclear and repetitive of concepts and internal disquisitions of the social disciplines, especially of psychology. Therefore, from the work experience, from the research itself and from the processes of psychosocial accompaniment for about 15 years, the author presents a reflective proposal, which implies a look from the social critical thought and a stance that allows to give a framework for the psychosocial

  15. Nuclear Power and Sustainable Development (Spanish Edition); Energia Nucleoelectrica y Desarrollo Sostenible

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-02-15

    crecientes de energia sin generar efectos colaterales negativos que amenacen el entorno vital de las generaciones futuras? La energia nucleoelectrica no es una panacea: es una opcion que se combina con otras para dar respuesta a los problemas energeticos. Las expectativas acerca de la expansion del uso de la energia nucleoelectrica estan creciendo. Ademas del aumento de la demanda, estas expectativas tambien obedecen a la preocupacion por la seguridad energetica, asi como a la baja emision de gases de efecto invernadero en la generacion de energia nucleoelectrica y al solido historial de las centrales nucleares. Cada pais debe hacer sus propias opciones energeticas: no hay una medida que valga para todos. Pero para los paises interesados en incorporar la energia nucleoelectrica en sus estrategias de desarrollo sostenible es importante mantener abierta y accesible esa opcion energetica.

  16. Remoção mecânica de plantas aquáticas: análise econômica e operacional Mechanical removal of aquatic weeds: operational and economic analysis

    Directory of Open Access Journals (Sweden)

    U.R. Antuniassi

    2002-01-01

    Full Text Available A remoção de plantas aquáticas tem sido utilizada como opção ao controle químico e biológico, em razão de restrições ambientais em algumas regiões brasileiras. O objetivo deste trabalho foi desenvolver um modelo para análise econômica e operacional da remoção mecânica de plantas aquáticas, visando realizar estudo econômico comparativo com o controle químico. A operação foi estudada num reservatório de uma usina de bombeamento em Barra do Piraí-RJ. O sistema consiste de retroescavadeiras instaladas em balsas, usadas para cortar as plantas e liberá-las no fluxo de água. Antes da tomada d'água existe uma barreira flutuante que intercepta as plantas, as quais são removidas por um guindaste fixo nas margens. As plantas são armazenadas por algum tempo e depois descartadas. Existe, ainda, um sistema de limpeza das grades da tomada d'água. Dados do volume total de plantas descartadas foram coletados durante 14 meses, assim como foi avaliado o volume de biomassa produzido por área das principais espécies infestantes. A empreiteira que administra o serviço forneceu planilhas de custos e outro parâmetros operacionais. Um modelo foi desenvolvido para calcular custos por hectare de plantas removidas. Os resultados mostraram custo médio mensal de US$ 17.780,28 por hectare. Apesar do alto custo, o sistema de remoção demonstrou capacidade de controlar apenas 4,1% da área infestada no reservatório, na época da coleta dos dados. Simulando dados de uma aplicação de glyphosate, o controle químico custaria apenas 0,23% do custo da remoção. Análises de sensibilidade mostraram que a compactação das plantas para transporte, o volume de plantas produzidas por área e o custo do transporte são os parâmetros principais para a otimização.Mechanical removal of aquatic weeds has been an option to biological and chemical control because of environmental restrictions in some places in Brazil. The objective of this study was to

  17. Variabilidad genética y morfológica y estructuración poblacional en Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endémica de Chile Genetic and morphological variation and population structure in Alstroemeria hookeri subsp. hookeri (Alstroemeriaceae, endemic to Chile

    Directory of Open Access Journals (Sweden)

    EDUARDO RUIZ

    2010-12-01

    Full Text Available El género Alstroemeria es exclusivamente sudamericano y consta de 82 taxa distribuyéndose, principalmente en Chile y Brasil. La gran importancia económica que han adquirido las Alstroemerias chilenas como plantas ornamentales ha despertado gran interés en la variabilidad morfológica de las flores y variabilidad genética en especies con potencial valor económico. Una de ellas es Alstroemeria hookeri que posee cuatro subespecies, de las cuales, la subespecie tipo, es endémica de las regiones del Maule y Biobio. Su distribución geográfica consiste de dos rangos, separados por la Cordillera de la Costa. Así, existen poblaciones costeras, creciendo, entre los 5-20 m de altura en las provincias de Arauco, Concepción, Nuble y Cauquenes y poblaciones del interior creciendo entre los 100-150 m de altura, en las provincias de Biobio y Nuble. Evidencias preliminares señalan diferencias fenotípicas entre poblaciones costeras y del interior, relacionadas con el color y forma de los tépalos. Por esta razón, se realizó un estudio morfológico comparativo en el rango completo de distribución de esta subespecie y estudiar su genética poblacional, especialmente los niveles de estructuración poblacional. Se analizaron 33 caracteres florales, mediante métodos de ordenación. El estudio morfológico indica una tendencia a separar las poblaciones en dos grupos, coincidiendo con los extremos de la variación morfológica y con ambos rangos de distribución, existiendo caracteres que aportan a ello. Los índices de variabilidad genética fueron determinados usando 17 loci aloenzimáticos. Además, se estimaron los valores de estructuración poblacional y se realizó un análisis de AMOVA. Se estimaron valores de distancia genética de Nei, entre todos los pares de poblaciones para construir un dendrograma que refleje las relaciones de similitud genética. Los resultados indican altos valores de estructuración entre poblaciones y baja variabilidad

  18. Selected Abstracts of the 10th International Workshop on Neonatology; Cagliari (Italy; October 22-25, 2014

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2014-06-01

    (Italy ABS 9. Traffiking of thymosin beta-4 in the cellular compartments of HepG2 cells at different conditions • M. Piras, M. Piludu, G. Pichiri, P. Coni, T. Cabras, R. Ambu, M. Castagnola; Cagliari and Rome (Italy ABS 10. Thyroid carcinoma in sardinian children and adolescents is often associated with autoimmune thyroiditis • P. Coni, E. Tamponi, A. Lampis, G. Pinna, A.M. Nurchi, S. Farci, M.L. Lai; Cagliari (Italy ABS 11. Prolonging nephrogenesis in preterm infants: a new approach for the prevention of renal disease in adulthood? • A. Sanna, C. Gerosa, D. Fanni, P. Van Eyken, M. Castagnola, R. Ambu; Cagliari, Rome (Italy and Leuven (Belgium ABS 12. Human adrenal gland development: morphogenesis and molecular mechanisms • E. Obinu, V. Fanos, A. Dessì, R. Ambu; Cagliari (Italy ABS 13. Biometrics application for newborns safe identification in Neonatal Intensive Care Units • A. Casanova, S. Barra, M. De Marsico, D. Riccio, L. Barberini, M. Puddu, V. Fanos; Cagliari, Rome and Naples (Italy ABS 14. Metabolomics in neonatal hypoxic-ischemic encephalopathy (HIE: a proposal for a european multicenter study • P. Gancia, G. Pomero, A. Delogu, C. Dalmazzo, G. Palmas, V. Fanos; Cuneo and Cagliari (Italy ABS 15. Longitudinal evaluation of myocardial function in infants with Hypoxic-Ischemic Encephalopathy (HIE: preliminary data • F. Vitali, S. Galletti, A. Aceti, L. Ridolfi, G. Aquilano, M. Fabi, G. Faldella; Bologna (Italy ABS 16. Changes in podocyte number during intrauterine development • M. Desogus, A. Crobe, A. Sanna, C. Gerosa, C. Fanni, C. Loddo, M. Puddu, G. Ottonello, D. Fanni; Cagliari (Italy ABS 17. Efficacy of recombinant human erythropoietin in anemic pregnant women with heterozygous beta-thalassemia • S. Angioni, V. Mais, G.B. Melis; Cagliari (Italy ABS 18. WT1 expression in ontogenesis of human fetus • R. Ambu, L. Vinci, C. Gerosa, D. Fanni, E. Obinu, A. Faa, V. Fanos; Cagliari (Italy ABS 19. Brain hypothermia in perinatal arterial ischemic

  19. New exposure ages for the Last Glacial Cycle in the Sanabria Lake region (northwestern Spain)

    Science.gov (United States)

    Rodríguez-Rodríguez, Laura; Jiménez-Sánchez, Montserrat; Domínguez-Cuesta, María Jose; Rinterknecht, Vincent; Pallàs, Raimon; Braucher, Régis; Bourlès, Didier; Valero-Garcés, Blas

    2013-04-01

    ., 2011. Last deglaciation in northwestern Spain: New chronological and geomorphologic evidence from the Sanabria region. Geomorphology 135, 48-65. Palacios, D., Andrés, N., Úbeda, J., Alcalá, J., Marcos, J., Vázquez-Selem, L., 2012. The importance of poligenic moraines in the paleoclimatic interpretation from cosmogenic dating. Geophysical Research Abstracts 14, EGU2012-3759-1. Pérez-Alberti, A., Valcárcel-Díaz, M., Martini, I.P., Pascucci, V., Andrucci, S., 2011. Upper Pleistocene glacial valley-junction sediments at Pias, Trevinca Mountains, NW Spain. In: Martini, I.P., French, H.M., Pérez-Alberti, A. (Eds.), Ice-Marginal and Periglacial Processes and Sediments. Geological Society (London) Special Publication 354, pp. 93-110. Research funded by the projects LIMNOCLIBER (REN2003-09130-C02-02), IBERLIMNO (CGL2005-20236-E/CLI), LIMNOCAL (CGL2006-13327-C04-01) and GRACCIE (CSD2007-00067) of the Spanish Inter-Ministry Commission of Science and Technology (CICYT). Additional funding was provided by the Fundación Patrimonio Natural de Castilla y León through the project "La investigacion en el Lago de Sanabria dentro del proyecto CALIBRE: perspectivas y posibilidades", and by the projects Consolider Ingenio 2006 (CSD2006-0041, Topo-Iberia), 2003 PIRA 00256, HF02.4, and RISKNAT (2009SGR520). L. Rodríguez-Rodríguez has developed her research under a Severo Ochoa Programme fellowship (FICYT- Asturias).

  20. Mal de Asclepio o Síndrome Judicial Médico

    Directory of Open Access Journals (Sweden)

    Hernán Urbina Joiro

    2015-12-01

    Full Text Available

    Se asocian crecientemente, de manera criminal, abogados, pacientes y médicos perversos contra médicos honestos, alineando el factor que peor puede degradar la medicina de hoy y potenciar sus otros males. Siendo dios de la medicina, el nacimiento y la muerte de Asclepio estuvieron marcados por la vileza, la que hoy amenaza de muerte a la profesión médica. Pero no hay que olvidar que finalmente Asclepio pudo ser resguardado de la perversidad.

    No se trata de la situación de quien denuncia legítimamente una transgresión cometida por un médico. El Mal de Asclepio o Síndrome Judicial Médico describe la actuación calculada por auténticos «enfermos» —en el sentido sociopático—, con manifiesta intención de ocasionar daño a médicos inocentes, comúnmente a través de prácticas delictivas, ocasionando además males permanentes en la salud física y mental de quienes se habían esforzado, irónicamente, para sanar a los demás, en esta era de degradación de la profesión médica, en este momento extraño donde el bastón de Asclepio, dios de la medicina, fue cambiado por el caduceo de Mercurio, dios del comercio y también de los ladrones (1.

    Asclepio fue un hijo no nacido, rescatado por un prodigio desde el vientre de su madre muerta y a punto de ser consumida por la pira funeraria. Coronis —o Corónide—, la madre, lo concibió tras un asalto del dios Apolo en la rivera de un río y, sin saber de su estado, cumplió con un pacto matrimonial arreglado por su padre, lo que incitó a Apolo a dar muerte a su joven esposo e impulsó a Artemisa, hermana de Apolo, a asesinar a flechazos a la propia Coronis. Fue el mismo Apolo quien, en el último momento, resolvió extraer del cadáver de Coronis al niño que puso por nombre Asclepio y que en adelante lucharía contra la muerte, incluso resucitando difuntos, hasta que la propia muerte —Hades— convenció de mala fe a Zeus, lo indujo al error —que más tarde

  1. Open Source Web Tool for Tracking in a Lowcost Mobile Mapping System

    Science.gov (United States)

    Fissore, F.; Pirotti, F.; Vettore, A.

    2017-11-01

    During the last decade several Mobile Mapping Systems (MMSs), i.e. systems able to acquire efficiently three dimensional data using moving sensors (Guarnieri et al., 2008, Schwarz and El-Sheimy, 2004), have been developed. Research and commercial products have been implemented on terrestrial, aerial and marine platforms, and even on human-carried equipment, e.g. backpack (Lo et al., 2015, Nex and Remondino, 2014, Ellum and El-Sheimy, 2002, Leica Pegasus backpack, 2016, Masiero et al., 2017, Fissore et al., 2018). Such systems are composed of an integrated array of time-synchronised navigation sensors and imaging sensors mounted on a mobile platform (Puente et al., 2013, Tao and Li, 2007). Usually the MMS implies integration of different types of sensors, such as GNSS, IMU, video camera and/or laser scanners that allow accurate and quick mapping (Li, 1997, Petrie, 2010, Tao, 2000). The typical requirement of high-accuracy 3D georeferenced reconstruction often makes such systems quite expensive. Indeed, at time of writing most of the terrestrial MMSs on the market have a cost usually greater than 50000, which might be expensive for certain applications (Ellum and El-Sheimy, 2002, Piras et al., 2008). In order to allow best performance sensors have to be properly calibrated (Dong et al., 2007, Ellum and El-Sheimy, 2002). Sensors in MMSs are usually integrated and managed through a dedicated software, which is developed ad hoc for the devices mounted on the mobile platform and hence tailored for the specific used sensors. Despite the fact that commercial solutions are complete, very specific and particularly related to the typology of survey, their price is a factor that restricts the number of users and the possible interested sectors. This paper describes a (relatively low cost) terrestrial Mobile Mapping System developed at the University of Padua (TESAF, Department of Land Environment Agriculture and Forestry) by the research team in CIRGEO, in order to test an

  2. Editorial Revista Ciencias Administrativas N°10

    Directory of Open Access Journals (Sweden)

    Comite Ejecutivo Revista CADM

    2017-06-01

    Full Text Available Tenemos el agrado de presentar el Número 10 de la Revista Ciencias Administrativas, correspondiente al periodo julio - diciembre de 2017. Esta edición incluye ocho artículos de autores de la Argentina, Ecuador, España, Francia y México donde se tratan temas relacionados con finanzas, responsabilidad social,  gestión organizacional, administración pública y neurociencia. La revista cumple su primer lustro y con orgullo podemos decir que hemos alcanzado grandes objetivos en un lapso bastante corto en lo que a publicaciones científicas se refiere. Ciencias Administrativas ha ido creciendo número a número y en esta oportunidad aprovechamos para compartir con ustedes un logro reciente. La Universidad Nacional de La Plata ha adquirido el servicio DOI (Digital Object Identifier que asigna a objetos digitales una identificación unívoca que permite citarlos y relacionarlos, por ejemplo, con una institución. Desde este número todos los artículos cuentan con su DOI y, de esa forma, mejoramos la visibilidad e identificación de la Revista para los lectores de todo el mundo. Seguimos avanzando en términos de indexación: a partir de mayo de este año, hemos sido aceptados para formar parte de la base de datos del Núcleo Básico de Revistas Científicas Argentinas (NB que comprende un conjunto de publicaciones científicas y tecnológicas argentinas en los distintos campos del conocimiento evaluadas según criterios definidos de calidad y trascendencia. También queremos informales que, para poder cumplir con una de las exigencias de sitios a los que esperamos ingresar en breve, debemos desempeñarnos con ciertos requisitos de calidad editorial que implican modificar las fechas de publicación de nuestros números. Es por eso que el 1 de julio de este año publicamos el N° 10 de la Revista correspondiente al período julio – diciembre y, a partir de ahora, las ediciones sucesivas serán el 1 de enero y el 1 de julio por los

  3. Evaluation of the ORYZA2000 Rice Growth Model under Nitrogen-Limited Conditions in an Irrigated Mediterranean Environment Evaluación del Modelo de Crecimiento de Arroz ORYZA2000 bajo Condiciones Limitadas de Nitrógeno en un Ambiente Mediterráneo Regado

    Directory of Open Access Journals (Sweden)

    Pamela Artacho

    2011-03-01

    Full Text Available ORYZA2000 is a growth model for tropical lowland rice ( Oryza sativa L. developed by the International Rice Research Institute and Wageningen University. This model has been evaluated extensively in a wide range of environments. However, reports examining japonica cultivars growing in temperate climates are scarce. In this study, ORYZA2000 was calibrated and evaluated using data from experiments carried out in the South-Central area of Chile. These experiments were performed on a japonica rice cultivar growing under an irrigated Mediterranean environment at various N rates. ORYZA2000 was then applied to explore potential yield and grain yield response to N fertilization under likely weather conditions in the major rice-producing area in Chile. ORYZA2000 was sufficiently accurate to simulate grain yield and crop N uptake at the end of the season. Final crop N uptake was simulated with a root mean squared error (RMSE of 20 kg ha-1 (15% and grain yield with a RMSE of 1666 kg ha-1 (19%. However, the prediction of biomass and N uptake of individual organs throughout the season was poor. A long-term simulation study confirmed a potential yield as high as 12 000 kg ha-1 in the Parral area, as well as the existence of a scope for yield increase. The yield response to N fertilization was predicted even at rates of 300 kg ha-1, although a significant probability of low yields was also observed. This trend supports the need to incorporate dynamic N management in Chilean rice production.ORYZA2000 es un modelo para arroz tropical regado desarrollado por el Instituto Internacional de Investigación en Arroz y Universidad de Wageningen, que ha sido evaluado en un amplio rango de ambientes. Sin embargo, los reportes para cultivares japónica creciendo en ambientes templados son escasos. En este estudio, ORYZA2000 fue calibrado y evaluado usando datos de experimentos realizados en el centro-sur de Chile, que incluyeron una variedad japónica cultivada bajo un

  4. Seasonal changes in the photosynthetic performance of two evergreen Nothofagus species in south central Chile Cambios estacionales en el desempeño fotosintético de dos especies siempreverdes de Nothofagus en el centro sur de Chile

    Directory of Open Access Journals (Sweden)

    RAFAEL ZÚÑIGA

    2006-12-01

    del aparato fotosintético bajo condiciones de jardín común de estas especies podrían explicar sus contrastantes preferencias de hábitat. Se estudian algunas de estas propiedades en estas dos especies creciendo en un jardín común en el centro sur de Chile. La eficiencia fotoquímica máxima (Fv/Fm de ambas especies permanece en el rango de los valores normales (» 0,8 con excepción de un decrecimiento al mediodía y en verano en N. dombeyi, que sugiere una reducción reversible de la eficiencia fotoquímica máxima del fotosistema II (PSII. Durante el verano, la eficiencia fotoquímica efectiva del PSII (F PSII, el apagamiento fotoquímico (qP, la fotosíntesis (Amax, conductancia estomática (gs y las tasas de transpiración (E en N. dombeyi fueron mayores que en N. nitida. Los mayores incrementos en los contenidos de pigmentos fotoprotectores (zeaxantina + anteraxantina y luteína entre prealba y mediodía se obtuvieron en verano en N. dombeyi. En N. nitida se presentó en invierno una retención nocturna de zeaxantina sin decrecimiento de Fv/Fm. Los resultados sugieren que bajo condiciones de mayor intensidad lumínica, mayor temperatura y sequía, N. dombeyi mostró un mejor desempeño fotosintético que N. nitida. Los datos presentados son consistentes con la capacidad pionera de N. dombeyi y las propiedades de semitolerancia a la sombra y distribución más restringida de N. nitida. Estas características fotosintéticas, junto con las diferencias de la resistencia al congelamiento, sequía y anegamiento pueden resultar de su separación de hábitat

  5. Let others manufacture! Towards a new manufacturing framework ¡Qué fabriquen ellos! Hacia un nuevo modelo productivo

    Directory of Open Access Journals (Sweden)

    Carlos Rodriguez Monroy

    2009-11-01

    salida, flexibilidad geográfica, bajos costes, difusión tecnológica en la red muy rápida, alta diversificación a través de los fabricantes subcontratados y excepcionales economías de escala. Este trabajo propone un modelo teórico que analizará las causas de la formación de estas redes incluyendo sus cuatro pilares básicos: estrategia, estructura, dinámica y cultura. Para ello, se tendrán en cuenta aspectos como las alianzas estratégicas entre empresas competidoras, la naturaleza permeable y difusa de los actores de la red y el riesgo de canibalizaciones de roles, la paradoja inherente de colaborar con competidores, los aspectos culturales a nivel sistémico o las tecnologías de información y comunicación a nivel de red. El modelo teórico propuesto permitirá conocer de una manera ordenada, todos los aspectos relevantes de este tipo de redes para esclarecer y dar perspectiva a uno de los tipos de organizaciones que más ha creciendo en los últimos años.

  6. CÁNCER DE PIEL NO MELANOMA: RIESGOS E ITINERARIOS

    Directory of Open Access Journals (Sweden)

    Guillermo Sánchez Vanegas

    2016-04-01

    quema con el viento. ...la verdad mijo nunca se cuidaba la piel. Él a veces usaba sombrero,... cremas nunca... eso es de mujeres... y al médico muy rara vez iba. Uno aquí en el campo está muy alejado de todo y protegerse del sol... yo creo que eso no le afanaba...

    Cuando preguntamos acerca del desarrollo y la detección de la enfermedad de don José, doña María nos contó:

    Un día, le pregunté a mijo acerca de ese granito que tenía en el borde de la nariz, y me dijo que era un barrito que se había espichado, pero que seguía creciendo. Después de mucho insistirle... por fin decidió ir al médico del centro de salud de Sotaquirá.. Un mes y medio después nos dieron la cita con el médico general, ...le formuló una cremita y nos dijo que volviéramos en un mes..."

  7. O significado da hospitalização para a criança pré-escolar: um modelo teórico El significado de la hospitalización para el niño en edad pre-escolar: un modelo teórico The meaning of hospitalization for the pre-school child: a theoretical model

    Directory of Open Access Journals (Sweden)

    Circéa Amália Ribeiro

    2005-12-01

    Full Text Available Este estudo teve como objetivo compreender o significado de estar hospitalizada, para a criança pré-escolar. Os referenciais teóricos foram o Interacionismo Simbólico e a teoria de Vygotsky sobre a brincadeira simbólica da criança e o referencial metodológico foi a Teoria Fundamentada nos Dados. Participaram do mesmo 11 crianças de três a seis anos de idade. As estratégias de coleta de dados foram: observação participante, entrevista com as crianças, mediada pelo Brinquedo Terapêutico e entrevista com as mães. A análise dos dados permitiu construir o modelo teórico Crescendo com a presença protetora da mãe, que evidencia a vulnerabilidade, a força da criança e a proteção recebida da mãe, para enfrentar o mistério e o terror da hospitalização.En este estudio se tuvo como objetivo comprender el significado que tiene para un niño pre-escolar, estar hospitalizado. Los referenciales teóricos fueron el Interaccionismo Simbólico y la teoría de Vygotsky sobre el juego simbólico del niño y el referencial metodológico fue la Teoría Fundamentada en los Datos. Participaron del mismo 11 niños de tres a seis años de edad. Las estrategias de recolección de datos fueron: observación participante, entrevista con los niños, mediado por el Juguete Terapéutico y entrevista con las madres. El análisis de los datos permitió construir el modelo teórico Creciendo con la presencia protectora de la madre, que evidencia la vulnerabilidad, la fuerza del niño y la protección recibida de la madre, para enfrentar el misterio y el terror de la hospitalización.This study was aimed at comprehending the meaning of being hospitalized for pre-school children. The theoretical references were the Symbolic Interactionism and Vygotsky's theory on the child's symbolic play. The methodological referential was the Theory Based on Data. Eleven children between the ages of 3 and 6 took part in the survey. The strategies for data collection were

  8. Pistillate Flower Abcission Symptoms of ‘Serr’ Walnut (Juglans RegiaL. Sintomatología del Aborto en flores Pistiladas de Nogal (Juglans regiaL. ‘Serr’

    Directory of Open Access Journals (Sweden)

    Cristián González R

    2008-06-01

    observación en microscopio óptico, utilizando como tinción azul de toluidina-O al 0,05%. La flor abortada por exceso de polen se deterioró rápidamente, presentó detención del crecimiento, pérdida del brillo del involucro y stigmatic necrosis. La flor abortada por falta de polinización mostró un deterioro lento que se prolongó dos semanas más que la abortada por exceso de polen. La flor cuajada siguió creciendo, sin perder su brillo. La flor abortada por exceso de polen puede caer con o sin pedúnculo adherido. Se pueden presentar dos zonas de separación: zona distal y zona proximal del pedúnculo. La cicatriz en el pedúnculo permite diferenciar el aborto por exceso de polen, falta de polen y por otras razones.

  9. La vegetación como indicador de la Geomorfología Fluvial

    Directory of Open Access Journals (Sweden)

    Juan José Neiff

    2005-11-01

    Full Text Available Aguas abajo de la confluencia con el río Paraguay, el Paraná se expande en una ancha planicie lateral que, durante las inundaciones extraordinarias completa un área 2-10 veces mayor que el área ocupada por las aguas en los períodos de bajantes extraordinarias, en los que el curso queda aislado de la planicie inundable. El propósito de esta contribución es presentar las características más salientes de este tramo entrelazado del río, usando las unidades de paisaje y los tipos de vegetación, como indicadores de las formas del relieve. Imágenes satelitales Landsat TM5 y TM7 procesadas con el SIG IDRISI, de la inundación extrema de 1998 y de la sequía extrema de 2001, fueron usadas para la clasificación de los tipos de vegetación, usando el criterio propuesto por CET (Clasificación Ecológica de Tierras. Observaciones de campo fueron realizadas en ambas fases hidrológicas para obtener la posición topográfica de las unidades de vegetación y de los ensambles de comunidades vegetales. Nosotros encontramos que los albardones están ocupados por tipos de bosques, mientras que los bañados y cuerpos de aguas someros están cubiertos por plantas herbáceas y que las praderas flotantes de vegetación flotante libre, como el aguapé, crecen en lagos conectados al río una o más veces en el año. La vegetación acuática del curso principal es muy pobre como consecuencia del flujo del río y las fluctuaciones de nivel del agua. Sólo pequeñas manchas de carrizo se encontraron creciendo en barras de arena. La interrelación entre la vegetación y las formas del relieve es muy dinámica, con cambios drásticos en períodos de décadas o aún de pocos años, dependiendo del caudal y de la carga de sólidos transportados. En otro sentido, la vegetación fluvial tiene un importante rol en la fijación de depósitos fluviales y como núcleos de acreción en las barras o para entender la obstrucción de pequeños cursos de agua en la planicie

  10. El transporte urbano entre la globalización y la fragmentación: El caso de la Región Metropolitana de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Susana Kralich

    1998-03-01

    Full Text Available Con la consolidación del capitalismo avanzado se deslocalizan las cadenas productivas, a la par que se internacionalizan los oligopolios del capital. Ellos florecen en el mundo subdesarrollado estimulados por la suburbanización, las políticas de ajuste, la flexibilización laboral, el desempleo, la privatización y desregulación de los servicios públicos, la hegemonía de las leyes de mercado y la gradual desaparición de la concepción keynesiana del Estado, exacerbándose la segregación y la exclusión y creciendo la violencia urbana hasta límites impensados. La concentración demográfica intensifica y complejiza las demandas, en especial las de transporte, complicándose la gestión de los servicios y dificultándose la compatibilización de intereses contradictorios. Puja en la cual indefectiblemente se ven perjudicadas las crecientes franjas de menores recursos, profundizándose las inequidades propias del modelo, cuyo resultado son ciudades cada vez más dualizadas. En este marco, la gestión de servicios urbanos requiere ser repensada y rediseñada, particularmente en las grandes aglomeraciones, ya que aparece cada vez como más acuciante la resolución de la pluralidad y superposición de administraciones que funcionan fragmentadas, dispersando la responsabilidad sobre los problemas integrales a afrontar. Tal el caso de la Región Metropolitana de Buenos Aires (RMBA, a la que nos referiremos enfocando la cuestión relativa a la gestión del transporte urbanoWith the consolidation of the advanced capitalism, the productive chains are dislocalizated, as well as the internacionalization of the capital oligopolies. They blossom in the underdeveloped world, stimulated by the suburbanization, the adjustment policies, the occupational flexibilization, the unemployment, the privatization and the desregulation of the public services, the hegemony of the market laws and the gradual disappearance of the Welfare State. All items previously

  11. Model Validation for Estimating the Leaf Stomatal Conductance in cv. Cabernet Sauvignon Grapevines Validación de un modelo para estimar la conductancia estomática de hojas en vides cv. Cabernet Sauvignon.

    Directory of Open Access Journals (Sweden)

    Francisco Jara-Rojas

    2009-03-01

    Full Text Available The coupled model of assimilation and stomatal conductance (A-g s was evaluated to estimate leaf stomatal conductance of a drip-irrigated vineyard (Vitis vinifera L. cv. Cabernet Sauvignon located in the Pencahue Valley (35º22’ S, 71°47’ W, 150 m.a.s.l., Maule Region, Chile, during the 2003-2004 and the 2004-2005 growing seasons. Additionally, a calibration of the three parameters mesophyll conductance (g m, maximum specific humidity (Dmax and coupled factor (f0 was applied on vines growing in 35 L pots. An infrared gas analyzer was used to calibrate and evaluate the A-g s which allowed simultaneous measuring of the leaf net CO2 assimilation (A and stomatal conductance (g s in 2 to 3 h intervals of time. The calibration indicated that the g m,, Dmax and f0 values were 1.15 mm s-1, 52.31 g kg-1 and 0.90, respectively. The validation in the drip-irrigated vineyard indicated that the A-g s model was able to estimate the leaf stomatal conductance with a root mean square error (RMSE of 0.05 mol m-2 s-1, model efficiency of 61% and agreement index of 90%. The sensitivity analysis indicated that the A-g s model is affected considerably by the g m, Dmax and f0 parameterization.Validación de un modelo para estimar la conductancia estomática de hojas en vides cv. Cabernet Sauvignon. El modelo acoplado de asimilación neta y conductancia estomática (A-g s fue evaluado para estimar la conductancia estomática de hojas (g s de un viñedo regado por goteo (Vitis vinifera L. cv. Cabernet Sauvignon ubicado en el Valle de Pencahue (35º22’ S; 71º47’ O; 150 m.s.n.m., Región del Maule, Chile, durante las temporadas 2003-2004 y 2004-2005. Además, se realizó una calibración de la conductancia del mesófilo (g m, valor máximo de humedad específica a saturación (Dmax y el factor acoplado (f0 en vides creciendo en maceteros de 35 L. Para calibrar y evaluar el modelo A-g s se utilizó un analizador infrarrojo de gases, el cual permitió medir simult

  12. Análise dos fatores de risco relacionados à incidência de infecção do sítio cirúrgico em gastrocirurgias Análisis de los factores de riesgo relacionados a la incidencia de infección del sitio quirúrgico en gastrocirugías Analysis of risk factors related to the incidence of site infections in gastrosurgeries

    Directory of Open Access Journals (Sweden)

    Vanessa de Brito Poveda

    2003-03-01

    Full Text Available A infecção hospitalar é considerada um problema grave, crescendo tanto em incidência quanto em complexidade, gerando diversos tipos de implicações sociais e econômicas. A presente investigação teve como objetivo identificar a incidência de infecção do sítio cirúrgico (ISC e os fatores de risco de pacientes submetidos a cirurgias eletivas, na especialidade de Gastroenterologia, realizadas em um hospital público do interior paulista. Os dados foram coletados por meio de estudo retrospectivo de prontuários médicos, no período compreendido entre janeiro a dezembro de 1999. Em 134 casos estudados, detectamos a ocorrência de infecção do sítio cirúrgico em 18 situações (13,4%, ocorrendo 9 casos (50% do tipo considerado infecção incisional superficial, 8 (44.4% infecção incisional profunda e 1 (5.5% infecção de órgão/espaço. Em relação aos fatores de risco presentes nos casos de ISC detectados, os que atingiram porcentagem maior ou igual a 50% foram: idade acima de 50 anos, presença de neoplasias, duração da cirurgia maior que duas horas e tricotomia inadequada.La infección hospitalaria es considerada un problema grave, creciendo tanto en incidencia como en complejidad, generando diversos tipos de implicaciones sociales y económicas. La presente investigación tuvo como objetivo identificar la incidencia de infección del sitio quirúrgico en pacientes sometidos a cirugias electivas, en la especialidad de Gastroenterología, realizadas en un hospital público del interior del estado de São Paulo. Los datos fueron recoleccionados por medio de un estudio retrospectivo de los archivos medicos, en el periodo entre enero y diciembre de 1999. En 134 casos estudiados, detectamos la ocurrencia de infección del sitio quirúrgico en 18 situaciones (13.4%, ocurriendo 9 casos (50% del tipo considerado infección incisional superficial, 8 (44.4% infección incisional profunda y 1 (5.5% infección de órgano/espacio. Con

  13. Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps con características probióticas y potencial en la degradación del pasto

    Directory of Open Access Journals (Sweden)

    Cecilia Lara Mantilla

    2013-06-01

    Full Text Available Título corto: Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps  Título en ingles:  Cellulolytic bacteria isolated from  termites’ gut (Nasutitermes nigriceps with probiotic characteristics and potential pasture degradationResumen: El objetivo de la presente investigación fue aislar bacterias celulolíticas del intestino de termitas (Nasutitermes nigriceps para determinar sus propiedades probióticas in vitro y su potencial en la degradación de pasto. Las termitas fueron tratadas con detergente antibacterial, separando y macerando luego, el intestino de las mismas en agua peptonada estéril. Diluciones de esta mezcla fueron inoculadas en cajas Petri con medio Luria Bertani (LB y Carboximetilcelulosa (CMC al 2%, incubando a 37º C por 24 horas, para luego revelar con Rojo Congo al 1%. Las bacterias que presentaron mayores halos de degradación fueron sometidas a tinción de Gram y a pruebas probióticas de temperatura, pH, salinidad y presencia de sales biliares, así como también a pruebas de antagonismo y degradación de pasto. Los resultados revelaron la presencia de 9 bacilos celulolíticos Gram (- de los cuales, los bacilos BTN7 y BTN8, presentaron los mejores halos de degradación, 12 y 14 mm de diámetro respectivamente, creciendo adecuadamente en las diferentes pruebas probióticas con densidades entre 106 y 108 UFC/ml; el porcentaje de degradación de materia seca fue de 39.73% y 36.10% en 48 y 72 horas respectivamente.  Las pruebas bioquímicas API E (bioMérieux SA revelaron que los bacilos BTN7 y BTN8 pertenecen al género Enterobacter sp. Los anteriores resultados abren la posibilidad de emplear, estos microorganismos como aditivos en la alimentación de rumiantes, a fin de contribuir con un mayor aprovechamiento de pastos, y otros sustratos vegetales lignocelulósicos.Palabras claves: Probióticos, Maralfalfa (Pennisetum sp., microorganismos ruminales, lignocelulosa, Enterobacter

  14. Evaluación y modelización hidrológica para el diagnóstico de “desastres naturales”

    Directory of Open Access Journals (Sweden)

    Pla Sentís Ildefonso

    2012-05-01

    Full Text Available La degradación de suelos afecta negativamente sus funciones como base de la producción de alimentos, de la regulación del ciclo hidrológico y de la calidad ambiental. Está creciendo en todo el mundo, en parte debido a faltas o deficiencias en las evaluaciones de los procesos y causas de dicha degradación en cada situación específica. Los procesos de degradación física de suelos se manifiestan a través de problemas de compactación, sellado, encostrado, escorrentía, erosión hídrica y eólica, movimientos en masa, etc., con efectos colaterales "in situ" y a distancia, a menudo con consecuencias desastrosas como inundaciones, deslizamientos de tierra, sedimentaciones, sequías, etc. Estos procesos están frecuentemente asociados a cambios desfavorables en los procesos hidrológicos responsables del balance de agua y régimen hídrico de los suelos, derivados principalmente de cambios en el uso y manejo de las tierras y de cambios climáticos. La evaluación de dichos procesos bajo diferentes escenarios de cambios de clima, propiedades de los suelos y uso y manejo de las tierras con el uso de modelos de simulación sencillos y flexibles, basados en procesos hidrológicos, permitiría predecir su desarrollo, y con ello, la selección y aplicación de prácticas apropiadas de conservación de suelos para eliminar o moderar sus efectos. Estos modelos requieren, como base, información adecuada sobre clima y propiedades hidrológicas de los suelos. A pesar de que existen metodologías y equipos comerciales cada vez más sofisticados y "precisos" para medir las diferentes propiedades físicas e hidrológicas de los suelos relacionados con los procesos de degradación, la mayoría de ellos solo son aplicables bajo condiciones de laboratorio y en suelos y condiciones muy particulares. A menudo se utilizan métodos indirectos, basados en relaciones o índices empíricos sin una adecuada validación, que frecuentemente conducen a costosos

  15. Bosques andinos del sur de Ecuador, clasificación, regeneración y uso

    Directory of Open Access Journals (Sweden)

    Rainer W. Bussmann

    2013-05-01

    Full Text Available Existen muy pocos inventarios y descripciones sintaxonómicas de la vegetación de bosques montanos tropicales. Este trabajo presenta datos sobre los bosques del sur de Ecuador localizados en la Reserva Biológica San Francisco, límite norte del Parque Nacional Podocarpus. Se propone la siguiente clasificación junto con notas sobre los factores edáficos que contribuyen a su establecimiento. El «Bosque Montano Bajo» (1800-2150 m, formando el orden Alzateetalia verticillatae, muestra 2-3 estratos arbóreos muy diversos, con árboles de 20-35 m de altura, y es una clímax mosaico típico. Creciendo sobre Terric Haplosaprists y Aquic Dystrupepts, originado del material de derrumbes viejos, este tipo de bosque se extiende hasta los 2300 m sobre el nivel del mar en quebradas protegidas de viento. A altitudes de 2100-2650 m (menos de 2750 m la estructura del bosque y la composición florística cambia totalmente. Esta vegetación, el «Bosque Montano Alto» forma el orden de Purdiaeaetalia nutantis y crece sobre Histic Petraquepts. Representando una vegetación monotípica con un solo estrato arbóreo de 5-10 m (–15 m de altura, completamente dominado por Purdiaea nutans (Cyrillaceae. El bosque ubicado a mayor altitud en el área, densamente enlazado con el páramo es el «Bosque Nublado Subalpino». Descritos como Clusio ellipticae-Weinmannietum cochensis aparecen más como una vegetación arbustiva casi impenetrable, y crecen sobre Humaquic Epiaquents. El límite del bosque es causado principalmente por los vientos fuertes de la región. Derrumbes e incendios naturales representan el «motor» de regeneración de los bosques. Se encontró carbón en la base de los niveles A de muchos perfiles de suelo. El análisis 14C precisó una edad de 710-980 ±50 años antes del presente. Esto indica que fuegos en la vegetación han contribuido a la dinámica de esta vegetación en el pasado y no es un fenómeno reciente. El diámetro basal de los

  16. SAFESKILL: um serious game para estudantes e profissionais de segurança do trabalho

    Directory of Open Access Journals (Sweden)

    Eliton Elói Brandão de Freitas

    2018-06-01

    Full Text Available A discussão em torno dos jogos digitais vem crescendo nos últimos vinte anos, especialmente no que se refere à mediação destes artefatos culturais em distintos espaços de aprendizagem, inclusive os voltados para formação e qualificação profissional.  Considerando essa possibilidade, surgiu o interesse por um estudo que subsidiasse o desenvolvimento de um Documento de Game Design (GDD para um serious game, denominado SafeSkill e que contribuísse para a formação e requalificação de técnicos e engenheiros de segurança do trabalho, tendo como foco a aplicação da Norma Regulamentadora nº 18. O presente artigo apresenta os resultados desse estudo e suas contribuições para desenvolver habilidades que promovam a segurança no trabalho com situações de risco, identificando, avaliando, controlando e evitando a ocorrência de acidentes.   PALAVRAS-CHAVE: Serious games; Game design; Segurança do trabalho; Construção Civil.     ABSTRACT Discussions on digital games have been on the rise for the last twenty years, especially in terms of the mediation of such cultural artifacts in distinct learning environments, including those focused on both professional qualification and background. In light of this, there has been interest in subsidizing the development of a Game Design Document (GDD for a serious game, named SafeSkill, which could contribute to requalify and train workplace safety technicians and engineers, through the application of Brazilian regulatory standard #18. This paper aims at presenting related results and their usefulness in developing skills that can promote safety in labor risky scenarios, such as accident identification, assessment, control and prevention.   KEYWORDS: Serious games; Game design; Workplace safety; Construction.     RESUMEN La discusión en torno a los juegos digitales viene creciendo en los últimos veinte años, especialmente en lo que se refiere a la mediación de estos artefactos

  17. Profile of scientific and technological production in nursing education research groups in the south of Brazil Perfil de la producción científica y tecnológica de los grupos de investigación en educación en enfermería de la región Sur de Brasil Perfil da produção científica e tecnológica dos grupos de pesquisa em educação em enfermagem da Região Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Mônica Motta Lino

    2010-06-01

    Full Text Available This research aimed to present the profile of production of Nursing Education Research Groups’ (NERG scientific and technological production in the South of Brazil. This documentary, quantitative, exploratory-descriptive retrospective research was guided by the active search for products in the Lattes curriculum of previously selected NERG researchers, based on the 2006 Census of the Research Group Directory/CNPq, between 1995 and 2008. The results indicated that the 18 NERG from southern Brazil produced 453 papers in proceedings, 371 book chapters, 206 books, 1,437 scientific articles and 08 technological products, but no patent was registered. NERG’s scientific production in the research region has grown progressively over the past 14 years. To strengthen this structure, the establishment of collaborative networks can be used as a strategy, so that political-scientific joint actions in the sector can advance science and technology.El objetivo del estudio fue presentar el perfil de la producción científica y tecnológica de los Grupos de Investigación en Educación en Enfermería (GIEE de la región sur de Brasil. Se trata de una investigación documental, cuantitativa, exploratoria-descriptiva retrospectiva, guiada por la búsqueda activa de las producciones, en el Currículo Lattes, de los investigadores de los GIEE, preseleccionados a partir del Censo-2006 del Directorio de Grupos/CNPq, en el período de 1995-2008. Los resultados indicaron que los 18 GIEE del sur de Brasil produjeron 453 trabajos en anales, 371 capítulos de libros, 206 libros, 1437 artículos científicos y 8 productos tecnológicos, sin embargo, ninguna patente registrada. La producción científica de los GIEE de la Región investigada viene creciendo, progresivamente, en los últimos 14 años. Para que esa estructura sea fortalecida, se puede utilizar como estrategia la formación de redes colaborativas que viabilicen articulaciones político-científicas en el

  18. Premio Nacional de Epilepsia “Margaret Merz de Fandiño”.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    2009-07-01

    Full Text Available

    Este premio, creado con el objetivo de reconocer a los investigadores colombianos comprometidos en el estudio de lo relacionado con las ciencias epileptológicas, es también una manera de estimular al talento humano estudioso y dedicado a aportar su óptimo esfuerzo intelectual para alivio de un padecimiento que afecta directamente a una numerosa población de compatriotas y con ellos impacta a ocho millones de colombianos si contamos la influencia que sobre las familias ejerce esta patología, identificada en 800 mil personas.

    El Premio, aprobado hace dos años en la Asamblea de socios activos de la Liga Colombiana contra la Epilepsia, es una vez más fruto del esfuerzo y tenacidad del Académico Jaime Fandiño Franky, eminente científico de las neurociencias y apóstol de una de las causas que inciden en la situación de los más necesitados en Colombia.

    La labor iniciada por Fandiño Franky hace ya cuatro décadas en la ciudad de Cartagena, con el ánimo de diagnosticar, investigar, tratar, hacer seguimiento y rehabilitación de las víctimas y su entorno familiar, ha llevado a la más ambiciosa realización científica, docente y asistencial, con el montaje primero de una infraestructura física plasmada en un centro de 13.000 metros cuadrados para enfrentar este problema de salud pública, bastante relegado tradicionalmente, pero merecedor por sus proporciones, de una consideración y manejo especiales, que de no prodigarlos el estamento oficial, lo afronta una organización altruista y generosa con Fandiño Franky y Margaret Merz, su esposa, a la cabeza.

    Con el tiempo su organización fue creciendo no sólo física sino cualitativamente con el empleo de las más modernas tecnologías para diagnóstico y tratamiento hasta convertirse en un centro piloto orgullo de Colombia y pionero en Latinoamérica del manejo integral, iniciado con la identificación del paciente y culminado con la rehabilitaci

  19. Diagnóstico teológico a los 50 años del Vaticano II (Theological Diagnosis 50 years after Vatican II - DOI: 10.5752/P.2175-5841.2011v9n24p1368

    Directory of Open Access Journals (Sweden)

    José Maria Vigil

    2012-01-01

    Full Text Available Resumen:Partiendo de la idea de que el Vaticano II quiso ser un diálogo con la modernidad, el autor comienza señalado (el «ver» en la medotología latinoamericana los grandes cambios de paradigma que se han sucedido en estos 50 años posteriores al Concilio: la revolución de la posmodernidad, el despertar de la conciencia política y la irrupción de la teología de la liberación, la nueva conciencia pluralista, el descubrimiento de la ecología profunda, la crisis de las «religiones agrarias» en un mundo que parece querer entrar en un mundo «post-religioso», y la transformación de la epistemología religiosa tradicional. En un segundo momento («juzgar» analiza lo que sucedió con el Vaticano II y el posconcilio: las transformaciones que propuso, la oposición que fue creciendo apoyándose en el propio poder jerárquico institucional, y el impase de la actual falta de diálogo. En una tercera parte («actuar» el autor propone unas pistas interpretativas como la mejor forma de aportar a una situación eclesial actual que parece no tener salida.Palabras clave: Diagnóstico teológico. Vaticano II. Concilio. Iglesia. Futuro. Cambio de ParadigmaAbstract:Starting from the idea that Vatican II wanted to stablish a dialogue with the modernity, the author starts pointing out (the «see», in the Latin American methodology the big changes of paradigm which have taken place in these last 50 years after the Council: the revolution of pos-modernity, the waking up of the politic conscienceand the irruption of the theology of Liberation, the new conscience of cultural and religious pluralism, the discovery of the depp ecology, the crisis of the «agrarian religions» in a world which seems to want enter into e post-religious world, and the transformation of the traditional religious epistemology.        In a second moment («judge» analizes what happened in the Vatican II and the pos-council: the transformations it proposed, the growing

  20. LAS INCUBADORAS UNIVERSITARIAS DE ECONOMÍA SOLIDARIA EN BRASIL - UN ESTUDIO DE CASOS / THE UNIVERSITY INCUBATORS OF SOLIDARITY ECONOMY IN BRAZIL – A CASE STUDY

    Directory of Open Access Journals (Sweden)

    Ioshiaqui SHIMBO

    2011-09-01

    Full Text Available La Economía Solidaria es un término que designa un movimiento social que viene creciendo en Brasil durante los últimos 15 años e incluye un gran conjunto de actores socioeconómicos. En él se generan alternativas de inserción productiva para colectivos socialmente desfavorecidos, pero sus objetivos no son solamente los cambios económicos, sino la promoción de cambios socioculturales hacia una sociedad más igualitaria y solidaria. Para apoyar y fortalecer la economía solidaria se crearon desde algunas universidades brasileñas las Incubadoras de Cooperativas Populares. En el presente estudio se analiza la trayectoria de la Incubadora Regional de Cooperativas Populares de la Universidad Federal de São Carlos, situada en el Estado de São Paulo (Brasil, como estructura que conjuga la investigación, la docencia y la extensión universitaria dirigidas hacia los procesos de incubación de emprendimientos solidarios. Aplicando el estudio de casos se sistematizan los avances conceptuales y metodológicos que se relacionan con las dificultades encontradas por estos emprendimientos para su consolidación y la creación de redes de iniciativas económicas solidarias en el territorio estudiado. El examen de este proceso ayudó a identificar y discutir estrategias para el progreso de los argumentos conceptuales, de la metodología de asesoramiento y para la aplicación a otras iniciativas similares. / The Solidarity Economy is a social movement who is growing up in the last 15 years in Brazil and it includes a very big group of socioeconomic actors. This movement improves alternatives of productive insertion to disadvantage groups of population. However its objectives are not only the economic changes, but the promotion of social and cultural changes toward a more equal and solidarity society. To support and strengthen the solidarity economy, the Popular Cooperatives Incubators had been created in some Brazilian Universities. In this study we

  1. Técnica de mineração de dados: uma revisão da literatura Técnica de mineración de datos: una revisión de la literatura Data mining: a literature review

    Directory of Open Access Journals (Sweden)

    Noemi Dreyer Galvão

    2009-10-01

    Full Text Available Este artigo teve como objetivo realizar uma revisão da literatura sobre a técnica de mineração de dados (Data Mining - DM nas bases de dados abrangendo o Literatura Latino-Americana e do Caribe em Ciências da Saúde (LILACS, Scientific Eletronic Library Online (SCIELO e alguns livros sobre o tema. Buscou-se uma coleta ampla utilizando as palavras data mining e mineração de dados, abrangendo o período de 1999 a 2008. Como critérios de exclusão foram utilizados os descritores: indústria mineira, minas, mineralogia; foram excluídos artigos que não esclareciam o método e as tarefas relacionadas à mineração de dados. Dos 123 artigos encontrados, 32 foram selecionados. Observou-se que o volume de dados armazenados é gigantesco e continua crescendo exponencialmente. Com isso o processo de Descoberta do Conhecimento em Bases de Dados e DM inclui tarefas e métodos para extração de conhecimento útil, interessante e indispensável na tomada de decisões rápidas nas mais diversas áreas de conhecimento.En este artículo se tuvo como objetivo realizar una revisión de la literatura sobre la técnica de mineración de datos (Data Mining - DM en las bases de datos que abarcaban la Literatura Latino-Americana y del Caribe en Ciencias de la Salud (LILACS, Scientific Eletronic Library Online (SCIELO y algunos libros sobre el tema. Se buscó una recolección amplia utilizando las palabras data mining y mineración de datos, en el período comprendido entre 1999 a 2008. Como criterios de exclusión fueron utilizados los descriptores: industria minera, minas, mineralogía; se excluyeron artículos que no aclaraban el método y las tareas relacionadas a la mineración de dados. De los 123 artículos encontrados, 32 fueron seleccionados. Se observó que el volumen de datos almacenados es gigantesco y continúa creciendo exponencialmente. Con eso el proceso de Descubrimiento del Conocimiento en Bases de Datos y DM incluye tareas y métodos para

  2. Demografía de Caulerpa paspaloides var. Wudermannii (Bryopsidales: Caulerpaceae en la zona costera de Campeche, México

    Directory of Open Access Journals (Sweden)

    Sergio Armando Fuentes

    2014-08-01

    Full Text Available La vegetación subacuática de Los Petenes, Campeche, México, se destaca por su gran diversidad florística, compuesto por una gran variedad de pastos marinos y varias especies del género Caulerpa sp. Caulerpa es un género de relevancia ecológica, con especies como la Caulerpa taxifolia, que es invasiva en el Mediterráneo, con un impacto negativo en varias plantas sub-acuáticas nativas, pero poco se sabe acerca de la demografía y la dinámica poblacional de las especies de Caulerpa y su contribución a las redes alimenticias. El objetivo general es conocer la demografía de Caulerpa sp., por medio del número de estolones, frondas completas e incompletas, el diámetro de los estolones y la biomasa. El estudio se realizó en la Reserva de la Biosfera de Los Petenes, en Campeche, México. La Vegetación Acuática Sumergida (VAS en la Biosfera de los Petenes está constituida por poblaciones tanto monoespecíficas como mixtas de las especies de pastos marinos Thalassia testudinum, Halodule wrightii y Syringodium filiforme. Aunque las especies de algas clorófitas, feofitas y rodófitas son elementos fundamentales de la VAS, destacan por su cobertura y abundancia las especies de Caulerpa. En mayo y junio del 2010, hubo diferencias significativas de la cantidad de estolones, su diámetro, frondas completas e incompletas y el tamaño de los estolones como el de los ejes erectos. En el 2010 el valor de la tasa finita de crecimiento poblacional (l fue de 2.38±0.15 con el método de las marcas y con el de la biomasa 1.20±0.13 y en el 2011 los valores fueron de 1.80±0.36 con las marcas y de 1.35±0.15 con la biomasa. Los resultados indican que la población está creciendo, pero es controlada por factores bióticos y abióticos. A pesar de que no se detecta la especie como una amenaza aparente, sugerimos que se continúen estos estudios demográficos sobre C. paspaloides var. wurdemannii e incluso de otras especies del mismo género. No solo

  3. Estimación de impacto paisajístico de las carreteras

    Directory of Open Access Journals (Sweden)

    Cañas Guerrero, Igancio

    1993-08-01

    Full Text Available Perhaps one of the most important ways in which public opinion knows the landscape is through roads. The 325,000 km of roads in Spain are of great importance since they are used by 16.5 million vehicles. It seems that this importance will continue to grow in the years to come. This process goes together with the increasing sensitivity of the population where environmental issues are concerned. For this reason we constantly face confrontations between the development and the nature preservation. We believe it possible to reduce these conflicts by identifying the most problematic areas and the possible solutions in the initial stages of planning and design. In the road - landscape relation the importance of landscape studies is obvious since one of the aspects the public opinion values most directly is the integration of the road in the landscape. The aim of this paper is precisely to identify the principal stages in the analysis of the landscape issue in road projects. This is not a thorough description but a comment of various steps to be taken in the estimation of the impact on landscape which can serve as the starting point to be developed further in different projects.

    Quizá uno de ¡os medios más importantes por los cuales la opinión pública conoce el paisaje sea a través de la carretera. En España tenemos más de 325.000 km de carreteras que son utilizadas por 16,5 millones de vehículos, su interés es pues grande. Esta importancia parece que en los próximos años seguirá creciendo. Este proceso va unido a una sensibilidad cada vez mayor por parte de la población con los temas medioambientales. Esto da lugar a que nos encontremos con enfrentamientos crecientes entre el desarrollo y la conservación de la naturaleza. Estos conflictos pensamos que pueden reducirse, si ya en las primeras etapas de la planificación y diseño se identifican las áreas más problemáticas y sus posibles soluciones. Dentro de la relaci

  4. Ecoanatomía foliar deárboles y arbustos delos distritos chaqueños occidental y serrano (Argentina Leaf ecoanatomy of trees and shrubs from Chacoan Occidental and Serrano Districts (Argentina

    Directory of Open Access Journals (Sweden)

    Ana M Arambarri

    2011-12-01

    Full Text Available El objetivo de este trabajo fue evaluar parámetros micrográficos foliares que permitan comprender mejor la relación planta-ambiente y contribuyan al desarrollo de nuevas tecnologías para el aprovechamiento sustentable y conservación de los bosques de esta región. Se empleó material de hoja de ejemplares recolectados en la región subtropical seca de la provincia chaqueña y material fresco de especies creciendo en zona templado-húmeda para comparar las variaciones de la estructura foliar. Se determinaron densidades por mm-2 de células epidérmicas, estomas y tricomas, tipos de mesofilo y tipo y distribución de los tejidos vascular y de sostén. Se encontró que estos caracteres anatómicos de la hoja son influenciados por una combinación de factores intraespecíficos y del ambiente. Los caracteres xeromórficos puestos de manifiesto fueron: presencia de ceras epicuticulares, estrías cuticulares, estomas hundidos con reborde peristomático, de epidermis bistrata o pluristrata y/o de hipodermis, mesofilo en empalizada o isolateral y abundante esclerénquima. Algunas especies tales como: Celtis ehrenbergiana, C. iguanaea, Jodina rhombifolia, Lycium cestroides y Parkinsonia aculeata, muestran desde caracteres xeromórficos (e.g. hojas anfistomáticas, equifaciales hasta caracteres mesomórficos (e.g. hojas hipostomáticas, bifaciales incluyendo algunos hidromórficos como la ausencia de esclerénquima.The objective of this work was to evaluate foliar micrographic parameters to deepen our understanding of the plant-environment relationships, contributing to new technologies to preserve the forests of this area. Leaf material of specimens collected in chacoan biogeographic province with subtropical and dry climatic conditions, and from species growing in template and humid conditions were studied to compare leaf structure variations. Epidermal cells, stomata and trichomes by unit of area (mm-2, types of mesophyll, sclerenchymatic tissue

  5. Structuring of the Açai Pulp Exporting Agribusiness’ Organizational FieldEstruturação do Campo Organizacional das Agroindústrias Exportadoras de Polpa de AçaíEstructuración del Campo Organizacional de las Agroindustrias Exportadoras de Pulpa de Açaí

    Directory of Open Access Journals (Sweden)

    SOUSA, José Welington

    2013-06-01

    , que facilitam o fluxo de informações entre as empresas.RESUMENEste artículo aborda la estructuración del campo de las agroindustrias exportadoras de la pulpa de açaí. Se trata de una industria que está creciendo desde pequeñas unidades artesanales de procesamiento hacia fábricas que incorporan tecnologías de producto, proceso y gestión, que operan en el mercado nacional e internacional. El estudio tiene como referencial analítico la teoría institucional para el estudio de las organizaciones. Es un estudio de tipo exploratorio y descriptivo con enfoque cualitativo, complementado con una entrevista semiestructurada en dos empresas localizadas en el municipio de Castanhal-PA, elegidas por sus trayectorias y por el volumen de las informaciones facilitadas. Los resultados indican que se está estructurando un campo organizacional de las agroindustrias exportadoras de açaí en proceso de isomorfismo. Finalmente, el estudio sostiene que las fuentes de isomorfismo son las agencias reguladoras, clientes, profesionales contratados y el sindicato de las empresas agroindustriales, los que facilitan el flujo de informaciones entre las empresas.

  6. Biomass partitioning and leaf area of Pinus radiata trees subjected to silvopastoral and conventional forestry in the VI region, Chile Distribución de biomasa y área foliar en árboles de Pinus radiata sometidos a manejo silvopastoral y convencional en la VI región, Chile

    Directory of Open Access Journals (Sweden)

    ROLANDO RODRÍGUEZ

    2003-09-01

    Full Text Available The effects of silvicultural regimes on leaf area and biomass distribution were analyzed in 16-year old Pinus radiata trees growing in the semiarid zone of Chile. Three stands with different silvopastoral management were compared with a conventionally managed stand. Data were obtained through destructive sampling of 36 trees and analyzed by MANOVA and regression models of ANCOVA. Results show that the management regime affects the leaf area. Specific leaf area was affected by both silvicultural regime and crown position. Total biomass per tree under the silvopastoral regime was 2.1 to 2.5 times larger than in the conventional forestry regime. However, aboveground biomass partitioning was neither affected by the silvicultural regime nor by the schemes of silvopastoral management. The most important allometric change was in fine root biomass, which was greater under the conventional forestry regime than in the silvopastoral one. Fine root biomass increases with a regular distribution of the plants in the field, and decreases with the clumping of trees. Similarly, the fine root biomass decreases with fertilization. Both plantation design and fertilization regimes explain the changes in the fine root biomass to components of the crown. However, crown structure influences the magnitude of these changes.Se analizaron los efectos del régimen silvícola en el área foliar y distribución de biomasa en árboles de Pinus radiata de 16 años, creciendo en la zona semiárida de Chile. Para ello se compararon tres rodales con manejo silvopastoral con uno manejado en forma tradicional. Los datos se obtuvieron mediante muestreo destructivo de 36 árboles y se analizaron mediante MANOVA y regresión en modelos de ANCOVA. Los resultados permiten concluir que el régimen de manejo afectó el área foliar. El área foliar específica fue afectada por el régimen silvícola y su posición en la copa. La biomasa total por árbol con régimen silvopastoral es 2,1 a

  7. Desenvolvimento de instrumento de coleta de dados de enfermagem para pacientes com câncer de pulmão em quimioterapia ambulatorial Desarrollo de instrumento de recogida de datos de enfermería para pacientes con cáncer de pulmón en quimioterapia ambulatoria Developing a nursing data colleting instrument to patients with lung cancer treated by chemotherapy in ambulatory

    Directory of Open Access Journals (Sweden)

    Anita Moda Salvadori

    2008-03-01

    Full Text Available O câncer é um grave problema de saúde pública, e, dentre suas variedades, há o câncer de pulmão, que vem crescendo na população brasileira e mundial. A principal causa do câncer de pulmão é o tabagismo. Há três formas de tratamento: cirurgia, radioterapia e quimioterapia; para essa patologia a mais utilizada é a terceira. A enfermeira deve estar apta a lidar com as dificuldades desses pacientes, que durante o tratamento ambulatorial manifestam em seus domicílios efeitos colaterais. Os objetivos desta pesquisa são elaborar um instrumento de coleta de dados para pacientes com câncer de pulmão em quimioterapia ambulatorial e avaliar a validade de seus conteúdos e sua confiabilidade. Teve como guia a teoria do autocuidado de Dorothea Orem. Para sua validação, o instrumento foi primeiramente avaliado por juízes; após isso, foram realizados o pré-teste e o teste de confiabilidade pelo método da equivalência entre observadores. O instrumento se demonstrou confiável, considerando aquilo que se pretendia medir.El cáncer es un grave problema de salud pública y entre sus variedades existe el cáncer de pulmón, que está creciendo en la población brasileña y mundial. La principal causa de cáncer de pulmón es el tabaquismo. Existen tres formas de tratamiento, quirúrgica, por radioterapia y quimioterapia, siendo que para esta patología la más utilizada es la tercera. La enfermera debe estar habilitada para manejar dificultades de los usuarios que ante el tratamiento ambulatorio visiblemente pozo a su domicilio lado efectos. Los objetivos de esta investigación son elaborar un aparato desde colecta de datos para pacientes con cáncer de pulmón en quimioterapia en ambulatorio y evaluar la validad de sus contenidos y su confiabilidad. Tuvo como guía la teoría utilizada del auto-cuidado de Dorothea Orem.Para que sea comprobada la validez de dicho instrumento primeramente este fue evaluado por jueces, luego fue realizado un

  8. Tendencias de la mortalidad por cáncer de mama en México, 1980-2009 Breast cancer mortality trends in Mexico, 1980-2009

    Directory of Open Access Journals (Sweden)

    Elvia de la Vara-Salazar

    2011-10-01

    Full Text Available El cáncer de mama ha trascendido como un importante riesgo para la salud de las mujeres a escala mundial. Las muertes por cáncer de mama han tenido un destacado incremento dentro de los tumores malignos a nivel mundial al cobrar más de 460 000 vidas en 2008, convirtiéndolo en el padecimiento con más decesos alrededor del mundo.Los cambios demográficos y en estilos de vida han modificado la exposición de la población al riesgo de enfermedades como el cáncer,y desde 1980la mortalidad porcáncerdemama ha mantenido una tendencia ascendente,ubicándose por encima de las muertes por cáncer cervicouterino desde 2006. Al analizar las tasas de mortalidad en las mujeres mexicanas de 25 años de edad en adelante a lo largo de 30 años, se distinguen diferencias estatales y por grupos de edad. Aun cuando el perfil de esta causa de muerte se ha asociado con un mayor desarrollo regional, en este trabajo se puede observar que están ocurriendo cambios y las muertes también están creciendo en la población de mujeres de regiones y entidades menos desarrolladas.Queda de manifiesto el reto que México enfrenta, y la necesidad de conjuntar esfuerzos e implementar programas para educar a la población hacia el autocuidado de la salud, así como promover estilos de vida saludables, además de mejorar la infraestructura diagnóstica para lograr una detección a tiempo y garantizar un tratamiento adecuado.Breast cancer has become an important health risk for women worldwide.The important growth of breast cancer-related deaths within those caused by malign tumors throughout the globe went past the 460 000 in 2008,becoming the deadliest disease worldwide.Demographic changes and lifestyles have modified the population exposure to risk factors of maladies such as cancer, and since 1980 breast cancer mortality has remained on an upward tendency,surpassing cervical cancer in 2006. After analyzing mortality rates along 30 years in Mexican women 25 or more years

  9. Cambios anatómicos y morfológicos en plántulas de Eucalyptus sp. en respuesta a diferentes niveles de luz Anatomical and morphological changes in Eucalyptus sp. seedlings in response to different levels of light

    Directory of Open Access Journals (Sweden)

    Ana B. Guarnaschelli

    2009-12-01

    Full Text Available Se evaluaron respuestas en la anatomía y morfología de plántulas de Eucalyptus globulus subesp. globulus, Eucalyptus grandis y Eucalyptus camaldulensis creciendo bajo diferentes niveles de luz. Las plantas fueron expuestas a tres regímenes de iluminación: pleno sol (C, 50 % (S50 y 75% de restricción lumínica (S75 y regadas diariamente. Se midieron características morfológicas y anatómicas del follaje, se calcularon coeficientes foliares e índices de plasticidad. Al disminuir la disponibilidad lumínica, las plantas mostraron cambios asociados a la aclimatación a la sombra. Se observaron aumentos en el área foliar y en los coeficientes foliares. Paralelamente se detectaron disminuciones en el espesor de las hojas, de la epidermis, del parénquima en empalizada y en la densidad de estomas. La biomasa foliar y la biomasa total diminuyeron significativamente bajo el nivel S75. El aumento en el nivel de restricción lumínica produjo cambios proporcionales en el espesor de hojas y en el coeficiente de área foliar. Independientemente del nivel de sombra, se detectaron diferencias entre especies, que podrían asociarse a las condiciones ambientales de sus áreas de origen. Si bien se observaron algunas diferencias en los índices de plasticidad, los valores promedio de las tres especies fueron similares. Esto sugiere que, para los caracteres considerados en este estudio, el grado de aclimatación a la sombra fue similar.Responses in the anatomy and morphology of Eucalyptus globulus subsp. globulus, Eucalyptus grandis and Eucalyptus camaldulensis seedlings, growing under different levels of light were evaluated. Seedlings were submitted to three levels of irradiance: full sun (C, 50% (S50 and 75% of light restriction (S75 and irrigated daily. Morphological and anatomical characteristics were measured; foliar coefficients and indexes of plasticity were calculated. As light availability diminished, plants showed changes associated with shade

  10. Observaciones ecológicas en la Isla de Salamanca (Depto. del Magdalena, Colombia Observaciones ecológicas en la Isla de Salamanca (Depto. del Magdalena, Colombia

    Directory of Open Access Journals (Sweden)

    Schnetter Marie-Luise

    1969-06-01

    énaga Grande de Santa Marta en el sur. La temperatura promedia anual es de 28° C. El verano dura cinco meses, la cantidad anual de lluvias sube probablemente a los 70 mm. En toda la región los suelos son arenosos. Vastas zonas de la Isla, sobre todo en el oeste, están cubiertas con manglares. En el este, donde se realizaron las investigaciones, las partes más elevadas están cubiertas con monte espinoso, mientras que en terrenos bajos (poco encima del nivel del mar hay tierras salinas desnudas o con vegetación de plantas halófilas, como Batis maritima y Sesuvium portulacastrum. Generalmente la salinidad del suelo es causada por aguas salinas subterráneas. Durante el verano la superficie de la tierra en las zonas desnudas esta cubierta con una costra de sal, mientras que en el verano los contenidos de sal en los estratos superiores son muy bajos. Las concentraciones de sal en áreas cubiertas con plantas halófilas pueden elevarse sobre las de las zonas desnudas, causada probablemente por la absorción de agua por las plantas. Donde el nivel de las aguas subterráneas esta cerca de la superficie de la tierra, hay un contenido alto de agua en todo el año, Al elevarse el nivel de la tierra sobre el nivel del mar, el disminuye. Al fin del verano el suministro de agua en las áreas cubiertas con plantas puede ser peor que en las zonas desnudas, pero en el invierno la cubierta vegetal reduce el desagüe superficial de las aguas de las lluvias.  Donde las aguas subterráneas no llegan hasta la superficie de la tierra, se puede desarrollar el monte espinoso, porque la concentración de sal baja notablemente en los estratos superiores. En el sitio investigado no se encontraron raíces cerca del nivel de las aguas subterráneas.  La mayoría de las especies creciendo en el monte espinoso pierde sus hojas durante el verano. Las especies con hojas fuertes, como Prosopis juliflora y Pithecollobium. spec, tienen un contenido de agua de 70%, aproximadamente. Las hojas suculentas de

  11. Selected Abstracts of the 12th International Workshop on Neonatology; Cagliari (Italy; October 19-22, 2016

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2016-10-01

    . Neroni, P.P. Bassareo, G. Ottonello, M. PudduABS 23. KAWASAKI DISEASE IN SARDINIA: A SINGLE-CENTER EXPERIENCE • M.G. Clemente, G. Taras, P. Omeo, M. Pes, M. Pala, R. Mannazzu, R. AntonucciABS 24. COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT (CAVSD AND DOWN'S SYNDROME (DS: WHEN CARDIAC SURGERY IS NOT CORRECTIVE, BUT PALLIATIVE • D. Congiu, E. Aru, M. Furno, P. Neroni, P.P. Bassareo, S. Floris, M. Puddu, G. OttonelloABS 25. CONGENITAL ATRIOVENTRICULAR BLOCK: A CASE REPORT • F. Ayari, H. Chourou, H. Mannai, M. Cheour, I. Ksibi, M. Ben Amara, S. KacemABS 26. MISDIAGNOSED IDIOPATHIC SEVERE DILATED CARDIOMYOPATHY IN A 3-YEAR-OLD BOY • G. Passarella, S. Rossin, C. Santagati, F. Rigon, V. Rametta, M. Berardi, E. Michelin, C. Lorenzetto, F. Rimondi, F. Marino, S. Innaurato, S. Malengo, M. Leopardi, M.A. Padalino, O. Milanesi, S. RugolottoABS 27. DEVELOPING A TOOL FOR THE MANAGEMENT OF PEDIATRIC EMERGENCIES • G. Piras, G. Iasiello, P. Isoni, S. Marongiu, G. Cuna, A. Anedda, I. PirasABS 28. TRAINING IN NEONATAL INTENSIVE CARE UNITS: A THREE-YEAR INNOVATIVE EXPERIENCE IN NEONATAL INTENSIVE CARE UNITS IN ROME (ITALY • M.G. Torrioli, M.F. Coletti, M. D'Agata, M. Marconi, G. Riccio, C. Rogora, G. Seganti, M. Sergo, F. VallettiABS 29. HEPATIC HEMATOPOIESIS: A COMPLEX STEM CELL NICHE AND A DYNAMIC PROCESS • F. Angotzi, C. Gerosa, F. Lai, P. Van Eyken, Y. Gibo, D. FanniABS 30. INTRAOSSEOUS LINE FOR ADENOSINE ADMINISTRATION IN THE NEWBORN: A CASE REPORT • A. Lai, V. Masile, M. MarrasABS 31. CONGENITAL DACRYOCYSTOCELE: CASE REPORT • A. Culurgioni, F. Carta, A. Olla, E. Gioia, N. Chuchueva, R. PuxedduABS 32. HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS: THE GREAT DECEIVER • F. Lucca, A. Cappelleri, M. Guarnieri, M. Mauro, S. Spaggiari, L. Andaloro, S. Cesaro, P. BibanABS 33. SUBCLAVIAN VEIN CANNULATION IN NEONATES • D. Gaffo, R. Irmesi, N. Zadra, Z. Merchaoui, P. TissieresABS 34. IS "NARRATIVOMICS" AN OMICS SCIENCE? • K.S. McGreevy, G. DonzelliABS 35

  12. Selected Abstracts of the 13th International Workshop on Neonatology; Cagliari (Italy; October 25th-28th, 2017

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2017-10-01

    . A CASE OF NORMOCYTIC ANEMIA IN AN IN­FANT WITH VITAMIN B12 DEFICIENCY • S. Grantaliano, M.G. Pattumelli, M.G. Clemente, C. Locci, R. AntonucciABS 45. THE CHANGING PATTERN OF HEAD INJURY: REPORT OF TWO CASES • V. Del Volgo, M.S. Cosentino, F. Comes, M. Soliani, C. Distefano, L. Bonetti, R. Delmiglio, A.E. Scaramuzza, G. Piccini, L. Bianchini, C. CavalliABS 46. PEMPHIGUS VULGARIS IN CHILDHOOD: A CASE REPORT • A. Manconi, V. Papacciuoli, M.A. Montesu, R. Satta, R. AntonucciABS 47. WHAT ROLE DOES ULTRASONOGRAPHY PLAY IN THE STUDY OF PEDIATRIC CHEST? • M. Marras, G. Vivanet, A. Lai, P.P. Bassareo, D. LongoABS 48. CLINIC-PATHOLOGICAL FEATURES OF PE­DI­ATRIC MYCOSIS FUNGOIDES: TWO CASES DESCRIPTION • L. Pilloni, M. Corbeddu, C. Ferreli, B. Conti, M. Pau, G. Faa, F. RongiolettiABS 49. EXPLORING LIM1 AMONG OLD AND NEW FUNCTIONS • F. Bardanzellu, M.A. Marcialis, M.C. Pintus, V. Fanos, G. FaaABS 50. NEONATAL ATRIAL FLUTTER AND SYN­CHRO­NIZED ELECTRICAL CARDIO­VERSION: YOU CAN DO IT IN NEONATAL INTENSIVE CARE UNIT! • P. Bini, G. Natalè, G. Rulfi, L. Pagani, F. Comolli, A. Castiglione, A. Pagliaro, C.M. Pagliotta, L. Leva, M. BarbariniABS 51. PULSE OXIMETRY SCREENING FOR CON­GENITAL HEART DEFECTS IN THE FIRST 24 HOURS OF LIFE • S. Perrone, D. Palombo, F. Lotti, I. Fontanarosa, P. Vezzosi, G. BuonocoreABS 52. TAKE CARE OF CHILDREN. THE MEDI­TER­RA­NEAN DIET IN THE FIRST 1,000 DAYS OF LIFE. A HEALTHY LIFE. WITH THE CON­TRIBU­TION OF “SARDEGNA RICERCHE” UN­DER THE PROJECT “SCIENTIFIC SCHOOL 2017” • V. Fanos, G. Trapani, R. Pintus, A. Dessì, E. Bertino, A. Noto, P. BaireABS 53. THE EFFICACY OF LOW LEVEL LASER THERAPY FOR THE PREVENTION AND TREATMENT OF CHEMOTHERAPY-CAUSED MUCOSITIS IN PEDIATRIC PATIENTS • S. Puggioni, C. Cuscusa, M. Aprile, C. Pala, C. Spiga, N. Satta, A. Piras, G. DenottiABS 54. ENDOMETRIAL STEM CELLS: ANGELS OR DEVILS? • F. Bardanzellu, M.A. Marcialis, V. Masile, V. Fanos, D. Fanni, C. Gerosa, F. Cau, G. FaaABS 55

  13. Photosynthetic responses to temperature and light of Antarctic and Andean populations of Colobanthus quitensis (Caryophyllaceae Respuestas fotosintéticas a la temperatura y a la luz de poblaciones antarticas y andinas de Colobanthus quitensis (Caryophyllaceae

    Directory of Open Access Journals (Sweden)

    ÁNGELA SIERRA-ALMEIDA

    2007-09-01

    ínsula Antartica. A pesar de que ambos habitats se caracterizan por ser fríos y con temperaturas congelantes, existen importantes diferencias microclimáticas entre estos habitats durante el período de crecimiento. Por ello, sería esperable encontrar importantes diferencias en la respuesta del aparato fotosintético a factores abióticos entre poblaciones antarticas y andinas de C. quitensis. Estudiamos la relación de la fotosíntesis neta con la temperatura foliar y la intensidad lumínica en dos poblaciones de C. quitensis, una proveniente de La Parva en Los Andes de Chile central y la otra de la Isla Rey Jorge, en la Antartica marítima. Plantas de ambas poblaciones fueron crecidas en laboratorio a 15 °C y 250 μmol fotones m-2 s-1, con un fotoperíodo de 16/8 h luz/oscuridad. Veinte plantas de cada población fueron transferidas a una cámara a 4 °C, con las mismas condiciones de luz y fotoperíodo antes mencionadas, de modo de evaluar la capacidad de aclimatación de la fotosíntesis. A 15 °C, las poblaciones presentaron diferencias en su temperatura foliar óptima para la fotosíntesis. Estos óptimos fueron 24,0 °C en individuos provenientes de los Andes y 18,6 °C en individuos de la Antártida. En contraste, los individuos antarticos mostraron la más alta tasa de fotosíntesis neta bajo ambos tratamientos de temperatura, con puntos de compensación y saturación más bajos. Los individuos antarticos tuvieron mayor capacidad fotosintética a menores temperaturas que los individuos andinos. Nuestros resultados sugieren que C. quitensis ha adaptado el desempeño fotosintético de individuos creciendo en diferentes localidades a las condiciones climáticas predominantes en dichas localidades. Las diferencias en las respuestas fotosintéticas a la temperatura y a la luz son discutidas en relación a la diferenciación ecotípica entre las dos poblaciones estudiadas

  14. Gasterópodos asociados al alga calcárea Halimeda opuntia (Udoteaceae en Puerto Rico

    Directory of Open Access Journals (Sweden)

    Cedar I García-Ríos

    2008-12-01

    Full Text Available Se describen y comparan las comunidades de gasterópodos asociados al alga verde calcárea H. opuntia. Se compararon estas comunidades en arrecifes coralinos de lugares geográfica y ambientalmente diferentes, uno en el noreste de Puerto Rico, frente a los vientos alisios (barlovento, el otro en el suroeste (sotavento. Se analizó el contenido de 15 lotes (2432 g de H. opuntia recolectadas en la estación de sotavento y 21 lotes (2448 g en la de barlovento. En los 36 lotes se recuperaron 526 gasterópodos (prosobranquios que se clasificaron en 54 taxones. Trece especies de gasterópodos representaron el 79.6% de la muestra de la comunidad. No encontramos diferencias significativas en las densidades de gasterópodos ni en la riqueza de especies (p>0.100. La densidad promedio fue de 13.9/100 g alga en la estación de sotavento y 7.6/100 g en la de barlovento. Se identificaron 40 especies diferentes en las muestras de sotavento y 31 en las de barlovento. Solamente se encontraron diferencias significativas en los valores de diversidad (Simpson, de 0.91 para la comunidad de sotavento y de 0.82 en la de barlovento (t = 3.44, α = 0.05. No encontramos correlaciσn entre el peso de la muestra del alga y la frecuencia de gasterσpodos en ésta, R² = 0.0893 para sotavento, 0.0249 para barlovento y 0.0923 para datos combinados. Utilizando los métodos de ordenación polar se comprueba la similitud de las dos comunidades estudiadas. Estos resultados sostienen la hipótesis de que H. opuntia le ofrece a los organismos que viven en sus intersticios un microhábitat protegido del impacto del movimiento del agua, creando condiciones más homogéneas que las del hábitat donde encontramos creciendo el alga.Gastropods associated with the calcareous alga Halimeda opuntia (Udoteaceae in Puerto Rico. Gastropod communities associated with the calcareous green alga Halimeda opuntia are described and compared for two Puerto Rico coral reefs: one in the northeast with

  15. Linear Alkylbenzene Sulfonate tolerance in bacteria isolated from sediment of tropical water bodies polluted with detergents

    Directory of Open Access Journals (Sweden)

    I.T Kehinde

    2008-12-01

    ambiente acuático. El tensoactivador persiste en algunos arroyos y ríos de Nigeria, en parte es absorbido por materiales en suspensión y termina entre los sedimentos de los cuerpos de agua receptores. En este estudio, bacterias aisladas de los sedimentos de algunos arroyos tropicales que reciben efluentes contaminados con detergentes, fueron analizadas para determinar su tolerancia a los LAS, utilizando la técnica de dilusión del medio. Las bacterias se consideraron tolerantes a los LAS cuando continuaron creciendo aún en presencia del tensoactivador. En los sedimentos también se determinó acidez (pH, concentración de tensoactivador, poblaciones de bacterias heterotróficas y de bacterias tolerantes a los LAS. Se encontró una relación directa (r= 0.9124 entre condiciones alcalinas (pH= 8.2-12.0 y concentraciones altas de tensoactivador (45-132 mg/g en los sedimentos. Además, los sedimentos mostraron albergar a una población grande y variada de bacterias; las poblaciones de bacterias heterotróficas (vHB: 2.9×10(5 -1.2×10(7 cfu/g y bacterias tolerantes a los LAS (LTB: 1.5×10(4 -1.2×10(6 cfu/g, mostraron una relación directa (r= 0.9500. Por otra parte, una relación inversa se encontró entre cada una de ellas y la concentración de tensoactivador en los sedimentos, r vHB/ LAS = -0.9303 y rLTB/ LAS = -0.9143 respectivamente. Doce especies de bacterias fueron aisladas de los sedimentos: Alcaligenes odorans, Bacillus subtilis, Burkholderia cepacia, Citrobacter freundii, Citrobacter diversus, Escherichia coli, Micrococcus luteus, Micrococcus albus, Pseudomonas putida, Pseudomonas stutzeri, Staphylococcus aureus y Streptococcus faecalis. La mayoría de esas especies muestra adaptaciones al tensoactividor, siempre que éste se encuentre en concentraciones entre 0.03 y 1.0% (w/v. Los sedimentos pueden servir como una fuente de organismos que pueden ser utilizados en el bio-tratamiento de desechos que contengan LAS.

  16. Uso de software libre en las empresas colombianas

    Directory of Open Access Journals (Sweden)

    Carlos Nelson Henrìquez Miranda

    2009-01-01

    Full Text Available ResumenActualmente las empresas usan la tecnología de punta para apoyar sus procesos comerciales, sin embargo en elámbito local podemos darnos cuenta que existen muchas empresas que no tienen conocimiento de la existenciade herramientas informáticas (software que les ayuden en sus labores empresariales. Algunos empresarios pordesconocimiento adquieren aplicaciones de software (propietario que son muy costosas y las cuales usan en unporcentaje muy bajo de sus verdaderas funcionalidades. Entonces hacen una gran inversión que no es redimibleen el futuro porque necesitan demasiadas asesorías y consultorías de estas empresas que comercializan la herramienta.Además si las empresas van creciendo e incluyen nuevas estaciones de trabajo, se necesita comprarmás software, porque este tipo de producto se vende normalmente bajo el término de licencia propietaria. Entoncesencontramos dos situaciones, aquellas empresas que no invierten en software porque es muy costoso, y aquellasque lo hacen pero a la inversión hecha, que a veces es muy alta, no le sacan provecho real por desconocimiento, odebido a una mala asesoría. Ante esta situación hay que buscar nuevas alternativas para lograr que las empresaspequeñas y medianas logren tener en sus manos todas las bondades que trae el uso de la computación (rapidez,eficiencia, organización entre otras. Una opción para este problema es la adopción de programas que no tienencosto o su costo es relativamente bajo, estos programas están enmarcados en el movimiento conocido como “SoftwareLibre”. Este nace como alternativa para uso de productos de una buena calidad a un bajo costo que permitala sistematización parcial o total de las empresas, además de usar programas ofimáticos para el manejo de lainformación de las oficinas.El uso de Software Libre en las empresas colombianas permitirá aumentar sus nivelesde competitividad, bajando un poco la inversión en software y mantenimiento, logrando una

  17. The recent decline of Montastraea annularis (complex coral populations in western Curaçao: a cause for concern?

    Directory of Open Access Journals (Sweden)

    A. W Bruckner

    2006-12-01

    del oeste de Curaçao están dominados por extensas poblaciones de Montastraea annularis (complejo. Estas especies son mayores en tamaño (promedio= 66 cm de diámetro que las otras especies, con algunas colonias pequeñas (10 cm observadas en transectos y la mayoría exhibió bajos niveles de mortalidad parcial (prom= 22.5%. En el 2005, fueron menos abundantes (38% de las colonias. La mortalidad parcial en colonias vivas de M. annularis y M. faveolata se incrementó en un 85% (promedio= 42% de mortalidad parcial y se observaron numerosas colonias de M. annularis y M. faveolata muertas; las colonias de M. franski generalmente se encontraron en excelentes condiciones (14% de mortalidad parcial. Se documentó una alta prevalencia de enfermedades de coral (3-30% en M. annularis y M. faveolata, mientras que las otras especies se vieron afectadas con menor frecuencia. La enfermedad de banda amarilla (BA emergió poco después del blanqueamiento de 1995 y se dispersó rápidamente en todas las profundidades, alcanzando su mayor prevalencia entre 1997-1999. La BA causó mortalidades lentas (= 1cm/mes, con aparición de múltiples lesiones focales en colonias individuales; estas lesiones fueron creciendo progresivamente al tiempo que mataban las colonias. Para el año 2005, el 44% de los corales que se etiquetaron habían muerto; los restantes exhibían infecciones activas de BA (21%, o estaban en remisión (31.6% pero habían perdido un promedio de >90% de su tejido. Aunque la incidencia de BA disminuyó a partir del 2000, la prevalencia de la plaga blanca (PB fue inusualmente alta (4-12% en el 2001 y 2005, provocando mortalidades recientes de hasta un 70% en las colonias afectadas. Las superficies muertas de Montastraea spp. han sido colonizadas por otros corales, incluyendo porítidos, agarícidos y otros fávidos, mientras que continúa la ausencia de reclutas de M. annularis (complejo. Si las enfermedades y otros estresores bióticos persisten en estos arrecifes, las

  18. A strategic learner for a new society Un aprendiz estratégico para una nueva sociedad

    Directory of Open Access Journals (Sweden)

    Bernardo Gargallo López

    2012-07-01

    1246 12.0 0 false 18 pt 18 pt 0 0 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:12.0pt; font-family:"Times New Roman"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Nuevos tiempos precisan de nuevos aprendices. En una escuela inmersa en la sociedad de la información, que queremos que sea del conocimiento, hace falta desarrollar nuevas actitudes y habilidades para el aprendizaje. El estudiante ha de aprender a desarrollar su autonomía y responsabilidad en un mundo abierto en que hay sobreabundancia de información y estímulos. Para ello hace falta que el estudiante llegue a ser “aprendiz estratégico”, una persona autónoma que quiere aprender para crecer, para sí y para los demás, teniendo como referente los valores, alguien que aprende a movilizar, observar, evaluar, planificar y controlar sus propios procesos de aprendizaje. Estamos hablando de aprendizaje autorregulado, de “aprender a aprender” Y, si bien es cierto que la escuela ha perdido su papel clave en la transmisión de la información, también lo es que se constituye en el espacio privilegiado para enseñar a aprender a aprender. La autorregulación, el pensamiento crítico, el compromiso cívico, etc. han de asentarse en la escuela para continuar creciendo luego, y se pueden y deben trabajar desde edades tempranas. En este trabajo presentamos claves para el desarrollo del aprendizaje estratégico en el sistema educativo.

  19. Historia del tratamiento de la Sífilis The history of Syphilis´ treatment

    Directory of Open Access Journals (Sweden)

    R M C Leitner

    2007-03-01

    Full Text Available El nombre sífilis proviene del griego siph: cerdo y philus: amor. Recuerda al personaje de una obra, llamado Syphilo, que fue castigado por los dioses a sufrir una terrible enfermedad. Se analizan los datos sobre la sífilis en la antigüedad (que difieren según su fuente. Su mención en la Edad Media, su controversial origen, la ayuda de los paleopatólogos para encontrarlo. Luego de la Revolución Francesa y el inicio de la Edad Contemporánea, el porcentaje de enfermos fue creciendo y se acentuó la segregación de los mismos por la sociedad. Desde el año 1500 hasta principios del siglo XX el tratamiento de la sífilis dependía del mercurio. Tenía una gran variedad de formas de aplicación. La vía tópica: el ungüento gris, en calomelano o tabletas, en inyecciones, en fricciones y fumigaciones en donde el mercurio se introducía en el cuerpo por lo pulmones. Se adjudicó a la madera del guayaco pretendidas características curativas, que no poseía. Los ioduros se utilizaron para el terciarismo. Ehrlich en 1907, patentó el compuesto 606 o Salvarsan y en 1910, el Neo-Salvarsan o Arsfenamina (compuesto 914. Por estos descubrimientos recibió el Premio Nobel. En 1887, Julios Wagner Jauregg sugirió que la fiebre terapéuticamente inducida era útil en el tratamiento de enfermos psicóticos. En 1912 publicó sus satisfactorios resultados al tratar la paresias con una combinación de mercurio-iodo y tuberculina de Koch. En 1917 ingresó a su servicio un enfermo de malaria, con cuya sangre escarificaron la piel palúdica de tres paréticos, en lugar de darle inmediatamente quinina. Por ello fue galardona con el Premio Nobel. Se utilizó luego el bismuto, a partir de 1922, pero posteriormente fue sustituido por las sulfamidas, de aplicación dificultosa. El avance terapéutico más importante ocurrió en 1943, año en que se comenzó a utilizar la penicilina por Mahoney y colaboradores. Luego se confirmó la eficacia de la tetraciclina para

  20. (GEHO Grupo español del hormigón

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1986-12-01

    by its inscription at the Madrid Provincial Registry of Associations, N.P. 6.771 of July 4th 1985.

    El Comité Europeo del Hormigón (CEB fue fundado en 1957 con el objeto de desarrollar, a nivel internacional, el estudio de toda cuestión científica y técnica susceptible de hacer progresar la construcción en hormigón. Entre sus seis miembros fundadores figuraba el profesor español Eduardo Torroja. Desde esa fecha, el prestigio alcanzado por el CEB ha ido creciendo continuamente, gracias a los trabajos y publicaciones realizados. Por otra parte, desde 1976 en que se reformaron sus Estatutos, el CEB ha pasado a denominarse Comité Euro-Internacional del Hormigón, con lo que admite en su seno a cualquier país del mundo. En la actualidad, los países miembros pasan de cuarenta. En España, la vinculación con el CEB ha venido siendo asegurada tradicionalmente por el Instituto de la Construcción y del Cemento "Eduardo Torroja" (lETcc, perteneciente al Consejo Superior de Investigaciones Científicas, quien centralizaba las relaciones tanto técnicas como administrativas. Esta labor del Instituto ha sido muy positiva y de ella se han beneficiado, directa o indirectamente, gran número de expertos y profesionales españoles del sector de la construcción. En particular, la normativa técnica española del sector del hormigón está basada en los trabajos del CEB. El desarrollo creciente de la técnica del hormigón en nuestro país, en sus distintas vertientes de investigación, docencia, proyecto, cálculo, construcción, control de calidad, etc., ha traído consigo que el número de profesionales interesados en el CEB sea hoy considerable. Ello aconseja la creación de una Asociación, al amparo de la Ley de 24 de Diciembre de 1964, que pueda servir de cauce a todas las actividades que se derivan de la pertenencia al CEB, potenciando con ello la participación de los expertos españoles en tan prestigiosa organización. A esta idea de participaci

  1. Carta al Editor

    Directory of Open Access Journals (Sweden)

    Darío Maldonado Romero

    1991-03-01

    establecidos estalló la Primera Guerra Mundial y en su calidad de Alsacianos fueron internados en un campo de concentración y el Doctor empezó a escribir su Filosofía de la Civilización. El Respeto a la Vida infundióle ánimo para soportar las dificultades que los abrumaron al ser remitidos a Europa al Campo de Concentración de Sr. Remy. Cuando se firmó el Armisticio habían almacenado fortaleza física y espiritual.

    Estaba más decidido que nunca a ir a donde mas lo necesitaran yen 1924 volvió al África a su hospital haciéndose a fondos con recitales de órgano y dando conferencias para proseguir su obra en Lambarené. Tendría que pasar largos períodos reclutando dineros, dando conferencias y recibiendo distinciones en diversos países.

    La ciudad de Francfort le confirió un premio en dinero, en memoria de Goethe, por “servicios a la comunidad” y la Reina Isabel lo honró con la Insignia de Miembro Honorario de la Orden del Mérito, que solamente había sido concedida a otro, no británico, el Presidente Eisenhower.

    En 1939 se declaró la Segunda Guerra Mundial y las dos fuerzas, la de Vichy y la de Francia Libre, sobrevolaron con sus aviones sobre el pueblito de Lambarené, quedando los alsacianos como franceses; el trabajo en el hospital había disminuido mucho pero después de algún tiempo llegó como visitante distinguida la esposa del Doctor a quien éste le había agradecido mucho que le hubiera dejado volver solo. En mayo de 1945 terminó la guerra.

    El hospital nuevamente iba creciendo. El Doctor trataba de escribir un poco cada noche, pero, si había enfermos graves, prefería atenderlos; en una sala se celebraban oficios religiosos y el doctor predicaba con dos intérpretes, que repetían sus palabras en las dos lenguas nativa” principales, sobre temas sencillos como las parábolas del hijo pródigo y el buen samaritano.

    La nauseabunda medicación chalmúgrica oral y la dolorosa ineficacia de los esteres inyectados

  2. Differences in root distribution, nutrient acquisition and nutrient utilization by tropical forage species grown in degraded hillside soil conditions¹ Diferencias en la distribución de raíces, absorción y utilización de nutrientes por especies forrajeras tropicales en condiciones de suelos degradados de ladera

    Directory of Open Access Journals (Sweden)

    Arnulfo Gómez-Carabalí

    2010-04-01

    ínea forrajera C4 (Brachiaria dictyoneura y dos leguminosas C3 (Arachis pintoi y Centrosema macrocarpum creciendo bajo dos niveles de fertilización y cultivadas en monocultivo y en asociación y cosechadas a cuatro diferentes edades. No se encontraron diferencias significativas en biomasa de raíces entre la gramínea y las leguminosas y sus asociaciones. La vegetación nativa presentó la menor cantidad de biomasa de raíces; mientras que la gramínea introducida (B. dictyoneura presentó la menor cantidad entre todos los materiales en todas las profundidades y edades, y la vegetación nativa presentó la más alta longitud especifica de raíces. Como era de esperar, la absorción de nutrientes se incremento con la edad y con el mayor nivel de fertilización en todas las especies. Centrosema macrocarpun tuvo la más alta absorción de N y Ca entre todos los materiales evaluados. La absorción de P, K y Mg fue mayor en la gramínea que en las otras especies solas o asociadas. Por otro lado, la gramínea presentó la más baja absorción de Ca. La gramínea sola y las asociaciones con las leguminosas A. pintoi y C. macrocarpun presentaron la mayor alta absorción de S. Se encontró una alta correlación (P < 0.001 entre la densidad de longitud de raíces (profundidades 0 - 10 y 10 - 20cm y la absorción de N y P. La eficiencia de uso de nutrientes (forraje producido/nutriente absorbido -g/g incrementó con la edad hasta las 38 semanas. A 55 semanas se observó una fuerte caída en la eficiencia de uso de nutrientes. Los valores de la eficiencia de uso de N, Ca y P fueron más altos con las gramíneas que con las leguminosas evaluadas. La eficiencia de uso K fue similar entre las tres especies. La gramínea mostró los mas altos valores de Mg y S, y la leguminosa A. pintoi el menor.

  3. Risk factor control in hypertensive and diabetic subjects attended by the Family Health Strategy in the State of Pernambuco, Brazil: the SERVIDIAH study Control de los factores de riesgo en hipertensos y diabéticos seguidos por la Estrategia Salud de la Familia en el estado de Pernambuco, Brasil: estudio SERVIDIAH Controle dos fatores de risco em hipertensos e diabéticos acompanhados pela Estratégia Saúde da Família no Estado de Pernambuco, Brasil: estudo SERVIDIAH

    Directory of Open Access Journals (Sweden)

    Adriana Falangola Benjamin Bezerra

    2013-06-01

    sobrepeso u obesidad, pocos informaron estar siguiendo una dieta para perder peso. El estudio, en esta muestra representativa de hipertensos y diabéticos registrados en la ESF de Pernambuco, muestra qué mejorías se deben buscar a fin de perfeccionar la prevención de las complicaciones de esos problemas, cuya incidencia está creciendo.O estudo SERVIDIAH (Avaliação de Serviços de Atenção Básica à Saúde para Diabéticos e Hipertensos foi realizado em 2010 no Estado de Pernambuco, Brasil. Foi constituída uma amostra aleatória de 785 hipertensos e 823 diabéticos oriunda dos cadastros de 208 equipes da Estratégia Saúde da Família (ESF sorteadas em 35 municípios do estado. Os usuários foram entrevistados por meio de formulário padronizado, e tiveram aferição de peso, altura e pressão arterial e, para os diabéticos, da hemoglobina glicada (HbA1c. A idade média foi em torno de 60 anos, com sobrerrepresentação de mulheres (70%. A pressão arterial foi controlada em 43,7% dos hipertensos e 25,8% dos diabéticos; 30,5% dos diabéticos apresentaram HbA1c abaixo de 7%. Apesar de 70% apresentarem sobrepeso ou obesidade, poucos referiram estar seguindo dieta para perder peso. O estudo, nesta amostra representativa de hipertensos e diabéticos cadastrados na ESF de Pernambuco, mostra que melhorias devem ser buscadas a fim de aprimorar a prevenção das complicações desses agravos, cuja incidência está crescente.

  4. Leaf phenology and its associated traits in the wintergreen species Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae Fenología foliar y sus caracteres asociados en la especie invierno-verde Aristotelia chilensis (Mol. Stuntz (Elaeocarpaceae

    Directory of Open Access Journals (Sweden)

    MARÍA ANGÉLICA DAMASCOS

    2001-12-01

    Full Text Available The post-summer leaf demography of the wintergreen species Aristotelia chilensis growing near San Carlos de Bariloche, Argentina, is described. Its specific leaf mass (SLM, g m-2 is compared to that of the deciduous and evergreen species of the Andean-Patagonian forests and to that of other communities abroad. The pattern of leaf emergence is intermediate, with leaf flush in spring (basal cohort, BC, followed by successive unfolding of the remaining leaves (distal cohort, DC during summer. The senescence of the BC occurs mainly in autumn, with a loss of 11-31 % of its SLM. The DC falls synchronously in mid-spring and the SLM loss in winter is 10-13 %. The SLM of A. chilensis (103.6 ± 6.2 g m-2 is intermediate when compared to the general mean values of deciduous (73.7 ± 15.9 g m-2 and evergreen species (154.8 ± 45.8 g m-2. The SLM of deciduous and evergreen species of three different forests near San Carlos de Bariloche varied significantly at the end of the growing season while that of A. chilensis showed more constant values. The periodicity of leaf production and senescence in A. chilensis allows the maintenance of one leaf cohort throughout the year, covering the carbon demand for flowering and leaf production in spring. This differentiates the deciduous from the wintergreen species, despite their similar mean leaf life span values, while the evergreen species have a longer leaf turnover. Considering the conditions for growth in each studied forest, the leaf life span was not the only factor determining the SLM value. This variable would also depend on multiple stresses that may act during the ontogenesis and evolution of the leaves in each phenological groupSe describe la demografía foliar después del verano de la especie invierno-verde Aristotelia chilensis, creciendo cerca de la ciudad de San Carlos de Bariloche, Argentina. Se compara su peso específico foliar (SLM, g m-2 con los valores de especies deciduas y siempreverdes de los

  5. Analysis of the re-colonization of San Benito Archipelago by Guadalupe fur seals (Arctocephalus townsendi Análisis de la recolonización del archipiélago de San Benito por el lobo fino de Guadalupe (Arctocephalus townsendi

    Directory of Open Access Journals (Sweden)

    Manuel Esperón-Rodríguez

    2012-03-01

    -colonización y el estado actual del LFG en el ASB. También se informan los primeros nacimientos y la ocupación de la isla del Oeste del ASB. Con base en los censos de 1997 a 2007, la población creció con una tasa de incremento anual de 21,6%. Se estudió el tamaño de la población, la tendencia de crecimiento de la colonia, biología reproductiva y preferencias alimentarias. Se contaron 2,227 individuos en el ASB. Tres especies de calamar se encontraron como el principal componente de la dieta (Loligo opalescens, Onychoteuthis banksii y Dosidicus gigas. La territorialidad, los patrones de actividad y el comportamiento reproductivo, muestran una conducta similar entre los individuos de isla Guadalupe y ASB. Se calculó la tasa de crecimiento promedio de las crías del ASB y se comparó con la tasa de crecimiento de las crías de isla Guadalupe (ASB: 6.7 ± 1.4 kg y 68,9 ± 2.64 cm; isla Guadalupe 5.9 ± 0.5 kg, y 67.29 ± 4.3 cm. Se midió la duración de los viajes de alimentación de las hembras, indicando que la colonia de San Benito probablemente se encuentra cerca de una importante zona de alimentación. En cuanto a los patrones de asistencia materna, estos podrían indicar una estrategia de lactancia-viajes de alimentación diferente entre SBA e isla Guadalupe. Se puede esperar que la población de lobos finos en San Benito siga creciendo, ya que no hay limitantes en cuanto al espacio reproductivo y los recursos alimenticios disponibles en la zona.

  6. Influencias de las variaciones en el clima y en la concentración de C0(2 sobre el crecimiento de Nothofagus pumilio en la Patagonia Influences of climatic and C0(2 concentration changes on radial growth oí Nothofagus pumilio in Patagonia

    Directory of Open Access Journals (Sweden)

    ANA M SRUR

    2008-06-01

    Full Text Available El objetivo de este trabajo fue evaluar las relaciones entre las variaciones en el clima y en la concentración de C0(2 durante el siglo XX con el crecimiento radial y la eficiencia en el uso del agua en los bosques de Nothofagus pumilio a lo largo de un gradiente altitudinal, en El Chaltén (49°22' S, Santa Cruz, Argentina. Se empleó una combinación de técnicas dendrocronológicas e isotópicas. Los patrones de crecimiento radial a lo largo del gradiente altitudinal reflejan las tendencias climáticas registradas en la zona durante el siglo XX. El crecimiento de los árboles ubicados en el límite superior muestra una tendencia positiva en respuesta al incremento regional de las temperaturas. Por el contrario, los bosques en contacto con la estepa patagónica presentan, en respuesta a una intensificación del déficit hídrico, una tendencia negativa de crecimiento durante el siglo pasado. Los árboles creciendo en bosques mésicos ubicados en alturas intermedias muestran una tendencia levemente negativa no significativa. Los valores de 6(13C reflejan en qué medida el contenido de humedad en el suelo regula en forma diferencial los procesos de conductancia estomática y tasa fotosintética a lo largo del gradiente altitudinal. En sitios donde el déficit hídrico varía desde leve a muy marcado, la eficiencia intrínseca en el uso del agua (EIUA parece estar influenciada por la disponibilidad de agua en el suelo. La relación entre la EIUA y las variables climáticas es más clara en sitios con reducido estrés hídrico. En sitios secos, el estrés hídrico muy marcado reduciría la tasa fotosintética en grado tal que el crecimiento no podría ser compensado por el aumento en EIUA. En contraste con el concepto tradicional en dendrocronología que postula una relación más estrecha entre el crecimiento radial y las variaciones climáticas en los bosques ecotonales, los valores isotópicos de 6(13C representan más claramente las

  7. BAELO CLAUDIA Y POLLENTIA: NUEVAS EVIDENCIAS SOBRE LAS FLUCTUACIONES ECONÓMICAS EN LA HISPANIA ROMANA DE LOS SIGLOS I-II D. C. (Baelo Claudia and Pollentia: new evidence on the economic fluctuations in Roman Spain during the first and second centuries AD

    Directory of Open Access Journals (Sweden)

    Pascual Izquierdo-Egea

    2012-06-01

    Full Text Available La revisión cronológica de la necrópolis sureste de Baelo Claudia (Bolonia-Tarifa, Cádiz y la de Can Fanals, en Pollentia (Alcudia, Mallorca, ha permitido ampliar el conocimiento sobre las fluctuaciones económicas en la Hispania romana de los siglos I y II de nuestra era y los cambios sociales asociados a las mismas. Se ha obtenido una nueva confirmación del impacto de la gran crisis de tiempos de Tiberio en los registros funerarios de Baelo Claudia y Pollentia, detectada previamente en Ampurias o Emporiae (Gerona. La bonanza de la época de Claudio se puede comprobar en Baelo Claudia de forma más elocuente que en Emporiae. Ahora bien, esta coincidencia en el devenir económico se rompe a lo largo de la segunda mitad del siglo I d. C., en concreto durante el periodo comprendido entre Nerón y principios de los Flavios. Es entonces cuando, frente a la decadente Ampurias, una pujante Pollentia sigue los pasos de la opulenta Baelo mostrando su mayor prosperidad. Sin embargo, esas tres ciudades romanas de Hispania mantienen un claro nexo basado en la exhibición durante ese periodo de su máxima complejidad social. Siempre se da una proporción directa entre la acumulación económica amortizada en los ajuares y la diferenciación entre los individuos, salvo en dos casos excepcionales. Uno, ya conocido, se refiere a la Ampurias de la segunda mitad del siglo I d. C., donde el empobrecimiento que la caracteriza se asocia con un incremento de la distancia social. Y, el otro, corresponde al extraño fenómeno documentado en la Pollentia del siglo II d. C. En esta sigue creciendo el gasto funerario, pero la diferenciación social medida desciende durante la primera mitad hasta caer abruptamente a lo largo de la segunda parte de dicha centuria. No obstante, lo más importante es que, por ahora, se detecta la misma evolución de la diferenciación social en Emporiae, Baelo Claudia y Pollentia desde la época de Tiberio hasta la primera mitad del

  8. The occurrence of black corals in Jamaican reef environments, with special reference to Stichopathes lutkeni (Antipatharia:Antipathidae

    Directory of Open Access Journals (Sweden)

    G.F Warner

    2005-05-01

    ños de las especies comunes.Además,una pared vertical creada por dragado en el 2002 permitió determinar el crecimiento de colonias recién asentadas.Hice observaciones desde 1998 y medidas desde el 2001 con equipo de buceo tipo "SCUBA "hasta 35 m de profundidad.Se identificaron siete especies de Antipatharia en paredes empinadas de arrecifes coralinos a más de 25 m de profundidad.La especie más común fue el coral negro no ramificado Stichopathes lutkeni .Otras especies comunes incluyen el coral negro con forma de abanico Antipathes atlantica y Antipathes gracilis .Las especies frecuentes incluyen una comercialmente importante,Antipathes caribbeana y una especie con un crecimiento inusual en forma de trepadora, Antipathes rubusiformis.Se observó poco la otra especie de importancia comercial en el Caribe,Plumapathes pennacea ,y la cavernícola Antipathes umbratica .La mayor abundancia de corales negros se dio en paredes empinadas de sustratos duros con poca iluminación pero expuestos a la corriente a lo largo de la costa.Las densidades combinadas de las especies más comunes de Antipatharia a 30 m de profundidad en Río Bueno en la costa norte,tenían un ámbito entre 0.1 y 2.5 m-2 (once transectos de 10 m x 1 m, 1-25 colonias por transecto,68 colonias en total.Cuarenta y seis de las 68 colonias eran S.lutkeni ,mientras cerca de allí,en Discovery Bay a 30-35 m,55 de las 59 colonias eran S.lutkeni .Había una diferencia significativa entre el tamaño promedio de colonias en estas dos poblaciones de S.lutkeni (100 cm y 80 cm,respectivamente,probablemente relacionada al hábitat.Una tercera población de S. lutkeni creciendo a 15-20 m de profundidad en la pared recién dragada tenía un tamaño promedio mucho más pequeño,36.6 cm (n=27.El individuo más grande midió 83 cm de largo,indicando un crecimiento mínimo del corallum sin ramificar de 2.1 mm por día.

  9. Arrecifes coralinos de Bocas del Toro, Panamá: distribución, estructura y estado de conservación de los arrecifes continentales de la Laguna de Chiriquí y la Bahía Almirante

    Directory of Open Access Journals (Sweden)

    Héctor M. Guzmán

    1998-09-01

    Full Text Available Se presenta la distribución de azrecifes coralinos a lo lar-go de la costa continental (tierra firrne de la Bahía Almirante (ca. 83km y de la Laguna de Chiñquí (ca 125km, Pro­vincia de Bocas del Toro, Panarná Se describe la estructura de 15 arrecifes coralinos, los cuales representan la diversidad de condiciones hidrológicas y orográficas de la zona costera con mayor inítuencia terrígena de Bocas del Toro. Los arrecifes encontrados en la Bahía Almirante se encuentran bien desarrollados hasta una profundidad máxima de 23 m y una diversidad de corales madrepóricos de 33 especies, locual representa aproximadamente un 53 % de la diversidad conocida para Panamá. las coberturas de coral vivo observadas para la región de estudio oscilan entre 20 % y 50 % depediendo de la profundidady se estima un promedio total de 35 % casi el doble de la cobertura informada para otras regiones de Panamá (San Blas donde se presume que los arrecifes estan mejor protegidos. La zonación y composición de especies de corales son similares en toda el área de estudio; Porites furcata domina los arrecifes someros hasta 2 m de profundidad, con una cobertura de ca. 90% seguida por una zona dominada por Agaricia tenuifolia, (40% hasta los 6 m. seguido de una zona principalmente compuesta de A. tenuifolia (15% Madracis mirabilis (7% y Siderastrea siderea (50% hasta los 15 m de profundidad, terminando en una zona profundad dominada por algas rojas calcareas Amphiroa rigida, Hydrolithon boergesenii, Sporolithon episporum y el coral S. siderea. El coral Agaricia undata, común en habitats profundos se encontró relativamente abundante (3% y creciendo después de los 10 m. Se informa por primera vez para la región la existencia de una barrera coralina construida por Porites furcata, semi-continua de ca. 22 km de largo y que bordea la zona costera de la Bahía Almirante. El grupo de las esponjas, segundo en importancia, está ampliamente distribuido en todos los

  10. Caracterização da saúde bucal de idosos em uma instituição beneficente de longa permanência de João Pessoa-PB, Brasil Caracterización de la salud bucal de ancianos residentes en una institución benéfica de João Pessoa-PB, Brasil Characterization of the buccal health of elderly in an beneficent institution of the long stay of João Pessoa-PB, Brazil

    Directory of Open Access Journals (Sweden)

    Isabella Lima Arrais Ribeiro

    2012-09-01

    Full Text Available Introdução: a população idosa está crescendo em números proporcionais se tornando necessário maior cuidado de sua saúde. O objetivo deste estudo foi descrever a situação epidemiológica do estado de saúde bucal dos idosos na cidade de João Pessoa - PB, Brasil. Métodos: foram analisados 55 idosos em longa permanência na instituição da cidade de João Pessoa. Os idosos foram interrogados sobre o quotidiano e hábitos pessoais e logo foram validadas as condições bucais por um especialista. A avaliação insere a condição dos dentes e a necessidade e o uso da prótese dentária. Foram coletados os dados em um formulário e analisados no SPSS(Chis quadrado ou exato do Fisher. Resultados: se verificou que 16 (29,0 % das pessoas têm 60-70 anos e 39 (71,0 % mais de 70 anos de idade. Estimativas do sexo evidenciaram que 43 (78,2 % são mulheres e 12 (21,8 % são homens. Os idosos reportaram ter marcado a última visita ao dentista ao menos um mês 2 (3,7 %, nos últimos 6 meses 4 (7,3 % e mais de um ano 49 (89,0 %. A prevaência de edentulismo foi de 35 (63,6 %. Outros têm uma média de 6,1 dentes por indivíduo. O uso de prótese geral removível se observou em 40,0 % dos idosos e de prótese parcial removível em 9,1 %. Um total de 78 % dos idosos presissam de algum tipo de prótese dentária. Conclusões: os idosos tratados ficam carentes de atenção odontológica, necessitando reabilitação protética.Introducción: la población de ancianos está creciendo en números proporcionales, por lo que es necesario mayor cuidado de su salud. El objetivo de este estudio fue describir la situación epidemiológica del estado de salud oral de los ancianos en la ciudad de João Pessoa - PB, Brasil. Métodos: se analizaron un total de 55 ancianos en una larga estancia, en la institución de la ciudad de João Pessoa. Los ancianos fueron interrogados acerca de información personal, los hábitos personales y a continuación, se llevó a

  11. Crecimiento demográfico y cambio climático

    Directory of Open Access Journals (Sweden)

    Wilfredo Bulege Gutiérrez

    2013-06-01

    Full Text Available El mundo seguirá creciendo. Las más recientes proyecciones de las Naciones Unidas no prevén todavía un punto de inflexión en el crecimiento poblacional en el transcurso del presente siglo, pero se estima que, dadas las tendencias demográficas registradas, para mediados de siglo seremos alrededor de 9 mil 300 millones de habitantes en el planeta. La dinámica demográfica es la principal fuerza conductora del cambio ambiental global, pues constituye una presión para ocupar cada vez más espacios, explotar más recursos, producir más alimentos, consumir más agua, contaminar más, utilizar más energía y emitir más gases de efecto invernadero (1. La disminución del crecimiento demográfico resulta un requisito necesario para reducir las emisiones de carbono en el futuro; sin embargo, se objeta que ello puede dar lugar a programas de “control demográfico” en los países en desarrollo. Y como se sabe, estos países se verían afectados gravemente por el cambio climático; desde tal perspectiva ha sido identificado por lo menos una de tres posibles formas de interacción entre las tendencias demográficas y los efectos del cambio climático: (i un rápido deterioro de las fuentes de recursos naturales, (ii mayordemanda de recursos escasos y (iii el aumento de la vulnerabilidad humana a fenómenos meteorológicos extremos (2. Resultados de investigaciones indican que habría que ofrecer más posibilidades de acceso voluntario a los servicios de planificación familiar a las comunidades pobres de los países menos adelantados. Este enfoque prioriza el bienestar de las comunidades pobres afectadas por el cambio climático, a diferencia de la otra postura que propone la reducción del crecimiento de la población a fin de limitar el aumento de las emisiones de carbono mundiales (2. El crecimiento poblacional aumenta la demanda de bienes y servicios, sin duda implica una mayor presión ambiental. Al mismo tiempo, el crecimiento econ

  12. Secondary Education in Afghanistan: a portray of postconflict education reconstrution

    Directory of Open Access Journals (Sweden)

    Juan Manuel Moreno Olmedilla

    2005-01-01

    importante: Dependiendo de la región o la provincia, la tasa de escolarización de las niñas en secundaria varía desde el 34 por ciento hasta el 0. Todavía hoy hay provincias enteras en que ni una sola niña está matriculada en la escuela secundaria superior. A todo esto se une la limitación impuesta por el escaso número de profesores ¿ y sobre todo de profesoras ¿ de secundaria tanto en determinadas regiones y provincias como en ciertas áreas curriculares (matemáticas y ciencias especialmente. El casi exclusivo énfasis actual, en buena medida impulsado por las distintas organizaciones donantes, sobre la educación primaria y en la universitaria, no permite anticipar que se vayan a llevar a cabo las reformas y las inversiones necesarias en el sector de la secundaria. Y no es necesario insistir en que ello puede llevar a desequilibrios importantes en el sistema educativo afgano, que al no poder hacer frente a la demanda de secundaria, podría ver cómo disminuyen ¿ o no siguen creciendo como es necesario ¿ las tasas de graduación en la primaria, cómo se amplía el déficit de profesorado tanto de primaria como de secundaria, y cómo continúan sin abrirse las puertas de la educación superior a las mujeres. Conseguir universalizar la educación secundaria de primer ciclo ¿ ya obligatoria, como se ha dicho ¿ va a requerir políticas muy decididas y orientadas a colectivos específicos. La provisión de escolarización habría de concentrarse en provincias, distritos y grupos étnicos muy específicos, además de las mujeres, que en principio no tienen asegurada su inclusión en un sistema que está en rapidísimo crecimiento

  13. Static measurements of the resilience of Caribbean coral populations

    Directory of Open Access Journals (Sweden)

    Andrew W. Bruckner

    2012-03-01

    resiliencia de los arrecifes del Caribe. Un aspecto clave de estos estudios se centra en la dinámica de las poblaciones de los corales, incluyendo medidas de cobertura de coral, estructura de tallas, la extensión de la mortalidad parcial y total de toda la comunidad, condición de los corales y reclutamiento. Un reto es que esto representa una medida estática que involucra una única evaluación. Sin seguir las colonias individuales y el reclutamiento en el tiempo, es difícil determinar las tasas de sobrevivencia y crecimiento de los reclutas, y podría no ser posible la diferenciación de los juveniles de los restos pequeños de colonias más viejas, especialmente cuando la cobertura algal es alta. Para abordar esta limitación, los corales monitoreados en Bonaire en julio del 2010 fueron subdivididos en dos categorías: 1 colonias sobre la estructura arrecifal; y 2 colonias creciendo sobre coral muerto o sobre las superficies expuestas del esqueleto de los corales vivos. Los arrecifes en Bonaire exhiben muchas características indicativas de alta resiliencia, incluyendo una alta cobertura de coral (frecuentemente 30-50%, altos niveles de reclutamiento, y un gran número de corales que se asentaron sobre los corales muertos y crecieron. En general, las superficies del esqueleto de 12 especies de corales fueron colonizadas por 16 especies de corales, con un máximo de 12 colonizadores en cada colonia, la mayoría (67% sobre esqueletos de Montastraea annularis (complejo. Colonias completamente muertas de M. annularis fueron comunes y los sobrevivientes con frecuencia son más pequeños o subdivididos en pequeños restos de tejido. Montastraea annularis es la especie que exhibe una mayor mortalidad parcial en relación con los demás corales. Una notable ausencia de reclutamiento sexual y juveniles de M. annularis ilustra el cambio progresivo de cambio de un sistema dominado por Montastraea. Este cambio, que se está produciendo en todo el Caribe, se caracteriza por un

  14. Alergia ao látex em paciente com síndrome de Kabuki: relato de caso Alergia al látex en paciente con síndrome de Kabuki: relato de caso Latex allergy in a patient with Kabuki syndrome: case report

    Directory of Open Access Journals (Sweden)

    Vera Coelho Teixeira

    2010-10-01

    conocimiento del profesional de Anestesiología sobre los aspectos específicos de pacientes portadores de síndromes raros, es una necesidad que ha venido creciendo, pues cada vez más, esos pacientes son derivados a los quirófanos. Nuestro objetivo es describir un caso de alergia al látex que ocurrió en uno de esos pacientes con diagnóstico del Síndrome de Kabuki, y cuyos aspectos todavía no fueron completamente aclarados, alertando a los anestesiólogos en cuanto a la posibilidad de esa asociación. RELATO DEL CASO: Paciente de 11 años, con diagnóstico de Síndrome de Kabuki, que fue admitida para exéresis de lesiones de las partes blandas. Presentaba un historial de reacciones alérgicas previas posteriores a los procedimientos quirúrgicos de pequeño porte. Con la necesidad de realizar un nuevo procedimiento, y después de la evaluación preanestésica, la paciente fue derivada a un alergista que la sometió a pruebas cutáneas las cuales confirmaron la hipótesis de alergia al látex. Una vez más fue enviada al quirófano para exéresis de las lesiones bajo anestesia general. Fueron tomadas todas las precauciones con el objetivo de evitar nuevas manifestaciones clínicas. El procedimiento transcurrió sin intercurrencias y la paciente recibió alta el mismo día, sin que presentase ningún tipo de complicación, lo que reforzó mucho más el diagnóstico. CONCLUSIONES: El Síndrome de Kabuki parece tener un curso relativamente benigno en su historial natural. Sin embargo, existen muchos aspectos que todavía necesitan ser aclarados y por lo tanto, no descartamos la posibilidad de la asociación de esa patología con otras condiciones que son del interés del anestesiólogo. Esa descripción tiene el objetivo de alertar sobre el riesgo de la asociación de ese síndrome con la alergia al látex. Para tanto, debemos incentivar la evaluación preanestésica de esos pacientes, la realización de una anamnesis correcta y el análisis de otros factores

  15. Situación y tendencias epidemiológicas de la infección por VIH/SIDA en Colombia

    Directory of Open Access Journals (Sweden)

    Ricardo Luque Núñez

    2004-03-01

    heterosexual, 28,3% homosexual y 16,8% bisexual, para un total de 96% transmitidos por vía sexual, 3,1% perinatal, 0,67% transfusional, 0,11% en usuarios de drogas intravenosas y 0,12% por otras formas. Por otro lado, en el estudio centinela realizado en el año 2000 (2, se encontraron prevalencias por encima de lo esperado en departamentos de la costa atlántica, lo que sugiere una tendencia a una epidemia generalizada en estos sitios. Las mujeres representan el 18% de los casos, pero este número continúa creciendo y la relación hombre-mujer sigue siendo cada vez más cercana, con una relación de 3:1 promedio en el país, que en algunos departamentos puede ser de 2:1. El 52.86 % de los casos por VIH se presenta en personas entre los 15 y los 35 años, lo que quiere decir que este grupo poblacional, probablemente, se infectó antes de los veinte años de edad.

    La tendencia de la epidemia es creciente y las curvas no parecen aplanarse de la forma como se ha logrado en otros países. Según las proyecciones, si las intervenciones no logran su efecto o no se les da la sostenibilidad requerida, para el año 2010 tendremos una prevalencia cercana al 1.5%, lo que representará un número estimado de 800.000 casos.

     

    REFERENCIAS

    1. INSTITUTO NACIONAL DE SALUD. Estudio de prevalencia al VIH con HSH en Bogotá, Liga Colombiana de Lucha contra el SIDA, 2000.

    2. INSTITUTO NACIONAL DE SALUD. Estudio Centinela Nacional, 2000.

  16. Selected Lectures of the 13th International Workshop on Neonatology; Cagliari (Italy; October 25th-28th, 2017

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2017-10-01

    IN PRETERM NEWBORNS • L. Corvaglia, S. MartiniLECT 19. ALLERGY TO COW’S MILK PROTEIN • M. De Filippo, A. Licari, G.L. MarsegliaLECT 20. GLOMERULAR NUMBER IN LBW BABIES: NOTE FOR THE FUTURE. THE FAULT IS NOT IN OUR STARS BUT MAY BE IN OUR EMBRYOS • G. RemuzziLECT 21. VACCINE-PREVENTABLE DISEASES • A. Villani, E. Bozzola, A.C. Vittucci, A. Grandin, C. Di Camillo, L. LancellaLECT 22. WHAT IS NEW IN PATENT DUCTUS ARTERIO­SUS TREATMENT? • F. Bardanzellu, P. Neroni, A. Dessì, M.A. Marcialis, V. FanosLECT 23. NEW PROSPECTS FOR PEDIATRIC RES­PI­RA­TORY MEDICINE FROM METABOLOMICS • M. Stocchero, G. Giordano, P. Pirillo, E. Priante, S. Carraro, E. BaraldiLECT 24. NEW BIOMARKERS AND “OMICS” IN PRE­ECLAMPSIA • M. Mussap, C. IeraceLECT 25. MATERNAL MILK: IMMUNOMICS AND MICRO­BIOMICS • D.G. PeroniLECT 26. NUTRIMETABOLOMICS OF MILK: COLOSTRUM AND MORE • A. Dessì, R. Pintus, F. Cesare Marincola, V. FanosLECT 27. AUTISM FROM CONVENTIONAL DIAGNOSIS TO METABOLOMICS: URINARY METABOLOMICS PROFILE IN A POPULATION OF CHILDREN WITH AUTISM SPECTRUM DISORDERS • P. Curatolo, A. Noto, M. Siracusano, A. Riccioni, L. Mazzone, L. Barberini, V. Fanos, C. FattuoniLECT 28. PLACENTAL BIOMARKERS • A.M. Paoletti, B. Piras, P. Abis, V. Corda, M. Neri, M.F. Marotto, M. Angiolucci, G.B. Melis, F. Coghe, V. MaisLECT 29. BIOMARKERS IN NEONATAL SEPSIS • R. ÖrsLECT 30. ACUTE KIDNEY INJURY IN NEWBORNS • C. AygunLECT 31. BIOMARKERS IN CARDIOLOGY • G. Mercuro, P.P. BassareoLECT 32. QUANTIFICATION IN NEONATAL URINE AND PROFICIENCY TESTING COMPARED TO NON-NMR METHODS • M. Spraul, H. Schäfer, C. Cannet, F. FangLECT 33. ENHANCING IMMUNE RESPONSES IN CHIL­DREN WITH RECURRENT RESPIRATORY IN­FEC­TIONS • G.V. Zuccotti, C. MameliLECT 34. OBSTETRICAL MANAGEMENT IN TWIN PREG­NANCIES • E. Cosmi, L. Marin, S. VisentinLECT 35. THE PATHOLOGIST AND TWINS • D. Fanni, C. Gerosa, G. FaaLECT 36. TWINS: THE POWER OF EPIGENETICS • G. Corsello, A. CorselloLECT 37. MANAGEMENT OF

  17. Selected Abstracts of the 9th International Workshop on Neonatology; Cagliari (Italy; October 23-26, 2013

    Directory of Open Access Journals (Sweden)

    --- Various Authors

    2013-06-01

    Full Text Available Selected Abstracts of the 9th International Workshop on Neonatology • LEARNED LESSONS, CHANGING PRACTICE AND CUTTING-EDGE RESEARCH • Cagliari (Italy • October 23rd-26th 2013The Workshop has been organized on behalf of Union of European Neonatal and Perinatal Societies, Union of Mediterranean Neonatal Societies, Italian Society of Neonatology, UNICEF, and under the High Patronage of the President of the Italian Republic. ABS 1. Aetiology and type of reference hospital for neonatal transport in Greece during 2012 • S. Mouskou, C. Varakis, D. Pyrros, N. Iacovidou; Athens (Greece ABS 2. Changes in neonatal outcomes of very low birth weight infants in Hospital of Lithuanian University of Health Sciences • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 3. Autoimmune liver disease in childhood • Y. Gibo, D. Fanni, P. Van Eyken, S. Nemolato, G. Floris, C. Gerosa; Matsumoto (Japan, Leuven (Belgium and Cagliari (Italy ABS 4. Lactoferrin attenuates intestinal injury afther perinatal hypoxia and hypothermia • N. Barisic, G. Konstantinidis, V. Stojanovic, A. Doronjski, S. Spasojevic; Novi Sad (Serbia ABS 5. Osteopenia in prematurity: case report • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 6. Neonatal Bartter syndrome: case report of a very unusual entity • A. Koutroumpa, K. Georgiou, H. Georgaki, F. Anatolitou; Athens (Greece ABS 7. Placental Growth Factor (PlGF and placental function • I. Atzeni, S.F. Deiana, A. Meloni, B. Piras, P. Zedda, S. Soddu, G. Parodo, G. Faa, G.B. Melis, A.M. Paoletti; Cagliari (Italy ABS 8. Neonatal ECMO: initial experience of Hospital de São João • G. Rocha, P. Soares, T. Henriques-Coelho, J. Correia-Pinto, J. Monteiro, H. Guimarães, R. Roncon-Albuquerque Jr; Porto (Portugal ABS 9. GCMS-based metabolomics analysis of urines in hypoxic neonatal piglets • C. Fattuoni, L. Barberini, N. Iacovidou, T

  18. Plasma Stability in Magnetic Mirror Machine with Stabilizing Rods; Stabilite du Plasma dans une Machine a Miroirs Magnetiques avec Barreaux de Stabilisation; Ustojchivost' plazmy v probkotrone so stabiliziruyushchimi sterzhnyami; Estabilidad del Plasma en una Trampa de Espejos con Barras Estabilizadoras

    Energy Technology Data Exchange (ETDEWEB)

    Trubnikov, B. A. [Institut Atomnoj Ehnergii Im. I.V. Kurchatova, Moskva, SSSR (Russian Federation)

    1966-04-15

    r{sub 0}/ Script-Small-L << 1, se puede expresar el criterio de estabilidad de foima que permanezca en el simplemente el parametro {alpha} = 4nJ Script-Small-L r{sub 0}{sup n-2}/ca{sup n} B{sup 0}{sub 0} y la magnitud x = z{sub max}/ Script-Small-L , donde z{sub max} es el punto de maxima reflexion de particulas (z = 0 corresponde al plano central de la trampa de espejos). Se han considerado dos distribuciones de particulas: la maxwelliana con el cono eliminado y el caso en que todas las particulas tengan los mismo valores de v{sup 2} y vi{sup 2}/B. La estabilidad aparece cuando {alpha} > (n-1){sup - Vulgar-Fraction-One-Half} y las primeras que se estabilizan son las particulas cuyas velocidades axiales son pequenas (v{sub il} --> 0) y, a medida que va creciendo {alpha}, todas las mas alejadas que x. El valor limite {alpha}{sub lim} = (n-1){sup - Vulgar-Fraction-One-Half} tiene un sentido fisico simple y corresponde a la condicion {Delta} Divides B Divides > 0 en el plano central de la trampa de espejos para z = o. En la memoria se consideran con detalle los sistemas con 4 y con 6 barras estabilizadoras. Los resultados del calculo del sistema con 6 barras concuerdan satisfactoriamente con los experimentos de loffe y colaboradores, que han observado la formacion de un plasma estabilizado en la trampa de espejos. (Al confrontar la teoria con el experimento, se supone que el plasma tiene una distribucion maxwelliana con el cono eliminado y se extiende en longitud hasta los espejos magneticos. Con objeto de evitar los calculos numericos, en la memoria se considera el caso x = z{sub max}/ Script-Small-L ' 1 , el cual, sin embargo, se ha extrapolado al valor x Tilde-Operator 1, lo que es admisible para evaluaciones semi-cuantitativas). Ademas de las barras infinitas, se han considerado en la memoria-Ios sistemas con barras estabilizadoras de longitud finita, los cuales se pueden realizar en la practica, tambien, en forma de imanes multipolares de longitud finita. Como se