WorldWideScience

Sample records for blazar pks 1510-089

  1. Very Rapid High-amplitude Gamma-Ray Variability in Luminous Blazar PKS 1510-089 Studied with Fermi-LAT

    Energy Technology Data Exchange (ETDEWEB)

    Saito, S.; Stawarz, L.; Tanaka, Y.T.; Takahashi, T.; Madejski, G.; D' Ammando, F.

    2013-03-20

    Here we report on the detailed analysis of the γ-ray light curve of a luminous blazar PKS 1510-089 observed in the GeV range with the Large Area Telescope (LAT) onboard the Fermi satellite during the period 2011 September - December. By investigating the properties of the detected three major flares with the shortest possible time binning allowed by the photon statistics, we find a variety of temporal characteristics and variability patterns. This includes a clearly asymmetric profile (with a faster flux rise and a slower decay) of the flare resolved on sub-daily timescales, a superposition of many short uncorrelated flaring events forming the apparently coherent longer-duration outburst, and a huge single isolated outburst unresolved down to the timescale of three-hours. In the latter case we estimate the corresponding γ-ray flux doubling timescale to be below one hour, which is extreme and never previously reported for any active galaxy

  2. Optical Polarimetry and Radio Observations of PKS1510-089 between 2009 and 2013

    Directory of Open Access Journals (Sweden)

    Pedro P. B. Beaklini

    2018-02-01

    Full Text Available The blazar PKS 1510-089 has shown intense activity at γ -rays in the recent years. In this work, we discussed the results of our 7 mm radio continuum and optical polarimetric monitoring between 2009 and 2013. In 2009, we detected a large rotation of the optical polarization angle that we attributed to the ejection of new polarized components. In 2011, after the occurrence of several γ -rays flares, the radio emission started to increase, reaching values never observed before. We interpreted this increase as the consequence of the superposition of several new components ejected during the γ -rays flares. A delay was measured between the maximum in the radio emission and the γ -ray flares, which favors models involving expanding components like the shock-in-jet models. Finally, we tried to understand the polarization angle variability behavior filling the gaps in our observations with published results of other polarimetric campaigns, and using the criterion of minimum variation in the polarization angle between successive observations to solve the 180° multiplicity.

  3. EVIDENCE FOR TWO LOGNORMAL STATES IN MULTI-WAVELENGTH FLUX VARIATION OF FSRQ PKS 1510-089

    Energy Technology Data Exchange (ETDEWEB)

    Kushwaha, Pankaj; Misra, Ranjeev [Inter University Center for Astronomy and Astrophysics, Pune 411007 (India); Chandra, Sunil; Singh, K. P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai 400005 (India); Sahayanathan, S. [Astrophysical Sciences Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Baliyan, K. S., E-mail: pankajk@iucaa.in [Physical Research Laboratory, Ahmedabad 380009 (India)

    2016-05-01

    We present a systematic characterization of multi-wavelength emission from blazar PKS 1510-089 using well-sampled data at near-infrared (NIR), optical, X-ray, and γ -ray energies. The resulting flux distributions, except at X-rays, show two distinct lognormal profiles corresponding to a high and a low flux level. The dispersions exhibit energy-dependent behavior except in the LAT γ -ray and optical B-band. During the low level flux states, it is higher toward the peak of the spectral energy distribution, with γ -ray being intrinsically more variable followed by IR and then optical, consistent with mainly being a result of varying bulk Lorentz factor. On the other hand, the dispersions during the high state are similar in all bands except the optical B-band, where thermal emission still dominates. The centers of distributions are a factor of ∼4 apart, consistent with anticipation from studies of extragalactic γ -ray background with the high state showing a relatively harder mean spectral index compared to the low state.

  4. Comparison of the X-Ray and Radio Light Curves of Quasar PKS 1510--089

    Science.gov (United States)

    Aller, M. F.; Marscher, A. P.; Marchenko-Jorstad, S. G.; McHardy, I. M.; Aller, H. D.

    1998-01-01

    We present results for the X-ray-bright superluminal AGN PKS 1510-089 (z=0.36) monitored weekly with the Rossi X-Ray Timing Explorer for the past four years in order to study the origin of X-ray emission from this extremely variable blazer. These RXTE data are compared with weekly cm-band flux and polarization observations from the Michigan Diameter telescope, to identify correlated activity and associated frequency-dependent time delays for constraining X-ray emission models; and bimonthly 7mm VLBA total and linearly polarized intensity imaging to identify temporal associations between X-ray events and the ejection of superluminal components and disturbances in the magnetic field, to test if the X-ray energy release is related to changes in the inner jet flow. Both the X-ray (2-20 keV) and radio flux are highly variable on timescales of weeks. The VLBA mas structure is dominated by a bright core with a weak jet; both the ejection of very fast superluminal knots and changes in the fractional polarization and EVPA of the core on timescales of one to four months are identified. Two outbursts in 1997 are well-resolved in both the centimeter and X-ray bands. Both the strong temporal association and the similar outburst shape support a causal relation, and a discrete cross-correlation analysis identifies that the X-ray lags the radio by 16 days during the bursts. Starting in 1998 the behavior changes: the correlation is weaker with the X-ray possibly leading the radio by six days. During the full time window there is a correlation between bands as expected if the radio photons are upscattered to X-ray energies. The time correlations and difference between the flat X-ray spectral index (0.0 <= alpha <= 0.5 where F(sub v) is proportional to v(exp -alpha)), and the mm-wave synchrotron spectrum (alpha = 0.8) are discussed within the framework of viable SSC models.

  5. Long-term Study of the Light Curve of PKS 1510-089 in GeV Energies

    Energy Technology Data Exchange (ETDEWEB)

    Prince, Raj; Gupta, Nayantara [Raman Research Institute, Sadashivanagar, Bangalore 560080 (India); Majumdar, Pratik, E-mail: rajprince@rri.res.in [Saha Institute of Nuclear Physics, HBNI, Kolkata, West Bengal 700064 (India)

    2017-07-20

    We have analyzed data from the flat-spectrum radio quasar PKS 1510-089 collected over a period of eight years from 2008 August to 2016 December with the Fermi -LAT. We have identified several flares of this highly variable source, studied their temporal and spectral properties in detail, and compared with previous works on flares of PKS 1510-089. Five major flares and a few subflares or substructures have been identified in our study. The fastest variability time is found to be 1.30 ± 0.18 hr between MJD 55852.063 and 55852.188, where we estimate the minimum size of the emission region to be 4.85 × 10{sup 15} cm. In most of the flares, the spectral energy distributions are better fitted with a log-parabolic distribution compared to a simple power law or a power law with exponential cutoffs. This has strong physics implications regarding the nature of the high-energy gamma-ray emission region.

  6. Multiwavelength Observations of the Powerful Gamma-ray Quasar PKS 1510-089: Clues on the Jet Composition

    Energy Technology Data Exchange (ETDEWEB)

    Kataoka, J.; Madejski, G.; Sikora, M.; Roming, P.; Chester, M.M.; Grupe, D.; Tsubuku, Y.; Sato, R.; Kawai, N.; Tosti, G.; Impiombato, D.; Kovalev, Y.Y.; Kovalev, Y.A.; Edwards, Philip G.; Wagner, S.J.; Moderski, R.; Stawarz, L.; Takahashi, T.; Watanabe, S.

    2007-09-28

    We present the results from a multiwavelength campaign conducted in August 2006 of the powerful {gamma}-ray quasar PKS 1510--089 (z = 0.361). This campaign commenced with a deep Suzaku observation lasting three days for a total exposure time of 120 ks, and continued with Swift monitoring over 18 days. Besides Swift observations, which sampled the optical/UV flux in all 6 UVOT filters as well as the X-ray spectrum in the 0.3--10 keV energy range, the campaign included ground-based optical and radio data, and yielded a quasi-simultaneous broad-band spectral energy distribution from 109 Hz to 1019 Hz. Thanks to its low instrumental background, the Suzaku observation provided a high S/N X-ray spectrum, which is well represented by an extremely hard power-law with photon index {Gamma}{approx_equal}1.2, augmented by a soft component apparent below 1 keV, which is well described by a black-body model with temperature kT {approx_equal}0.2 keV. Monitoring by Suzaku revealed temporal variability which is different between the low and high energy bands, again suggesting the presence of a second, variable component in addition to the primary power-law emission. We model the broadband spectrum of PKS 1510--089 assuming that the high energy spectral component results from Comptonization of infrared radiation produced by hot dust located in the surrounding molecular torus. In the adopted internal shock scenario, the derived model parameters imply that the power of the jet is dominated by protons but with a number of electrons/positrons exceeding a number of protons by a factor {approx} 10. We also find that inhomogeneities responsible for the shock formation, prior to the collision may produce bulk-Compton radiation which can explain the observed soft X-ray excess and possible excess at {approx} 18 keV. We note, however, that the bulk-Compton interpretation is not unique, and the observed soft excess could arise as well via some other processes discussed briefly in the text.

  7. “Orphan” γ-Ray Flares and Stationary Sheaths of Blazar Jets

    Science.gov (United States)

    MacDonald, Nicholas R.; Jorstad, Svetlana G.; Marscher, Alan P.

    2017-11-01

    Blazars exhibit flares across the entire electromagnetic spectrum. Many γ-ray flares are highly correlated with flares detected at longer wavelengths; however, a small subset appears to occur in isolation, with little or no correlated variability at longer wavelengths. These “orphan” γ-ray flares challenge current models of blazar variability, most of which are unable to reproduce this type of behavior. MacDonald et al. have developed the Ring of Fire model to explain the origin of orphan γ-ray flares from within blazar jets. In this model, electrons contained within a blob of plasma moving relativistically along the spine of the jet inverse-Compton scatter synchrotron photons emanating off of a ring of shocked sheath plasma that enshrouds the jet spine. As the blob propagates through the ring, the scattering of the ring photons by the blob electrons creates an orphan γ-ray flare. This model was successfully applied to modeling a prominent orphan γ-ray flare observed in the blazar PKS 1510-089. To further support the plausibility of this model, MacDonald et al. presented a stacked radio map of PKS 1510-089 containing the polarimetric signature of a sheath of plasma surrounding the spine of the jet. In this paper, we extend our modeling and stacking techniques to a larger sample of blazars: 3C 273, 4C 71.01, 3C 279, 1055+018, CTA 102, and 3C 345, the majority of which have exhibited orphan γ-ray flares. We find that the model can successfully reproduce these flares, while our stacked maps reveal the existence of jet sheaths within these blazars.

  8. OPTICAL AND INFRARED PHOTOMETRY OF THE BLAZAR PKS 0537-441: LONG AND SHORT TIMESCALE VARIABILITY

    International Nuclear Information System (INIS)

    Impiombato, D.; Treves, A.; Covino, S.; Foschini, L.; Fugazza, D.; Pian, E.; Tosti, G.; Ciprini, S.; Nicastro, L.

    2011-01-01

    We present a large collection of photometric data on the blazar PKS 0537-441 in the VRIJHK bands taken in 2004-2009. At least three flare-like episodes with months duration and >3 mag amplitude are apparent. The spectral energy distribution is consistent with a power law, and no indication of a thermal component is found. We searched for short timescale variability, and an interesting event was identified in the J band, with a duration of ∼25 minutes.

  9. Results of the first simultaneous X-ray, optical, and radio campaign on the blazar PKS 1622-297

    NARCIS (Netherlands)

    Meyer, Angela Osterman; Miller, H. Richard; Marshall, Kevin; Ryle, Wesley T.; Aller, Hugh; Aller, Margo; McFarland, John P.; Pollock, Joseph T.; Reichart, Daniel E.; Crain, J. Adam; Ivarsen, Kevin M.; LaCluyze, Aaron P.; Nysewander, Melissa C.

    Coordinated X-ray, optical, and radio observations of the blazar PKS 1622-297 were obtained during a three-week campaign in 2006 using the Rossi X-Ray Timing Explorer (RXTE), the University of Michigan Radio Astronomy Observatory, and optical telescopes at Cerro Tololo Inter-American Observatory.

  10. Multiwavelength Study of Gamma-Ray Bright Blazars

    Science.gov (United States)

    Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.

    2011-01-01

    We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

  11. Comparison Of Optical, UV, X-ray, And Gamma-ray Variations Of Selected Blazars In 2011

    Science.gov (United States)

    Consiglio, Santina; Marscher, A. P.; Jorstad, S. G.; Walker, G.

    2012-01-01

    We present multi-wavelength observations of several gamma-ray bright blazars. We combine optical data obtained at Maria Mitchell Observatory on Nantucket Island with space- and ground-based observations carried out with a variety of instruments. These include a number of other optical telescopes, the Fermi Gamma-ray Space Telescope at photon energies of 0.1-200 GeV, the Rossi X-Ray Timing Explorer at 2.4-10 keV, and the Swift satellite at 0.3-10 keV plus optical and UV wavelengths. Three of the observed blazars proved to be particularly active - BL Lac, 3C 279, and PKS 1510-089. BL Lac was of special interest, varying greatly in optical brightness from night to night. In addition, as reported by the VERITAS group, it exhibited a remarkable, short-lived flare at TeV gamma-ray energies on one of the nights. We cross-correlate the variations in the different wavebands in an effort to guide theoretical interpretations of the optical and high-energy emission from blazars. This project was supported by NSF/REU grant AST-0851892 and by the Nantucket Maria Mitchell Association. The research at Boston University was supported in part by NSF grants AST-0907893, and by NASA through Fermi grants NNX08AV65G and NNX11AQ03G.

  12. Detection techniques for the H.E.S.S. II telescope, data modeling of gravitational lensing and emission of blazars in HE-VHE astronomy

    International Nuclear Information System (INIS)

    Barnacka, Anna

    2013-01-01

    This thesis presents the study of four aspects of high energy astronomy. The first part of my thesis is dedicated to an aspect of instrument development for imaging atmospheric Cherenkov telescopes, namely the Level 2 trigger system of the High Energy Stereoscopic System (H.E.S.S.). My work on the project focused on the algorithm development and the Monte Carlo simulations of the trigger system and overall instrument. The hardware implementation of the system is described and its expected performances are then evaluated. The H.E.S.S. array has been used to observe the blazar PKS 1510-089. The second part of my thesis deals with the data analysis and modeling of broad-band emission of this particular blazar. In part II of my thesis, I am presenting the analysis of the H.E.S.S. data: the light curve and spectrum of PKS 1510-089, together with the FERMI data and a collection of multi-wavelength data obtained with various instruments. I am presenting the model of PKS 1510-089 observations carried out during a flare recorded by H.E.S.S.. The model is based on a single zone internal shock scenario. The third part of my thesis deals with blazars observed by the FERMI-LAT, but from the point of view of other phenomena: a strong gravitational lensing. This part of my thesis shows the first evidence for gravitational lensing phenomena in high energy gamma-rays. This evidence comes from the observation of a gravitational lens system induced echo in the light curve of the distant blazar PKS 1830-211. Traditional methods for the estimation of time delays in gravitational lensing systems rely on the cross-correlation of the light curves from individual images. In my thesis, I used 300 MeV-30 GeV photons detected by the Fermi-LAT instrument. The FERMI-LAT instrument cannot separate the images of known lenses. The observed light curve is thus the superposition of individual image light curves. The FERMI-LAT instrument has the advantage of providing long, evenly spaced, time series

  13. First Nustar Observations of the Bl Lac-Type Blazar Pks 2155-304: Constraints on the Jet Content and Distribution of Radiating Particles

    DEFF Research Database (Denmark)

    Madejski, G. M.; Nalewajko, K.; Madsen, K. K.

    2016-01-01

    We report the first hard X-ray observations with NuSTAR of the BL Lac-type blazar PKS 2155-304, augmented with soft X-ray data from XMM-Newton and γ-ray data from the Fermi Large Area Telescope, obtained in 2013 April when the source was in a very low flux state. A joint NuSTAR and XMM spectrum, ...

  14. INTEGRAL observations of the GeV blazar PKS 1502+106 and the hard X-ray bright Seyfert galaxy Mkn 841

    Czech Academy of Sciences Publication Activity Database

    Pian, E.; Ubertini, P.; Bazzano, A.; Beckmann, V.; Eckert, D.; Ghisellini, G.; Pursimo, T.; Tagliaferri, G.; Tavecchio, F.; Türler, M.; Bianchi, S.; Bianchin, V.; Hudec, René; Maraschi, L.; Raiteri, C.M.; Soldi, S.; Treves, A.; Villata, M.

    2011-01-01

    Roč. 526, February (2011), A125/1-A125/7 ISSN 0004-6361 Grant - others:ESA(XE) ESA PECS project No.98023; GA ČR(CZ) ga102/09/0997 Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * blazar PKS 1502+106 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

  15. Multifrequency observations of the Blazar PKS 0537-441 in a moderately active state

    International Nuclear Information System (INIS)

    Tanzi, E.G.; Chiappetti, L.; Barr, P.; Bouchet, P.; Cristiani, S.; EXOSAT Observatory, Darmstadt, West Germany; European Southern Observatory, La Silla, Chile)

    1986-01-01

    PKS 0537-441 was observed during an active state in February 1985 at infrared, optical, UV, and X-ray frequencies. Comparison with earlier measurements indicates that the source brightened by a factor of approximately 2 in all bands. This suggests that the same spatial region may be responsible for the emission in the whole spectral range observed. 19 references

  16. Multifrequency observations of the Blazar PKS 0537-441 in a moderately active state

    Energy Technology Data Exchange (ETDEWEB)

    Tanzi, E.G.; Chiappetti, L.; Barr, P.; Bouchet, P.; Cristiani, S.

    1986-12-01

    PKS 0537-441 was observed during an active state in February 1985 at infrared, optical, UV, and X-ray frequencies. Comparison with earlier measurements indicates that the source brightened by a factor of approximately 2 in all bands. This suggests that the same spatial region may be responsible for the emission in the whole spectral range observed. 19 references.

  17. Gamma-Ray Flaring Activity from the Gravitationally Lensed Blazar PKS 1830-211 Observed by Fermi LAT

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A. A.; et al.

    2015-01-23

    The Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope routinely detects the MeV-peaked flat-spectrum radio quasar PKS 1830–211 (z = 2.507). Its apparent isotropic γ-ray luminosity (E > 100 MeV), averaged over ~3 years of observations and peaking on 2010 October 14/15 at 2.9 × 10(50) erg s(–)(1), makes it among the brightest high-redshift Fermi blazars. No published model with a single lens can account for all of the observed characteristics of this complex system. Based on radio observations, one expects time-delayed variability to follow about 25 days after a primary flare, with flux about a factor of 1.5 less. Two large γ-ray flares of PKS 1830–211 have been detected by the LAT in the considered period, and no substantial evidence for such a delayed activity was found. This allows us to place a lower limit of about 6 on the γ-ray flux ratio between the two lensed images. Swift XRT observations from a dedicated Target of Opportunity program indicate a hard spectrum with no significant correlation of X-ray flux with the γ-ray variability. The spectral energy distribution can be modeled with inverse Compton scattering of thermal photons from the dusty torus. The implications of the LAT data in terms of variability, the lack of evident delayed flare events, and different radio and γ-ray flux ratios are discussed. Microlensing effects, absorption, size and location of the emitting regions, the complex mass distribution of the system, an energy-dependent inner structure of the source, and flux suppression by the lens galaxy for one image path may be considered as hypotheses for understanding our results.

  18. Swift detections of the flaring blazar GAIA 18ayp (PKS 2333-415) in X-rays and the UV

    Science.gov (United States)

    Grupe, Dirk; Komossa, S.; Angioni, R.; Schartel, N.

    2018-04-01

    We report Swift observations of the z=1.41 QSO GAIA 18ayp (PKS 2333-415) which was detected by GAIA in an optically flaring state on 2018-April-14. Swift observed GAIA 18ayp on 2018 April 23 for a total of 1.4 ks. The QSO is clearly detected in X-rays and the UV. The X-ray position found using the enhanced XRT position (Goad et al. 2007, Evans et al. 2009) is RA-2000 = 23 36 34.1, Dec-2000 = -41 15 21.4 with an uncertainty of 3.0".

  19. Through the Ring of Fire: A Study of the Origin of Orphan Gamma-ray Flares in Blazars

    Science.gov (United States)

    MacDonald, Nicholas R.; Marscher, Alan P.; Jorstad, Svetlana G.; Joshi, Manasvita

    2014-06-01

    Blazars exhibit flares across the electromagnetic spectrum. Many gamma-ray flares are highly correlated with flares detected at optical wavelengths; however, a small subset appear to occur in isolation, with no counterpart in the other wave bands. These "orphan" gamma-ray flares challenge current models of blazar variability, most of which are unable to reproduce this type of behavior. We present numerical calculations of the time variable emission of a blazar based on a proposal by Marscher et al. (2010) to explain such events. In this model, a plasmoid ("blob") consisting of a power-law distribution of electrons propagates relativistically along the spine of a blazar jet and passes through a synchrotron emitting ring of electrons representing a shocked portion of the jet sheath. This ring supplies a source of seed photons that are inverse-Compton scattered by the electrons in the moving blob. As the blob approaches the ring, the photon density in the co-moving frame of the plasma increases, resulting in an orphan gamma-ray flare that then dissipates as the blob passes through and then moves away from the ring. The model includes the effects of radiative cooling and a spatially varying magnetic field. Support for the plausibility of this model is provided by observations by Marscher et al.(2010) of an isolated gamma-ray flare that was correlated with the passage of a superluminal knot through the inner jet of quasar PKS 1510-089. Synthetic light-curves produced by this new model are compared to the observed light-curves from this event. In addition, we present polarimetric observations that point to the existence of a jet sheath in the quasar 3C 273. A rough estimate of the bolometric luminosity of the sheath results in a value of ~10^45 erg s^-1 10% of the jet luminosity). This inferred sheath luminosity indicates that the jet sheath in 3C 273 can provide a significant source of seed photons that need to be taken into account when modeling the non

  20. Shaping the GeV-spectra of bright blazars

    Science.gov (United States)

    Hunger, L.; Reimer, A.

    2016-05-01

    -scattered BLR radiation only, and provide the corresponding injection parameters. Here the spectral turn-over is explained by a corresponding break in the ambient electron spectrum. In a similar way, we also applied our model to the FSRQ PKS 1510-089, and present two possible model fits. Here, the GeV-spectrum is either dominated by Compton-scattered accretion disk radiation or is a combination of Compton-scattered disk and BLR radiation. We provide the required injection parameters for these fits. In all four scenarios, we found that impulsive particle injection is disfavored. Conclusions: The presented injection model that is embedded in a leptonic blazar emission model for external Compton-loss dominated jets of AGN aims towards bridging jet emission with acceleration models using a phenomenological approach. Blazar spectral data can be analyzed with this model to constrain injection parameters, in addition to the conventional parameter values of steady-state emission models, if sufficient broad multifrequency coverage is provided.

  1. GAMMA–GAMMA ABSORPTION IN THE BROAD LINE REGION RADIATION FIELDS OF GAMMA-RAY BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Böttcher, Markus; Els, Paul, E-mail: Markus.Bottcher@nwu.ac.za [Centre for Space Research, North-West University, Potchefstroom, 2531 (South Africa)

    2016-04-20

    The expected level of γγ absorption in the Broad Line Region (BLR) radiation field of γ -ray loud Flat Spectrum Radio Quasars (FSRQs) is evaluated as a function of the location of the γ -ray emission region. This is done self-consistently with parameters inferred from the shape of the spectral energy distribution (SED) in a single-zone leptonic EC-BLR model scenario. We take into account all geometrical effects both in the calculation of the γγ opacity and the normalization of the BLR radiation energy density. As specific examples, we study the FSRQs 3C279 and PKS 1510-089, keeping the BLR radiation energy density at the location of the emission region fixed at the values inferred from the SED. We confirm previous findings that the optical depth due to γγ absorption in the BLR radiation field exceeds unity for both 3C279 and PKS 1510-089 for locations of the γ -ray emission region inside the inner boundary of the BLR. It decreases monotonically, with distance from the central engine and drops below unity for locations within the BLR. For locations outside the BLR, the BLR radiation energy density required for the production of GeV γ -rays rapidly increases beyond observational constraints, thus making the EC-BLR mechanism implausible. Therefore, in order to avoid significant γγ absorption by the BLR radiation field, the γ -ray emission region must therefore be located near the outer boundary of the BLR.

  2. Models for Very Rapid High-Energy γ-Ray Variability in Blazars G. E. ...

    Indian Academy of Sciences (India)

    blazar PKS 2155−304 and present synthetic light-curves of the kind that ... radio wavelengths led to a similar situation (see Wagner & Witzel 1995 for a review). Some of the ... If the instabilities grow, the two components will eventually mix.

  3. The Study on the Physical Properties of Blazar Jets

    Science.gov (United States)

    Kang, S. J.

    2017-09-01

    of LSP blazars is the same as that of FR IIs, we find that it is an electron-positron pair dominated leptonic jet in these blazars, and the number density of electron-positron pairs is several times higher than that of electron-proton pairs, but the jet power is still dominated by protons. For the high-synchrotron-peaked (HSP) BL Lac PKS 1424+240, the SED fitting with the synchrotron self-Compton (SSC) model gave unreasonable fitting parameters (e.g., a very large Doppler factor δ). In this work, we take into account the possible external soft photon field, and then fit the multi-waveband SEDs of blazar PKS 1424+240 with one-zone leptonic jet models in both states. We find the SSC+external-Compton (EC) model can give a better fitting result if the EC process is included. However, the needed energy density of external soft photon field (U_{ext}) is much lower than the typical value. This result is consistent with the results of some other BL Lacs, where the BLR or torus is very weak or disappearing. It means that there is evolution of the energy density of external soft photon field with decreasing of the luminosity of blazars (the flat spectrum radio quasars (FSRQs)-BL Lac: low energy peaked BL Lac (LBL)-intermediate energy peaked BL Lac (IBL)-high energy peaked BL Lac (HBL)). And on this basis, in the chapter 5, we further explore the possible evolution of the external soft photon field of blazars based on the EC process. We employ the one-zone homogeneous leptonic jet model and χ2 procedure to fit simultaneously or quasi-simultaneously multi-waveband SEDs for a sample of blazars with a wide distribution of luminosities. In our model, we set Uext as a free parameter. Studying the energy density of the external photon field in different subclasses of blazars, we find: (1) the Uext of the high luminosity blazar (FSRQs and LBLs) keeps roughly as a constant, which is, however, smaller than that constrained from BLR observations. Assuming IR as the source of soft

  4. Unveiling the nature of the γ-ray emitting active galactic nucleus PKS 0521-36

    International Nuclear Information System (INIS)

    D'Ammando, F.; Istituto Nazionale di Astrofisica; Orienti, M.; Tavecchio, F.; Ghisellini, G.

    2015-01-01

    PKS 0521-36 is an active galactic nucleus (AGN) with uncertain classification. Here, we investigate the properties of this source from radio to γ-rays. The broad emission lines in the optical and ultraviolet bands and steep radio spectrum indicate a possible classification as an intermediate object between broad-line radio galaxies (BLRG) and steep spectrum radio quasars (SSRQ). On pc-scales PKS 0521-36 shows a knotty structure similar to misaligned AGN. The core dominance and the γ-ray properties are similar to those estimated for other SSRQ and BLRG detected in γ-rays, suggesting an intermediate viewing angle with respect to the observer. In this context the flaring activity detected from this source by Fermi-Large Area Telescope between 2010 June and 2012 February is very intriguing. We discuss the γ-ray emission of this source in the framework of the structured jet scenario, comparing the spectral energy distribution (SED) of the flaring state in 2010 June with that of a low state. We present three alternative models corresponding to three different choices of the viewing angles θv = 6°, 15°, and 20°. We obtain a good fit for the first two cases, but the SED obtained with θv = 15° if observed at a small angle does not resemble that of a typical blazar since the synchrotron emission should dominate by a large factor (~100) the inverse Compton component. This suggests that a viewing angle between 6° and 15° is preferred, with the rapid variability observed during γ-ray flares favouring a smaller angle. However, we cannot rule out that PKS 0521-36 is the misaligned counterpart of a synchrotron-dominated blazar.

  5. Stochastic modeling of the Fermi/LAT γ-ray blazar variability

    Energy Technology Data Exchange (ETDEWEB)

    Sobolewska, M. A.; Siemiginowska, A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Kelly, B. C. [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93107 (United States); Nalewajko, K., E-mail: malgosia@camk.edu.pl [JILA, University of Colorado and National Institute of Standards and Technology, 440 UCB, Boulder, CO 80309 (United States)

    2014-05-10

    We study the γ-ray variability of 13 blazars observed with the Fermi/Large Area Telescope (LAT). These blazars have the most complete light curves collected during the first four years of the Fermi sky survey. We model them with the Ornstein-Uhlenbeck (OU) process or a mixture of the OU processes. The OU process has power spectral density (PSD) proportional to 1/f {sup α} with α changing at a characteristic timescale, τ{sub 0}, from 0 (τ >> τ{sub 0}) to 2 (τ << τ{sub 0}). The PSD of the mixed OU process has two characteristic timescales and an additional intermediate region with 0 < α < 2. We show that the OU model provides a good description of the Fermi/LAT light curves of three blazars in our sample. For the first time, we constrain a characteristic γ-ray timescale of variability in two BL Lac sources, 3C 66A and PKS 2155-304 (τ{sub 0} ≅ 25 days and τ{sub 0} ≅ 43 days, respectively, in the observer's frame), which are longer than the soft X-ray timescales detected in blazars and Seyfert galaxies. We find that the mixed OU process approximates the light curves of the remaining 10 blazars better than the OU process. We derive limits on their long and short characteristic timescales, and infer that their Fermi/LAT PSD resemble power-law functions. We constrain the PSD slopes for all but one source in the sample. We find hints for sub-hour Fermi/LAT variability in four flat spectrum radio quasars. We discuss the implications of our results for theoretical models of blazar variability.

  6. Blazar Sequence in Fermi Era Liang Chen

    Indian Academy of Sciences (India)

    Abstract. In this paper, we review the latest research results on the topic of blazar sequence. It seems that the blazar sequence is phenomenally ruled out, while the theoretical blazar sequence still holds. We point out that black hole mass is a dominated parameter accounting for high-power- high-synchrotron-peaked and ...

  7. Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

    Science.gov (United States)

    Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

    2018-01-01

    Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

  8. Gamma-Ray and Multiwavelength Emission from Blazars Meg Urry

    Indian Academy of Sciences (India)

    Abstract. Blazars are now well understood as approaching relativistic jets aligned with the line of sight. The long-time uncertainty about the demographics of blazars is starting to become clearer: since the Fermi blazar sample includes a larger fraction of high-frequency peaked blazars. (like the typical X-ray-selected blazars ...

  9. X-Ray Intraday Variability of Five TeV Blazars with NuSTAR

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Ashwani; Gupta, Alok C. [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263002 (India); Wiita, Paul J., E-mail: ashwanitapan@gmail.com, E-mail: acgupta30@gmail.com, E-mail: wiitap@tcnj.edu [Department of Physics, The College of New Jersey, 2000 Pennington Road, Ewing, NJ 08628-0718 (United States)

    2017-06-01

    We have examined 40 Nuclear Spectroscopic Telescope Array ( NuSTAR ) light curves (LCs) of five TeV emitting high synchrotron peaked blazars: 1ES 0229+200, Mrk 421, Mrk 501, 1ES 1959+650, and PKS 2155−304. Four of the blazars showed intraday variability in the NuSTAR energy range of 3–79 keV. Using an autocorrelation function analysis we searched for intraday variability timescales in these LCs and found indications of several between 2.5 and 32.8 ks in eight LCs of Mrk 421, a timescale around 8.0 ks for one LC of Mrk 501, and timescales of 29.6 and 57.4 ks in two LCs of PKS 2155-304. The other two blazars’ LCs do not show any evidence for intraday variability timescales shorter than the lengths of those observations; however, the data were both sparser and noisier for them. We found positive correlations with zero lag between soft (3–10 keV) and hard (10–79 keV) bands for most of the LCs, indicating that their emissions originate from the same electron population. We examined spectral variability using a hardness ratio analysis and noticed a general “harder-when-brighter” behavior. The 22 LCs of Mrk 421 observed between 2012 July and 2013 April show that this source was in a quiescent state for an extended period of time and then underwent an unprecedented double-peaked outburst while monitored on a daily basis during 2013 April 10–16. We briefly discuss models capable of explaining these blazar emissions.

  10. Radio and γ -Ray Variability in the BL Lac PKS 0219−164: Detection of Quasi-periodic Oscillations in the Radio Light Curve

    Energy Technology Data Exchange (ETDEWEB)

    Bhatta, Gopal, E-mail: gopalbhatta716@gmail.com [Astronomical Observatory of the Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland); Mt. Suhora Observatory, Pedagogical University, ul. Podchorazych 2, 30-084 Kraków (Poland)

    2017-09-20

    In this work, we explore the long-term variability properties of the blazar PKS 0219−164 in the radio and the γ -ray regime, utilizing the OVRO 15 GHz and the Fermi /LAT observations from the period 2008–2017. We found that γ -ray emission is more variable than the radio emission implying that γ -ray emission possibly originated in more compact regions while the radio emission represented continuum emission from the large-scale jets. Also, in the γ -ray, the source exhibited spectral variability, characterized by the softer-when-brighter trend, a less frequently observed feature in the high-energy emission by BL Lacs. In radio, using Lomb–Scargle periodogram and weighted wavelet z -transform, we detected a strong signal of quasi-periodic oscillation (QPO) with a periodicity of 270 ± 26 days with possible harmonics of 550 ± 42 and 1150 ± 157 day periods. At a time when detections of QPOs in blazars are still under debate, the observed QPO with high statistical significance (∼97%–99% global significance over underlying red-noise processes) and persistent over nearly 10 oscillations could make one of the strongest cases for the detection of QPOs in blazar light curves. We discuss various blazar models that might lead to the γ -ray and radio variability, QPO, and the achromatic behavior seen in the high-energy emission from the source.

  11. Frequency dependent polarization in blazars

    International Nuclear Information System (INIS)

    Bjoernsson, C.I.

    1984-10-01

    It is argued that the intrinsic frequency dependent polarization in blazars finds its most straightforward explanations in terms of a single rather than a multicomponent sourcemodel. In order to reproduce the observations, under the assumption that the emission mechanism is optically thin synchrotron radiation, both a well ordered magnetic field and an electron distribution with a sharp break or cuttoff are necessary. Non-uniform pitch angle distribution and/or environments where synchrotron losses are important are both conducive to producing strong frequency dependent polarization. Reasons are put forth as to why such conditions ar expected to occur in blazars. Two specific models are discussed in detail and it is shown that they are both able to produce strong frequency dependent polarization, even when the spectral index changes by a small amount only. (orig.)

  12. Automated Blazar Light Curves Using Machine Learning

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Spencer James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-27

    This presentation describes a problem and methodology pertaining to automated blazar light curves. Namely, optical variability patterns for blazars require the construction of light curves and in order to generate the light curves, data must be filtered before processing to ensure quality.

  13. First detection in gamma-rays of a young radio galaxy: Fermi -LAT observations of the compact symmetric object PKS 1718−649

    Energy Technology Data Exchange (ETDEWEB)

    Migliori, G.; Loh, A.; Corbel, S. [Laboratoire AIM (CEA/IRFU—CNRS/INSU—Université Paris Diderot), CEA DSM/SAp, F-91191 Gif-sur-Yvette (France); Siemiginowska, A.; Sobolewska, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Ostorero, L. [Dipartimento di Fisica, Università degli Studi di Torino and Istituto Nazionale di Fisica Nucleare (INFN), Via P. Giuria 1, I-10125 Torino (Italy); Stawarz, Ł., E-mail: giulia.migliori@cea.fr [Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland)

    2016-04-20

    We report the γ -ray detection of a young radio galaxy, PKS 1718−649, belonging to the class of compact symmetric objects (CSOs), with the Large Area Telescope (LAT) on board the Fermi satellite. The third Fermi Gamma-ray LAT catalog (3FGL) includes an unassociated γ -ray source, 3FGL J1728.0−6446, located close to PKS 1718−649. Using the latest Pass 8 calibration, we confirm that the best-fit 1 σ position of the γ -ray source is compatible with the radio location of PKS 1718−649. Cross-matching of the γ -ray source position with the positions of blazar sources from several catalogs yields negative results. Thus, we conclude that PKS 1718−649 is the most likely counterpart to the unassociated LAT source. We obtain a detection test statistics TS ∼ 36 (>5 σ ) with a best-fit photon spectral index Γ = 2.9 ± 0.3 and a 0.1–100 GeV photon flux density F {sub 0.1−100} {sub GeV} = (11.5 ± 0.3) × 10{sup −9} ph cm{sup −2} s{sup −1}. We argue that the linear size (∼2 pc), the kinematic age (∼100 years), and the source distance ( z = 0.014) make PKS 1718−649 an ideal candidate for γ -ray detection in the framework of the model proposing that the most compact and the youngest CSOs can efficiently produce GeV radiation via inverse-Compton scattering of the ambient photon fields by the radio lobe non-thermal electrons. Thus, our detection of the source in γ -rays establishes young radio galaxies as a distinct class of extragalactic high-energy emitters and yields a unique insight on the physical conditions in compact radio lobes interacting with the interstellar medium of the host galaxy.

  14. Structure of PKS 1148-001

    International Nuclear Information System (INIS)

    Venugopal, V.R.; Ananthakrishnan, S.; Swarup, G.; Pynzar, A.V.; Udaltsov, V.A.

    1985-01-01

    Interplanetary scintillation (IPS) observations of PKS1148-001 at 326.5 and 102.5 MHz are described. The results from these are combined with published VLBI results at various frequencies to derive a three-component model for the source. The three components have sizes 0.0015, 0.01 and 0.1 arcsec and synchrotron self-absorption below frequencies about 1.5, 0.4 and 0.05 GHz respectively. This model is consistent with the total flux density spectrum. It is suggested that the results of the earlier two IPS surveys made at 327 and 408 MHz at Ooty and Arecibo need to be revised, since PKS 1148-001 is more compact than IPS calibrators used in those surveys. (author)

  15. Partai Islam Se-Malaysia (PAS) dan Partai Keadilan Sejahtera (PKS) sebagai Partai Islam Pendukung Demokrasi PKS Pada Pemilu

    OpenAIRE

    Ahmad Ali Nurdin

    2015-01-01

    The article compares the achievement of Partai Islam se-Malaysia (PAS) and Partai Keadilan Sejahtera (PKS) in the latest general election held in 2013 in Malaysia and in 2014 in Indonesia. The writer finds that the political performance of PAS and PKS has indicated differently contrast results. While political electability of PAS in the 2013 Malaysia’s general election has disappointed this party, PKS has successfully proved that surveys held by a number of survey institutes—predicting that t...

  16. BLAZAR SPECTRAL PROPERTIES AT 74 MHz

    Energy Technology Data Exchange (ETDEWEB)

    Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Paggi, A.; D' Abrusco, R. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)

    2013-10-01

    Blazars are the most extreme class of active galactic nuclei. Despite a previous investigation at 102 MHz for a small sample of BL Lac objects and our recent analysis of blazars detected in the Westerbork Northern Sky Survey, a systematic study of the blazar spectral properties at frequencies below 100 MHz has been never carried out. In this paper, we present the first analysis of the radio spectral behavior of blazars based on the recent Very Large Array Low-frequency Sky Survey (VLSS) at 74 MHz. We search for blazar counterparts in the VLSS catalog, confirming that they are detected at 74 MHz. We then show that blazars present radio-flat spectra (i.e., radio spectral indices of ∼0.5) when evaluated, which also about an order of magnitude in frequency lower than previous analyses. Finally, we discuss the implications of our findings in the context of the blazars-radio galaxies connection since the low-frequency radio data provide a new diagnostic tool to verify the expectations of the unification scenario for radio-loud active galaxies.

  17. Testing the Equivalence Principle and Lorentz Invariance with PeV Neutrinos from Blazar Flares.

    Science.gov (United States)

    Wang, Zi-Yi; Liu, Ruo-Yu; Wang, Xiang-Yu

    2016-04-15

    It was recently proposed that a giant flare of the blazar PKS B1424-418 at redshift z=1.522 is in association with a PeV-energy neutrino event detected by IceCube. Based on this association we here suggest that the flight time difference between the PeV neutrino and gamma-ray photons from blazar flares can be used to constrain the violations of equivalence principle and the Lorentz invariance for neutrinos. From the calculated Shapiro delay due to clusters or superclusters in the nearby universe, we find that violation of the equivalence principle for neutrinos and photons is constrained to an accuracy of at least 10^{-5}, which is 2 orders of magnitude tighter than the constraint placed by MeV neutrinos from supernova 1987A. Lorentz invariance violation (LIV) arises in various quantum-gravity theories, which predicts an energy-dependent velocity of propagation in vacuum for particles. We find that the association of the PeV neutrino with the gamma-ray outburst set limits on the energy scale of possible LIV to >0.01E_{pl} for linear LIV models and >6×10^{-8}E_{pl} for quadratic order LIV models, where E_{pl} is the Planck energy scale. These are the most stringent constraints on neutrino LIV for subluminal neutrinos.

  18. Core shift effect in blazars

    Science.gov (United States)

    Agarwal, A.; Mohan, P.; Gupta, Alok C.; Mangalam, A.; Volvach, A. E.; Aller, M. F.; Aller, H. D.; Gu, M. F.; Lähteenmäki, A.; Tornikoski, M.; Volvach, L. N.

    2017-07-01

    We studied the pc-scale core shift effect using radio light curves for three blazars, S5 0716+714, 3C 279 and BL Lacertae, which were monitored at five frequencies (ν) between 4.8 and 36.8 GHz using the University of Michigan Radio Astronomical Observatory (UMRAO), the Crimean Astrophysical Observatory (CrAO) and Metsähovi Radio Observatory for over 40 yr. Flares were Gaussian fitted to derive time delays between observed frequencies for each flare (Δt), peak amplitude (A) and their half width. Using A ∝ να, we infer α in the range of -16.67-2.41 and using Δ t ∝ ν ^{1/k_r}, we infer kr ∼ 1, employed in the context of equipartition between magnetic and kinetic energy density for parameter estimation. From the estimated core position offset (Ωrν) and the core radius (rcore), we infer that opacity model may not be valid in all cases. The mean magnetic field strengths at 1 pc (B1) and at the core (Bcore) are in agreement with previous estimates. We apply the magnetically arrested disc model to estimate black hole spins in the range of 0.15-0.9 for these blazars, indicating that the model is consistent with expected accretion mode in such sources. The power-law-shaped power spectral density has slopes -1.3 to -2.3 and is interpreted in terms of multiple shocks or magnetic instabilities.

  19. Multiwavelength Emission from Blazars – Conference Summary ...

    Indian Academy of Sciences (India)

    emission—radio emission—host galaxies—blazar demographics— .... We still need a comprehensive analysis of the selection effects operating in existing ... to the M-sigma relation, or to investigate the evolution of the fundamental plane for.

  20. Radio core dominance of Fermi blazars

    Science.gov (United States)

    Pei, Zhi-Yuan; Fan, Jun-Hui; Liu, Yi; Yuan, Yi-Hai; Cai, Wei; Xiao, Hu-Bing; Lin, Chao; Yang, Jiang-He

    2016-07-01

    During the first 4 years of mission, Fermi/LAT detected 1444 blazars (3FGL) (Ackermann et al. in Astrophys. J. 810:14, 2015). Fermi/LAT observations of blazars indicate that Fermi blazars are luminous and strongly variable with variability time scales, for some cases, as short as hours. Those observations suggest a strong beaming effect in Fermi/LAT blazars. In the present work, we will investigate the beaming effect in Fermi/LAT blazars using a core-dominance parameter, R = S_{core}/ S_{ext.}, where S_{core} is the core emission, while S_{ext.} is the extended emission. We compiled 1335 blazars with available core-dominance parameter, out of which 169 blazars have γ-ray emission (from 3FGL). We compared the core-dominance parameters, log R, between the 169 Fermi-detected blazars (FDBs) and the rest non-Fermi-detected blazars (non-FDBs), and we found that the averaged values are R+(2.25±0.10), suggesting that a source with larger log R has larger V.I. value. Thirdly, we compared the mean values of radio spectral index for FDBs and non-FDBs, and we obtained < α_{radio}rangle =0.06±0.35 for FDBs and < α_{radio}rangle =0.57±0.46 for non-FDBs. If γ-rays are composed of two components like radio emission (core and extended components), then we can expect a correlation between log R and the γ-ray spectral index. When we used the radio core-dominance parameter, log R, to investigate the relationship, we found that the spectral index for the core component is α_{γ}|_{core} = 1.11 (a photon spectral index of α_{γ}^{ph}|_{core} = 2.11) and that for the extended component is α_{γ}|_{ext.} = 0.70 (a photon spectral index of α_{γ}^{ph}|_{ext.} = 1.70). Some discussions are also presented.

  1. Blazars in Hard X-rays

    Science.gov (United States)

    Ghisellini, Gabriele

    2009-05-01

    Although blazars are thought to emit most of their luminosity in the γ-ray band, there are subclasses of them very prominent in hard X-rays. These are the best candidates to be studied by Simbol-X. They are at the extremes of the blazar sequence, having very small or very high jet powers. The former are the class of TeV emitting BL Lacs, whose synchrotron emission often peaks at tens of keV or more. The latter are the blazars with the most powerful jets, have high black hole masses accreting at high (i.e. close to Eddington) rates. These sources are predicted to have their high energy peak even below the MeV band, and therefore are very promising candidates to be studied with Simbol-X.

  2. The Varied Variability of PKS 0736+017

    Science.gov (United States)

    Clements, S. D.; Cubides, L. A.; Greiwe, C. L.; Habermas, K. S.; Jenks, A. K.; Long, A. M.; Patel, J. A.; Torres, Y. V.

    2003-05-01

    The flat spectrum radio quasar PKS 0736+017 has been an exciting observing target, exhibiting diverse optical variability behaviors and even sharing its field one evening with a minor planet. The behavior of PKS 0736+017 has included persistently faint and quiescent periods, episodes of quasi-periodic microvariability, dramatic flaring events, and periods of unusual oscillations. These assorted behaviors are examined, with particular emphasis on the quasi-periodic variations and unusual oscillations that accompanied a dramatic flare.

  3. The BL Lac objects PKS 1144-379

    International Nuclear Information System (INIS)

    Nicolson, G.D.; Glass, I.S.; Feast, M.W.; Andrews, P.J.

    1979-01-01

    The highly variable radio source PKS 1144-379 has been monitored at 13 cm and 6 cm over a period of 3 years. It has been identified with an object whose photographic image is star-like. From infrared photometry, UBVRsub(KC)Isub(KC) photometry and spectroscopy, it is concluded that PKS 1144-379 is a BL Lac object with msub(v) approximately = 16.2. (author)

  4. Optical spectroscopic observations of blazars and γ-ray blazar candidates in the sloan digital sky survey data release nine

    Energy Technology Data Exchange (ETDEWEB)

    Massaro, F.; Masetti, N.; D' Abrusco, R.; Paggi, A.; Funk, S.

    2014-09-09

    We present an analysis of the optical spectra available in the Sloan Digital Sky Survey data release nine (SDSS DR9) for the blazars listed in the ROMA-BZCAT and for the γ-ray blazar candidates selected according to their IR colors. First, we adopt a statistical approach based on Monte Carlo simulations to find the optical counterparts of the blazars listed in the ROMA-BZCAT catalog. Then, we crossmatched the SDSS spectroscopic catalog with our selected samples of blazars and γ-ray blazar candidates, searching for those with optical spectra available to classify our blazar-like sources and, whenever possible, to confirm their redshifts. Our main objectives are to determine the classification of uncertain blazars listed in the ROMA-BZCAT and to discover new gamma-ray blazars. For the ROMA-BZCAT sources, we investigated a sample of 84 blazars, confirming the classification for 20 of them and obtaining 18 new redshift estimates. For the γ-ray blazars, indicated as potential counterparts of unassociated Fermi sources or with uncertain nature, we established the blazar-like nature of 8 out of the 27 sources analyzed and confirmed 14 classifications.

  5. Astronomical Plate Archives and Binary Blazars Studies

    Czech Academy of Sciences Publication Activity Database

    Hudec, René

    2011-01-01

    Roč. 32, 1-2 (2011), s. 91-95 ISSN 0250-6335. [Conference on Multiwavelength Variability of Blazars. Guangzhou, 22,09,2010-24,09,2010] R&D Projects: GA ČR GA205/08/1207 Grant - others:GA ČR(CZ) GA102/09/0997; MŠMT(CZ) ME09027 Institutional research plan: CEZ:AV0Z10030501 Keywords : astronomical plates * plate archives archives * binary blazars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.400, year: 2011

  6. X-ray monitoring of the radio and γ-ray loud Narrow-Line Seyfert 1 Galaxy PKS2004–447

    Directory of Open Access Journals (Sweden)

    Kreikenbohm A.

    2013-12-01

    Full Text Available We present preliminary results of the X-ray analysis of XMM-Newton and Swift observations as part of a multi-wavelength monitoring campaign in 2012 of the radio-loud narrow line Seyfert 1 galaxy PKS 2004–447. The source was recently detected in γ-rays by Fermi/LAT among only four other galaxies of that type. The 0:5 – 10 keV X-ray spectrum is well-described by a simple absorbed powerlaw (Γ ∼ 1.6. The source brightness exhibits variability on timescales of months to years with indications for spectral variability, which follows a “bluer-when-brighter” behaviour, similar to blazars.

  7. Partai Islam Se-Malaysia (PAS dan Partai Keadilan Sejahtera (PKS sebagai Partai Islam Pendukung Demokrasi PKS Pada Pemilu

    Directory of Open Access Journals (Sweden)

    Ahmad Ali Nurdin

    2015-11-01

    Full Text Available The article compares the achievement of Partai Islam se-Malaysia (PAS and Partai Keadilan Sejahtera (PKS in the latest general election held in 2013 in Malaysia and in 2014 in Indonesia. The writer finds that the political performance of PAS and PKS has indicated differently contrast results. While political electability of PAS in the 2013 Malaysia’s general election has disappointed this party, PKS has successfully proved that surveys held by a number of survey institutes—predicting that the party would cease within the 2014 Indonesia’s national election—were totally false. Many political figures of PAS have failed to gain positions in the legislative assembly. Meanwhile, in viewing PKS’s political performance during the 2014 national election, one may assume that this party was luckily survive. This is because, a number of surveys conducted before the election had predicted that PKS could be considered lucky when it was able to gain five percent of vote, as its former president has been suspected of being corrupt for his involvement in cows import. However, the fact shows that PKS has not only magnificently survived but it was even able to gain almost seven percent of voters’ vote. Unfortunately, PKS was unsuccessful to achieve its political target to be the biggest three of national vote.

  8. The CLASS blazar survey - II. Optical properties

    NARCIS (Netherlands)

    Caccianiga, A; Marcha, MJ; Anton, S; Mack, KH; Neeser, MJ

    2002-01-01

    This paper presents the optical properties of the objects selected in the CLASS blazar survey. Because an optical spectrum is now available for 70 per cent of the 325 sources present in the sample, a spectral classification, based on the appearance of the emission/absorption lines, is possible. A

  9. Modelling blazar flaring using a time-dependent fluid jet emission model - an explanation for orphan flares and radio lags

    Science.gov (United States)

    Potter, William J.

    2018-01-01

    Blazar jets are renowned for their rapid violent variability and multiwavelength flares, however, the physical processes responsible for these flares are not well understood. In this paper, we develop a time-dependent inhomogeneous fluid jet emission model for blazars. We model optically thick radio flares for the first time and show that they are delayed with respect to the prompt optically thin emission by ∼months to decades, with a lag that increases with the jet power and observed wavelength. This lag is caused by a combination of the travel time of the flaring plasma to the optically thin radio emitting sections of the jet and the slow rise time of the radio flare. We predict two types of flares: symmetric flares - with the same rise and decay time, which occur for flares whose duration is shorter than both the radiative lifetime and the geometric path-length delay time-scale; extended flares - whose luminosity tracks the power of particle acceleration in the flare, which occur for flares with a duration longer than both the radiative lifetime and geometric delay. Our model naturally produces orphan X-ray and γ-ray flares. These are caused by flares that are only observable above the quiescent jet emission in a narrow band of frequencies. Our model is able to successfully fit to the observed multiwavelength flaring spectra and light curves of PKS1502+106 across all wavelengths, using a transient flaring front located within the broad-line region.

  10. Multi-Frequency Monitoring of the Flat Spectrum Radio Quasar PKS 1222+216 in 2008–2015

    Directory of Open Access Journals (Sweden)

    Ivan Troitskiy

    2016-11-01

    Full Text Available We analyze the broadband activity of the flat spectrum radio quasar PKS 1222+216 from 2008 to 2015 using multi-frequency monitoring which involves γ-ray data from the Fermi Large Area Telescope, total intensity and linear polarization observations from different optical telescopes in R band, and imaging of the inner jet structure with the Very Long Baseline Array (VLBA at 43 GHz. During the observations, the source showed several dramatic flares at γ rays and optical bands, with the rising branch of a γ-ray flare accompanied by a rapid rotation of the polarization position angle (EVPA, a fast increase of the degree of polarization in the optical band, brightening of the VLBI core, and appearance of a new superluminal component in the parsec-scale jet. The rapid variability of the optical linear polarization may be explained by a strong turbulence in the jet plasma. We find a correlation between the γ rays, optical R band, and 43 GHz variability on a long-term scale (months and years, and a good general alignment between EVPAs in R band and at 43 GHz, while the correlation between short-term variations (days and weeks is weaker. Synchronous activity across the bands supports the idea that the emission regions responsible for the γ-ray and optical flares are co-spatial and located in the vicinity of the mm-wave core of the parsec-scale jet. However, these connections do not completely explain the challenging behaviour of PKS 1222+216, since there are some γ-ray flares which are not accompanied by jet events, and vice versa. We need a continuation of multi-frequency monitoring along with high resolution imaging of the parsec-scale jet to understand in detail the origin of high energy emission in blazars.

  11. A MULTIWAVELENGTH STUDY OF THREE HYBRID BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Stanley, E. C.; Lister, M. L. [Department of Physics and Astronomy, Purdue University, 525 Northwestern Avenue, West Lafayette, IN 47907 (United States); Kharb, P. [Indian Institute of Astrophysics, II Block, Koramangala, Bangalore 560034 (India); Marshall, H. L. [Center for Space Research, Room NE80-6031, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); O’Dea, C.; Baum, S. [Department of Physics and Astronomy, University of Manitoba, Winnipeg, MB R3T 2N2 (Canada)

    2015-07-01

    We present multiwavelength imaging observations of PKS 1045−188, 8C 1849+670, and PKS 2216−038, three radio-loud active galactic nuclei from the MOJAVE-Chandra Sample that straddle the Fanaroff-Riley (FR) boundary between low- and high-power jets. These hybrid sources provide an excellent opportunity to study jet emission mechanisms and the influence of the external environment. We used archival VLA observations, and new Hubble and Chandra observations to identify and study the spectral properties of five knots in PKS 1045−188, two knots in 8C 1849+670, and three knots in PKS 2216−038. For the seven X-ray visible knots, we constructed and fit the broadband spectra using synchrotron and inverse Compton/cosmic microwave background (IC/CMB) emission models. In all cases, we found that the lack of detected optical emission ruled out the X-ray emission from the same electron population that produces radio emission. All three sources have high total extended radio power, similar to that of FR II sources. We find this is in good agreement with previously studied hybrid sources, where high-power hybrid sources emit X-rays via IC/CMB and the low-power hybrid sources emit X-rays via synchrotron emission. This supports the idea that it is total radio power rather than FR morphology that determines the X-ray emission mechanism. We found no significant asymmetries in the diffuse X-ray emission surrounding the host galaxies. Sources PKS 1045−188 and 8C 1849+670 show significant differences in their radio and X-ray termination points, which may result from the deceleration of highly relativistic bulk motion.

  12. Multiwavelength Variability Study of the Classical BL Lac Object PKS 0735+178 on Timescales Ranging from Decades to Minutes

    Energy Technology Data Exchange (ETDEWEB)

    Goyal, Arti; Stawarz, Łukasz; Ostrowski, Michał; Soida, Marian [Astronomical Observatory of Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland); Larionov, Valeri [Astronomical Institute of St. Petersburg State University, Petrodvorets 198504 (Russian Federation); Gopal-Krishna [Centre for Excellence in Basic Sciences (CEBS), University of Mumbai campus (Kalina), Mumbai 400098 (India); Wiita, Paul J. [Department of Physics, The College of New Jersey, 2000 Pennington Road, Ewing, NJ 08628-0718 (United States); Joshi, Santosh [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263002 (India); Agudo, Iván, E-mail: arti@oa.uj.edu.pl [Instituto de Astrofísica de Andalucía (CSIC), Apartado 3004, E–18080 Granada (Spain)

    2017-03-10

    We present the results of our power spectral analysis for the BL Lac object PKS 0735+178, utilizing the Fermi -LAT survey at high-energy γ -rays, several ground-based optical telescopes, and single-dish radio telescopes operating at GHz frequencies. The novelty of our approach is that, by combining long-term and densely sampled intra-night light curves in the optical regime, we were able to construct for the first time the optical power spectrum of the blazar for a time domain extending from 23 years down to minutes. Our analysis reveals that: (1) the optical variability is consistent with a pure red noise, for which the power spectral density can be well approximated by a single power law throughout the entire time domain probed; (2) the slope of power spectral density at high-energy γ -rays (∼1) is significantly flatter than that found at radio and optical frequencies (∼2) within the corresponding time variability range; (3) for the derived power spectra, we did not detect any low-frequency flattening, nor do we see any evidence for cutoffs at the highest frequencies down to the noise floor levels due to measurement uncertainties. We interpret our findings in terms of a model where the blazar variability is generated by the underlying single stochastic process (at radio and optical frequencies), or a linear superposition of such processes (in the γ -ray regime). Along with the detailed PSD analysis, we also present the results of our extended (1998–2015) intra-night optical monitoring program and newly acquired optical photo-polarimetric data for the source.

  13. The Gamma-Ray Emitting Radio-Loud Narrow-Line Seyfert 1 Galaxy PKS 2004-447 II. The Radio View

    Science.gov (United States)

    Schulz, R.; Kreikenbohm, A.; Kadler, M.; Ojha, R.; Ros, E.; Stevens, J.; Edwards, P. G.; Carpenter, B.; Elsaesser, D.; Gehrels, N.; hide

    2016-01-01

    Context. gamma-ray-detected radio-loud narrow-line Seyfert 1 (gamma-NLS1) galaxies constitute a small but interesting sample of the gamma-ray-loud AGN. The radio-loudest gamma-NLS1 known, PKS2004447, is located in the southern hemisphere and is monitored in the radio regime by the multiwavelength monitoring programme TANAMI. Aims. We aim for the first detailed study of the radio morphology and long-term radio spectral evolution of PKS2004447, which are essential for understanding the diversity of the radio properties of gamma-NLS1s. Methods. The TANAMI VLBI monitoring program uses the Australian Long Baseline Array (LBA) and telescopes in Antarctica, Chile, New Zealand, and South Africa to monitor the jets of radio-loud active galaxies in the southern hemisphere. Lower resolution radio flux density measurements at multiple radio frequencies over four years of observations were obtained with the Australia Telescope Compact Array (ATCA). Results. The TANAMI VLBI image at 8.4GHz shows an extended one-sided jet with a dominant compact VLBI core. Its brightness temperature is consistent with equipartition, but it is an order of magnitude below other gamma-NLS1s with the sample value varying over two orders of magnitude. We find a compact morphology with a projected large-scale size 11 kpc and a persistent steep radio spectrum with moderate flux-density variability. Conclusions. PKS2004447 appears to be a unique member of the gamma-NLS1 sample. It exhibits blazar-like features, such as a flat featureless X-ray spectrum and a core-dominated, one-sided parsec-scale jet with indications for relativistic beaming. However, the data also reveal properties atypical for blazars, such as a radio spectrum and large-scale size consistent with compact-steep-spectrum (CSS) objects, which are usually associated with young radio sources. These characteristics are unique among all gamma-NLS1s and extremely rare among gamma-ray-loud AGN.

  14. Jets, black holes and disks in blazars

    Directory of Open Access Journals (Sweden)

    Ghisellini Gabriele

    2013-12-01

    Full Text Available The Fermi and Swift satellites, together with ground based Cherenkov telescopes, has greatly improved our knowledge of blazars, namely Flat Spectrum Radio Quasars and BL Lac objects, since all but the most powerful emit most of their electro–magnetic output at γ–ray energies, while the very powerful blazars emit mostly in the hard X–ray region of the spectrum. Often they show coordinated variability at different frequencies, suggesting that in these cases the same population of electrons is at work, in a single zone of the jet. The location of this region along the jet is a matter of debate. The jet power correlates with the mass accretion rate, with jets existing at all values of disk luminosities, measured in Eddington units, sampled so far. The most powerful blazars show clear evidence of the emission from their disks, and this has revived methods of finding the black hole mass and accretion rate by modelling a disk spectrum to the data. Being so luminous, blazars can be detected also at very high redshift, and therefore are a useful tool to explore the far universe. One interesting line of research concerns how heavy are their black holes at high redshifts. If we associate the presence of a relativistic jets with a fastly spinning black hole, then we naively expect that the accretion efficiency is larger than for non–spinning holes. As a consequence, the black hole mass in jetted systems should grow at a slower rate. In turn, this would imply that, at high redshifts, the heaviest black holes should be in radio–quiet quasars. We instead have evidences of the opposite, challenging our simple ideas of how a black hole grows.

  15. Rapid Multiwaveband Polarization Variability in the Quasar PKS 0420-014: Optical Emission from the Compact Radio Jet

    Science.gov (United States)

    D'Arcangelo, Francesca D.; Marscher, Alan P.; Jorstad, Svetlana G.; Smith, Paul S.; Larionov, Valeri M.; Hagen-Thorn, Vladimir A.; Kopatskaya, Eugenia N.; Williams, G. Grant; Gear, Walter K.

    2007-04-01

    An 11 day monitoring campaign in late 2005 reveals clear correlation in polarization between the optical emission and the region of the intensity peak (the ``pseudocore'') at the upstream end of the jet in 43 GHz VLBA (Very Long Baseline Array) images in the highly variable quasar PKS 0420-014. The electric-vector position angle (EVPA) of the pseudocore rotated by about 80° in four VLBA observations over a period of 9 days, matching the trend of the optical EVPA. In addition, the 43 GHz EVPAs agree well with the optical values when we correct the former for Faraday rotation. Fluctuations in the polarization at both wave bands are consistent with the variable emission arising from a standing conical shock wave that compresses magnetically turbulent plasma in the ambient jet. The volume of the variable component is the same at both wave bands, although only ~20% of the total 43 GHz emission arises from this site. The remainder of the 43 GHz flux density must originate in a separate region with very low polarization. If 0420-014 is a typical case, the nonthermal optical emission from blazars originates primarily in and near the pseudocore rather than closer to the central engine where the flow collimates and accelerates.

  16. On the Direct Correlation between Gamma-Rays and PeV Neutrinos from Blazars

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Shan; Pohl, Martin; Winter, Walter, E-mail: shan.gao@desy.de [Deutsches Elektronen-Synchrotron (DESY), Platanenallee 6, D-15738 Zeuthen (Germany)

    2017-07-10

    We study the frequently used assumption in multi-messenger astrophysics that the gamma-ray and neutrino fluxes are directly connected because they are assumed to be produced by the same photohadronic production chain. An interesting candidate source for this test is the flat-spectrum radio quasar PKS B1424-418, which recently called attention to a potential correlation between an IceCube PeV neutrino event and its burst phase. We simulate both the multi-waveband photon and the neutrino emission from this source using a self-consistent radiation model. We demonstrate that a simple hadronic model cannot adequately describe the spectral energy distribution for this source, but a lepto-hadronic model with a subdominant hadronic component can reproduce the multi-waveband photon spectrum observed during various activity phases of the blazar. As a conclusion, up to about 0.3 neutrino events may coincide with the burst, which implies that the leptonic contribution dominates in the relevant energy band. We also demonstrate that the time-wise correlation between the neutrino event and burst phase is weak.

  17. Time dependent approach of TeV blazars based on a model of inhomogeneous stratified jet

    International Nuclear Information System (INIS)

    Boutelier, T.

    2009-05-01

    The study of the emission and variability mechanisms of TeV blazars has been the subject of intensive research for years. The homogeneous one-zone model commonly used is puzzling since it yields very high Lorentz factor, in contradiction with other observational evidences. In this work, I describe a new time dependent multi-zone approach, in the framework of the two-flow model. I compute the emission of a full jet, where relativistic electron-positron pairs distributed in pileup propagate. The evolution and the emission of the plasma is computed taking into account a turbulent heating term, some radiative cooling, and a pair production term due to photo-annihilation process. Applied to PKS 2155-304, the model allows the reproduction of the full spectra, as well as the simultaneous multi wavelength variability, with a relatively small Lorentz factor. The variability is explained by the instability of the pair creation process. Nonetheless, the value is still high to agree with other observational evidences in radio. Hence, I show in the last part of this work how to conciliate high Lorentz factor with the absence of apparent superluminal movement in radio, by taking into account the effect of the opening angle on the appearance of relativistic jets. (author)

  18. Ringo2 Optical Polarimetry of Blazars

    Directory of Open Access Journals (Sweden)

    Helen Jermak

    2016-10-01

    Full Text Available We present polarimetric and photometric observations from a sample of 15 γ-ray bright blazars with data from the Tuorla blazar monitoring program (KVA DIPOL and Liverpool Telescope (LT Ringo2 polarimeters (supplemented with γ-ray data from Fermi-LAT. We find that (1 The optical magnitude and γ-ray flux are positively correlated; (2 electric vector position angle rotations can occur in any blazar subclass; (3 there is no difference in the γ-ray flaring rates in the sample between subclasses; flares can occur during and outside of rotations with no preference for this behaviour; (4 the average degree of polarisation (P, optical magnitude and γ-ray flux are lower during a rotation compared with during non-rotation; (5 the number of observed flaring events and optical polarisation rotations are correlated and (6 the maximum observed P increases from ∼10% to ∼30% to ∼40% for subclasses with synchrotron peaks at high, intermediate and low frequencies respectively.

  19. Multi-Band Spectral Properties of Fermi Blazars Benzhong Dai ...

    Indian Academy of Sciences (India)

    ... FSRQs, 41 AGNs of other types and 72 AGNs of unknown type (Abdo et al. 2010a). This large sample enable us to investigate the spectral shapes of blazars from optical to X-ray to γ-ray in more detail than has been done before. For this purpose, we collected data for all Fermi blazars having available spectral information.

  20. Optical features associated with the quasar PKS 2135-14

    International Nuclear Information System (INIS)

    Hawkins, M.R.S.

    1978-01-01

    The field surrounding the quasar PKS 2135-14 has been investigated from B and R photographs taken with the 3.8-m Anglo-Australian telescope. Isophotal plots of the plates, produced with the COSMOS measuring machine, have revealed a number of faint optical features apparently associated with the radio source. (author)

  1. Rapid interstellar scintillation of quasar PKS 1257-326

    NARCIS (Netherlands)

    Bignall, Hayley E.; Jauncey, David L.; Lovell, James E. J.; Tzioumis, Anastasios K.; Macquart, Jean-Pierre; Kedziora-Chudczer, Lucyna; Engvold, O

    2005-01-01

    PKS 1257-326 is one of three quasars known to show unusually large and rapid, intra-hour intensity variations, as a result of scintillation in the turbulent Galactic interstellar medium. We have measured time delays in the variability pattern arrival times at the VLA and the ATCA, as well as an

  2. Bacterial competition reveals differential regulation of the pks genes by Bacillus subtilis.

    Science.gov (United States)

    Vargas-Bautista, Carol; Rahlwes, Kathryn; Straight, Paul

    2014-02-01

    Bacillus subtilis is adaptable to many environments in part due to its ability to produce a broad range of bioactive compounds. One such compound, bacillaene, is a linear polyketide/nonribosomal peptide. The pks genes encode the enzymatic megacomplex that synthesizes bacillaene. The majority of pks genes appear to be organized as a giant operon (>74 kb from pksC-pksR). In previous work (P. D. Straight, M. A. Fischbach, C. T. Walsh, D. Z. Rudner, and R. Kolter, Proc. Natl. Acad. Sci. U. S. A. 104:305-310, 2007, doi:10.1073/pnas.0609073103), a deletion of the pks operon in B. subtilis was found to induce prodiginine production by Streptomyces coelicolor. Here, colonies of wild-type B. subtilis formed a spreading population that induced prodiginine production from Streptomyces lividans, suggesting differential regulation of pks genes and, as a result, bacillaene. While the parent colony showed widespread induction of pks expression among cells in the population, we found the spreading cells uniformly and transiently repressed the expression of the pks genes. To identify regulators that control pks genes, we first determined the pattern of pks gene expression in liquid culture. We next identified mutations in regulatory genes that disrupted the wild-type pattern of pks gene expression. We found that expression of the pks genes requires the master regulator of development, Spo0A, through its repression of AbrB and the stationary-phase regulator, CodY. Deletions of degU, comA, and scoC had moderate effects, disrupting the timing and level of pks gene expression. The observed patterns of expression suggest that complex regulation of bacillaene and other antibiotics optimizes competitive fitness for B. subtilis.

  3. Bacterial Competition Reveals Differential Regulation of the pks Genes by Bacillus subtilis

    Science.gov (United States)

    Vargas-Bautista, Carol; Rahlwes, Kathryn

    2014-01-01

    Bacillus subtilis is adaptable to many environments in part due to its ability to produce a broad range of bioactive compounds. One such compound, bacillaene, is a linear polyketide/nonribosomal peptide. The pks genes encode the enzymatic megacomplex that synthesizes bacillaene. The majority of pks genes appear to be organized as a giant operon (>74 kb from pksC-pksR). In previous work (P. D. Straight, M. A. Fischbach, C. T. Walsh, D. Z. Rudner, and R. Kolter, Proc. Natl. Acad. Sci. U. S. A. 104:305–310, 2007, doi:10.1073/pnas.0609073103), a deletion of the pks operon in B. subtilis was found to induce prodiginine production by Streptomyces coelicolor. Here, colonies of wild-type B. subtilis formed a spreading population that induced prodiginine production from Streptomyces lividans, suggesting differential regulation of pks genes and, as a result, bacillaene. While the parent colony showed widespread induction of pks expression among cells in the population, we found the spreading cells uniformly and transiently repressed the expression of the pks genes. To identify regulators that control pks genes, we first determined the pattern of pks gene expression in liquid culture. We next identified mutations in regulatory genes that disrupted the wild-type pattern of pks gene expression. We found that expression of the pks genes requires the master regulator of development, Spo0A, through its repression of AbrB and the stationary-phase regulator, CodY. Deletions of degU, comA, and scoC had moderate effects, disrupting the timing and level of pks gene expression. The observed patterns of expression suggest that complex regulation of bacillaene and other antibiotics optimizes competitive fitness for B. subtilis. PMID:24187085

  4. Signature of inverse Compton emission from blazars

    Science.gov (United States)

    Gaur, Haritma; Mohan, Prashanth; Wierzcholska, Alicja; Gu, Minfeng

    2018-01-01

    Blazars are classified into high-, intermediate- and low-energy-peaked sources based on the location of their synchrotron peak. This lies in infra-red/optical to ultra-violet bands for low- and intermediate-peaked blazars. The transition from synchrotron to inverse Compton emission falls in the X-ray bands for such sources. We present the spectral and timing analysis of 14 low- and intermediate-energy-peaked blazars observed with XMM-Newton spanning 31 epochs. Parametric fits to X-ray spectra help constrain the possible location of transition from the high-energy end of the synchrotron to the low-energy end of the inverse Compton emission. In seven sources in our sample, we infer such a transition and constrain the break energy in the range 0.6-10 keV. The Lomb-Scargle periodogram is used to estimate the power spectral density (PSD) shape. It is well described by a power law in a majority of light curves, the index being flatter compared to general expectation from active galactic nuclei, ranging here between 0.01 and 1.12, possibly due to short observation durations resulting in an absence of long-term trends. A toy model involving synchrotron self-Compton and external Compton (EC; disc, broad line region, torus) mechanisms are used to estimate magnetic field strength ≤0.03-0.88 G in sources displaying the energy break and infer a prominent EC contribution. The time-scale for variability being shorter than synchrotron cooling implies steeper PSD slopes which are inferred in these sources.

  5. Blazars with arcminute-scale radio halos

    International Nuclear Information System (INIS)

    Ulvestad, J.S.; Antonucci, R.R.J.; Space Telescope Science Institute, Baltimore, MD)

    1986-01-01

    About 10-arcsec resolution 20-cm wavelength maps are presented for three nearby BL Lac objects: Mkn 180, whose halo has a linear size of 85 kpc, 2155-304, with a halo about 375 kpc across, and 1727 + 502, whose one-sided diffuse emission extends to a distance of about 145 kpc from its radio core. Little evidence is found for strong radio variability in the cores of the three blazars; these and other results obtained are consistent with the assertion that the three objects should be classified as normal low luminosity double radio galaxies with optically dull nuclei, if seen from other directions. 20 references

  6. Effective spectral index properties for Fermi blazars

    Science.gov (United States)

    Yang, JiangHe; Fan, JunHui; Liu, Yi; Zhang, YueLian; Tuo, ManXian; Nie, JianJun; Yuan, YuHai

    2018-05-01

    Blazars are a special subclass of active galactic nuclei with extreme observation properties. This subclass can be divided into two further subclasses of flat spectrum radio quasars (FSRQs) and BL Lacertae objects (BL Lacs) according to their emission line features. To compare the spectral properties of FSRQs and BL Lacs, the 1.4 GHz radio, optical R-band, 1 keV X-ray, and 1 GeV γ-ray flux densities for 1108 Fermi blazars are calculated to discuss the properties of the six effective spectral indices of radio to optical ( α RO), radio to X-ray ( α RX), radio to γ ray ( α Rγ), optical to X-ray ( α OX), optical to γ ray ( α Oγ), and X-ray to γ ray ( α Xγ). The main results are as follows: For the averaged effective spectral indices, \\overline {{α _{OX}}} > \\overline {{α _{Oγ }}} > \\overline {{α _{Xγ }}} > \\overline {{α _{Rγ }}} > \\overline {{α _{RX}}} > \\overline {{α _{RO}}} for samples of whole blazars and BL Lacs; \\overline {{α _{Xγ }}} ≈ \\overline {{α _{Rγ }}} ≈ \\overline {{α _{RX}}} for FSRQs and low-frequency-peaked BL Lacs (LBLs); and \\overline {{α _{OX}}} ≈ \\overline {{α _{Oγ }}} ≈ \\overline {{α _{Xγ }}} for high-synchrotron-frequency-peaked BL Lacs (HBLs). The distributions of the effective spectral indices involving optical emission ( α RO, α OX, and α Oγ) for LBLs are different from those for FSRQs, but if the effective spectral index does not involve optical emission ( α RX, α Rγ, and α Xγ), the distributions for LBLs and FSRQs almost come from the same parent population. X-ray emissions from blazars include both synchrotron and inverse Compton (IC) components; the IC component for FSRQs and LBLs accounts for a larger proportion than that for HBLs; and the radiation mechanism for LBLs is similar to that for FSRQs, but the radiation mechanism for HBLs is different from that for both FSRQs and LBLs in X-ray bands. The tendency of α Rγ decreasing from LBLs to HBLs suggests that the synchrotron self

  7. Islamisme dan Politisasi Agama Model PKS dalam Pilpres 2009

    Directory of Open Access Journals (Sweden)

    Akh. Muzakki

    2014-01-01

    Full Text Available In the past decade or so, Islamism as a political concept and perhaps as an ideology has gained strong momentum in Indonesia. The fall of Soeharto after more than three decades in power has helped this ideology to emerge and exert itself particularly in the form of religion oriented political party. This paper is interested in exploring the expression and actualization of Islamism by scrutinizing the political behavior of Justice and Welfare Party (Partai Keadilan Sejahtera / PKS during the 2009 presidential election. We are particularly interested in looking at the use of religious symbols and rites by the party for clear political purposes. We argue that Islamism has been manipulated by PKS during that election as a vehicle to gain power. Hence, the main problem that this paper deals with is actually the idea of the politization of religion by a political party claiming to have represented Islam and its noble teaching.

  8. THE WISE BLAZAR-LIKE RADIO-LOUD SOURCES: AN ALL-SKY CATALOG OF CANDIDATE γ-RAY BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    D' Abrusco, R.; Paggi, A.; Smith, H. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Masetti, N. [INAF/IASF di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Landoni, M. [INAF/Osservatorio Astronomico di Brera, Via E. Bianchi 46, I-23807 Merate (Italy); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)

    2014-11-01

    We present a catalog of radio-loud candidate γ-ray emitting blazars with WISE mid-infrared colors similar to the colors of confirmed γ-ray blazars. The catalog is assembled from WISE sources detected in all four WISE filters, with colors compatible with the three-dimensional locus of the WISE γ-ray emitting blazars, and which can be spatially cross-matched with radio sources from one of the three radio surveys: NVSS, FIRST, and/or SUMSS. Our initial WISE selection uses a slightly modified version of previously successful algorithms. We then select only the radio-loud sources using a measure of the radio-to-IR flux, the q {sub 22} parameter, which is analogous to the q {sub 24} parameter known in the literature but which instead uses the WISE band-four flux at 22 μm. Our final catalog contains 7855 sources classified as BL Lacs, FSRQs, or mixed candidate blazars; 1295 of these sources can be spatially re-associated as confirmed blazars. We describe the properties of the final catalog of WISE blazar-like radio-loud sources and consider possible contaminants. Finally, we discuss why this large catalog of candidate γ-ray emitting blazars represents a new and useful resource to address the problem of finding low-energy counterparts to currently unidentified high-energy sources.

  9. Some physical and mechanical properties of palm kernel shell (PKS ...

    African Journals Online (AJOL)

    In this study, some of the mechanical and physical properties of palm kernel shells (PKS) were evaluated. These are moisture content, 7.8325 ± 0.6672%; true density, 1.254 ± 5.292 x 10-3 g/cm3; bulk density, 1.1248g/cm3; mean rupture force along width, and thickness were 3174.52 ± 270.70N and 2806.94 ± 498.45N for ...

  10. Redshift of the BL Lacertae object PKS 2005-489

    Energy Technology Data Exchange (ETDEWEB)

    Falomo, R.; Maraschi, L.; Treves, A.; Tanzi, E.G.

    1987-07-01

    In a high-resolution spectrum of PKS 2005-489 taken on Aug. 16, 1986 two weak emission lines (EW = about 1 A) were detected at 7031 and 7051 A. Identification with H-alpha and the 6583-A forbidden line of N II is proposed at a redshift z = 0.071. The observations correspond to a relatively faint state of the source with B = about 14.7. 12 references.

  11. Redshift of the BL Lacertae object PKS 2005-489

    International Nuclear Information System (INIS)

    Falomo, R.; Maraschi, L.; Treves, A.; Tanzi, E.G.; Milano Universita, Milan, Italy; CNR, Istituto di Fisica Cosmica, Milan, Italy)

    1987-01-01

    In a high-resolution spectrum of PKS 2005-489 taken on Aug. 16, 1986 two weak emission lines (EW = about 1 A) were detected at 7031 and 7051 A. Identification with H-alpha and the 6583-A forbidden line of N II is proposed at a redshift z = 0.071. The observations correspond to a relatively faint state of the source with B = about 14.7. 12 references

  12. Far UV observations of PKS2155-304

    International Nuclear Information System (INIS)

    Maraschi, L.; Tanzi, E.G.; Treves, A.; Tarenghi, M.

    1980-01-01

    Several spectra of the BL Lac object PKS2155 - 304 are reported in the 1,150 - 3,200 A band taken with the IUE when the object was in a bright phase. The UV flux connects smoothly with the optical and IR observations of the source in its brightest state and its extrapolation matches the soft X-ray flux, implying a change in spectral slope around 10 15 Hz. (UK)

  13. Search for a pentaquark decaying to pKS0

    Science.gov (United States)

    FOCUS Collaboration; Link, J. M.; Yager, P. M.; Anjos, J. C.; Bediaga, I.; Castromonte, C.; Machado, A. A.; Magnin, J.; Massafferri, A.; de Miranda, J. M.; Pepe, I. M.; Polycarpo, E.; Dos Reis, A. C.; Carrillo, S.; Casimiro, E.; Cuautle, E.; Sánchez-Hernández, A.; Uribe, C.; Vázquez, F.; Agostino, L.; Cinquini, L.; Cumalat, J. P.; Frisullo, V.; O'Reilly, B.; Segoni, I.; Stenson, K.; Butler, J. N.; Cheung, H. W. K.; Chiodini, G.; Gaines, I.; Garbincius, P. H.; Garren, L. A.; Gottschalk, E.; Kasper, P. H.; Kreymer, A. E.; Kutschke, R.; Wang, M.; Benussi, L.; Bertani, M.; Bianco, S.; Fabbri, F. L.; Pacetti, S.; Zallo, A.; Reyes, M.; Cawlfield, C.; Kim, D. Y.; Rahimi, A.; Wiss, J.; Gardner, R.; Kryemadhi, A.; Chung, Y. S.; Kang, J. S.; Ko, B. R.; Kwak, J. W.; Lee, K. B.; Cho, K.; Park, H.; Alimonti, G.; Barberis, S.; Boschini, M.; Cerutti, A.; D'Angelo, P.; Dicorato, M.; Dini, P.; Edera, L.; Erba, S.; Inzani, P.; Leveraro, F.; Malvezzi, S.; Menasce, D.; Mezzadri, M.; Moroni, L.; Pedrini, D.; Pontoglio, C.; Prelz, F.; Rovere, M.; Sala, S.; Davenport, T. F.; Arena, V.; Boca, G.; Bonomi, G.; Gianini, G.; Liguori, G.; Lopes Pegna, D.; Merlo, M. M.; Pantea, D.; Ratti, S. P.; Riccardi, C.; Vitulo, P.; Göbel, C.; Olatora, J.; Hernandez, H.; Lopez, A. M.; Mendez, H.; Paris, A.; Quinones, J.; Ramirez, J. E.; Zhang, Y.; Wilson, J. R.; Handler, T.; Mitchell, R.; Engh, D.; Givens, K. M.; Hosack, M.; Johns, W. E.; Luiggi, E.; Nehring, M.; Sheldon, P. D.; Vaandering, E. W.; Webster, M.; Sheaff, M.

    2006-08-01

    We present a search for a pentaquark decaying strongly to pKS0 in γN collisions at a center-of-mass energy up to 25 GeV. Finding no evidence for such a state in the mass range of 1470 MeV/c to 2200 MeV/c, we set limits on the yield and on the cross section times branching ratio relative to Σ1385 and K892.

  14. THE SPECTRAL INDEX PROPERTIES OF FERMI BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Fan, J. H.; Yang, J. H.; Yuan, Y. H.; Wang, J.; Gao, Y., E-mail: jhfan_cn@yahoo.com.cn [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China)

    2012-12-20

    In this paper, a sample of 451 blazars (193 flat spectrum radio quasars (FSRQs), 258 BL Lacertae objects) with corresponding X-ray and Fermi {gamma}-ray data is compiled to investigate the correlation both between the X-ray spectral index and the {gamma}-ray spectral index and between the spectral index and the luminosity, and to compare the spectral indexes {alpha}{sub X}, {alpha}{sub {gamma}}, {alpha}{sub X{gamma}}, and {alpha}{sub {gamma}X{gamma}} for different subclasses. We also investigated the correlation between the X-ray and the {gamma}-ray luminosity. The following results have been obtained. Our analysis indicates that an anti-correlation exists between the X-ray and the {gamma}-ray spectral indexes for the whole sample. However, when we considered the subclasses of blazars (FSRQs, the low-peaked BL Lacertae objects (LBLs) and the high-peaked BL Lacertae objects (HBLs)) separately, there is not a clear relationship for each subclass. Based on the Fermi-detected sources, we can say that the HBLs are different from FSRQs, while the LBLs are similar to FSRQs.

  15. FACT. Flare alerts from blazar monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Dorner, Daniela [Universitaet Wuerzburg (Germany); Bretz, Thomas [RWTH Aachen (Germany); Collaboration: FACT-Collaboration

    2015-07-01

    One of the major goals of the First G-APD Cherenkov Telescope is the longterm monitoring of bright TeV blazars. For more than three years, FACT has observed the blazars Mrk 421 and Mrk 501 and a few other sources on a regular basis. To understand these highly variable objects, simultaneous data at different wavelengths are very useful. FACT is not only taking part in multi-wavelength campaigns, but also sending alerts to other instruments in case of enhanced flux, to study flares within the multi-wavelength frame. To send fast alerts, an automatic quick look analysis was set up on site. Once the data are written on disk, they are automatically processed, and the analysis results are published on a website where other observers can monitor the activity of the source in the very high energy band. In addition, alerts are sent in case the flux is higher than a certain predefined value. In 2014, more than five alerts have been sent. Results from three years of monitoring are presented.

  16. Hints of an axion-like particle mixing in the GeV gamma-ray blazar data?

    Energy Technology Data Exchange (ETDEWEB)

    Mena, Olga [IFIC, Universidad de Valencia-CSIC, E-46071, Valencia (Spain); Razzaque, Soebur, E-mail: omena@ific.uv.es, E-mail: srazzaque@uj.ac.za [Department of Physics, University of Johannesburg, PO Box 524, Auckland Park 2006 (South Africa)

    2013-11-01

    Axion-Like Particles (ALPs), if exist in nature, are expected to mix with photons in the presence of an external magnetic field. The energy range of photons which undergo strong mixing with ALPs depends on the ALP mass, on its coupling with photons as well as on the external magnetic field and particle density configurations. Recent observations of blazars by the Fermi Gamma-Ray Space Telescope in the 0.1–300 GeV energy range show a break in their spectra in the 1–10 GeV range. We have modeled this spectral feature for the flat-spectrum radio quasar 3C454.3 during its November 2010 outburst, assuming that a significant fraction of the gamma rays convert to ALPs in the large scale jet of this blazar. Using theoretically motivated models for the magnetic field and particle density configurations in the kiloparsec scale jet, outside the broad-line region, we find an ALP mass m{sub a} ∼ (1−3)⋅10{sup −7} eV and coupling g{sub aγ} ∼ (1−3)⋅10{sup −10} GeV{sup −1} after performing an illustrative statistical analysis of spectral data in four different epochs of emission. The precise values of m{sub a} and g{sub aγ} depend weakly on the assumed particle density configuration and are consistent with the current experimental bounds on these quantities. We apply this method and ALP parameters found from fitting 3C454.3 data to another flat-spectrum radio quasar PKS1222+216 (4C+21.35) data up to 400 GeV, as a consistency check, and found good fit. We find that the ALP-photon mixing effect on the GeV spectra may not be washed out for any reasonable estimate of the magnetic field in the intergalactic media.

  17. Exploring the Variability of the Fermi LAT Blazar Population

    Science.gov (United States)

    Macomb, Daryl J.; Shrader, C. R.

    2014-01-01

    The flux variability of the approximately 2000 point sources cataloged by the Fermi Gamma-Ray Space Telescope provide important clues to population characteristics. This is particularly true of the more than 1100 source that are likely AGN. By characterizing the intrinsic flux variability and distinguishing this variability from flaring behavior, we can better address questions of flare amplitudes, durations, recurrence times, and temporal profiles. A better understanding of the responsible physical environments, such as the scale and location of jet structures responsible for the high-energy emission, may emerge from such studies. Assessing these characteristics as a function of blazar sub-class is a further goal in order to address questions about the fundamentals of blazar AGN physics. Here we report on progress made in categorizing blazar flare behavior, and correlate these behaviors with blazar sub-type and other source parameters.

  18. TeV Blazars and Cosmic Infrared Background Radiation

    OpenAIRE

    Aharonian, F. A.

    2001-01-01

    The recent developments in studies of TeV radiation from blazars are highlighted and the implications of these results for derivation of cosmologically important information about the cosmic infrared background radiation are discussed.

  19. Extended radio emission and the nature of blazars

    International Nuclear Information System (INIS)

    Antonucci, R.R.J.; Ulvestad, J.S.

    1985-01-01

    The VLA has been used at 20 cm to map all 23 of the 54 confirmed blazars listed in the Angel and Stockman review paper that had not been mapped before at high resolution. (Blazars include BL Lac objects and optically violently variable quasars.) In addition, data on most of the previously mapped blazars have been reprocessed in order to achieve higher dynamic range. Extended emission has been detected associated with 49 of the 54 objects. The extended radio emission has been used to test the hypothesis that blazars are normal radio galaxies and radio quasars viewed along the jet axes. We find that blazars have substantial extended power, consistent with this hypothesis. Many have extended powers as high as the luminous Fanaroff-Riley class 2 radio doubles. The projected linear sizes are small, as expected from foreshortening of the extended sources, and many blazars have the expected core-halo morphology. There are also several small doubles, a head-tail source, and some one-sided sources, and these could be in cases where the line of sight is slightly off the jet axis, or projections of asymmetrical radio galaxies and quasars. The ratio of core to extended radio emission has been studied as a possible indicator of viewing aspect or beaming intensity. It is found to correlate with optical polarization, optical and radio core variability, and one-sided radio morphology. We can go beyond these consistency checks and work toward a proof of the hypothesis under discussion. The flux from the extended emission alone is sufficient in some blazars to qualify them for inclusion in the 3C and 4C catalogs. Suppose that the radio core emission is anisotropic, but the extended emission is predominantly isotropic. The isotropy of the extended emission implies that these blazars would be in the catalogs even if viewed from the side

  20. Comparative genomic analysis of the PKS genes in five species and expression analysis in upland cotton

    Directory of Open Access Journals (Sweden)

    Xueqiang Su

    2017-10-01

    Full Text Available Plant type III polyketide synthase (PKS can catalyse the formation of a series of secondary metabolites with different structures and different biological functions; the enzyme plays an important role in plant growth, development and resistance to stress. At present, the PKS gene has been identified and studied in a variety of plants. Here, we identified 11 PKS genes from upland cotton (Gossypium hirsutum and compared them with 41 PKS genes in Populus tremula, Vitis vinifera, Malus domestica and Arabidopsis thaliana. According to the phylogenetic tree, a total of 52 PKS genes can be divided into four subfamilies (I–IV. The analysis of gene structures and conserved motifs revealed that most of the PKS genes were composed of two exons and one intron and there are two characteristic conserved domains (Chal_sti_synt_N and Chal_sti_synt_C of the PKS gene family. In our study of the five species, gene duplication was found in addition to Arabidopsis thaliana and we determined that purifying selection has been of great significance in maintaining the function of PKS gene family. From qRT-PCR analysis and a combination of the role of the accumulation of proanthocyanidins (PAs in brown cotton fibers, we concluded that five PKS genes are candidate genes involved in brown cotton fiber pigment synthesis. These results are important for the further study of brown cotton PKS genes. It not only reveals the relationship between PKS gene family and pigment in brown cotton, but also creates conditions for improving the quality of brown cotton fiber.

  1. Multi-waveband Behavior of Blazars

    Directory of Open Access Journals (Sweden)

    Marscher Alan P.

    2013-12-01

    Full Text Available The author reviews recent progress toward understanding blazars that multi-waveband monitoring observations have advanced. The primary techniques include the compilation of multi-waveband light curves, multi-epoch VLBI images at radio wavelengths, plots of linear polarization vs. time at radio through optical wavelengths, and spectral energy distributions (SEDs. Correlations and the coincidence or lag of events across wavebands and in the images indicate where the events take place relative to the “core” that lies ≳ 0.5 pc from the central engine. Rotations of the polarization electric vector suggest a helical geometry of the magnetic field upstream of the millimeter-wave core, while rapid fluctuations in degree and position angle of polarization imply that the jet plasma is turbulent in and downstream of the core. The author is developing a numerical model that simulates the emission from such turbulence as it interacts with a conical standing shock in the core region.

  2. BROADBAND OBSERVATIONS OF HIGH REDSHIFT BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Parker, M. L.; Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Stalin, C. S., E-mail: vpaliya@g.clemson.edu [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)

    2016-07-01

    We present a multi-wavelength study of four high redshift blazars, S5 0014+81 ( z = 3.37), CGRaBS J0225+1846 ( z = 2.69), BZQ J1430+4205 ( z = 4.72), and 3FGL J1656.2−3303 ( z = 2.40) using quasi-simultaneous data from the Swift , Nuclear Spectroscopic Telescope Array ( NuSTAR ) and the Fermi -Large Area Telescope (LAT) and also archival XMM-Newton observations. Other than 3FGL J1656.2−3303, none of the sources were known as γ -ray emitters, and our analysis of ∼7.5 yr of LAT data reveals the first time detection of statistically significant γ -ray emission from CGRaBS J0225+1846. We generate the broadband spectral energy distributions (SED) of all the objects, centering at the epoch of NuSTAR observations and reproduce them using a one-zone leptonic emission model. The optical−UV emission in all the objects can be explained by radiation from the accretion disk, whereas the X-ray to γ -ray windows of the SEDs are found to be dominated by inverse Compton scattering off the broad line region photons. All of them host black holes that are billions of solar masses. Comparing the accretion disk luminosity and the jet power of these sources with a large sample of blazars, we find them to occupy a high disk luminosity–jet power regime. We also investigate the X-ray spectral properties of the sources in detail with a major focus on studying the causes of soft X-ray deficit, a feature generally seen in high redshift radio-loud quasars. We summarize that this feature could be explained based on the intrinsic curvature in the jet emission rather than being due to the external effects predicted in earlier studies, such as host galaxy and/or warm absorption.

  3. The classification of flaring states of blazars

    Science.gov (United States)

    Resconi, E.; Franco, D.; Gross, A.; Costamante, L.; Flaccomio, E.

    2009-08-01

    Aims: The time evolution of the electromagnetic emission from blazars, in particular high-frequency peaked sources (HBLs), displays irregular activity that has not yet been understood. In this work we report a methodology capable of characterizing the time behavior of these variable objects. Methods: The maximum likelihood blocks (MLBs) is a model-independent estimator that subdivides the light curve into time blocks, whose length and amplitude are compatible with states of constant emission rate of the observed source. The MLBs yield the statistical significance in the rate variations and strongly suppresses the noise fluctuations in the light curves. We applied the MLBs for the first time on the long term X-ray light curves (RXTE/ASM) of Mkn 421, Mkn 501, 1ES 1959+650, and 1ES 2155-304, more than 10 years of observational data (1996-2007). Using the MLBs interpretation of RXTE/ASM data, the integrated time flux distribution is determined for each single source considered. We identify in these distributions the characteristic level, as well as the flaring states of the blazars. Results: All the distributions show a significant component at negative flux values, most probably caused by an uncertainty in the background subtraction and by intrinsic fluctuations of RXTE/ASM. This effect concerns in particular short time observations. To quantify the probability that the intrinsic fluctuations give rise to a false identification of a flare, we study a population of very faint sources and their integrated time-flux distribution. We determine duty cycle or fraction of time a source spent in the flaring state of the source Mkn 421, Mkn 501, 1ES 1959+650 and 1ES 2155-304. Moreover, we study the random coincidences between flares and generic sporadic events such as high-energy neutrinos or flares in other wavelengths.

  4. Mapping of polyketide biosynthesis pathways in Aspergillus nidulans using a genome wide PKS gene deletion library

    DEFF Research Database (Denmark)

    Larsen, Thomas Ostenfeld; Rank, Christian; Klejnstrup, Marie Louise

    In order to map new links between PKS genes and their products in Aspergillus nidulans we have systematically deleted all thirty-two individual genes predicted to encode polyketide synthases in this model organism. This number greatly exceeds the number of currently known PKs calling for new appr...

  5. An Investigation of Blazars without Redshifts: Not a Missing Population at High Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Mao, Peiyuan; Urry, C. Megan [Yale Center for Astronomy and Astrophysics, Physics Department, New Haven, CT 06520 (United States)

    2017-06-01

    We investigate a sample of 622 blazars with measured fluxes at 12 wavebands across the radio-to-gamma-ray spectrum but without spectroscopic or photometric redshifts. This sample includes hundreds of sources with newly analyzed X-ray spectra reported here. From the synchrotron peak frequencies, estimated by fitting the broadband spectral energy distributions (SEDs), we find that the fraction of high-synchrotron-peaked blazars in these 622 sources is roughly the same as in larger samples of blazars that do have redshifts. We characterize the no-redshift blazars using their infrared colors, which lie in the distinct locus called the WISE blazar strip, then estimate their redshifts using a KNN regression based on the redshifts of the closest blazars in the WISE color–color plot. Finally, using randomly drawn values from plausible redshift distributions, we simulate the SEDs of these blazars and compare them to known blazar SEDs. Based on all these considerations, we conclude that blazars without redshift estimates are unlikely to be high-luminosity, high-synchrotron-peaked objects, which had been suggested in order to explain the “blazar sequence”—an observed trend of SED shape with luminosity—as a selection effect. Instead, the observed properties of no-redshift blazars are compatible with a causal connection between jet power and electron cooling, i.e., a true blazar sequence.

  6. The Gamma-Ray Blazar Content of the Northern Sky

    Energy Technology Data Exchange (ETDEWEB)

    Michelson, Peter

    2003-07-16

    Using survey data, we have re-evaluated the correlation of flat spectrum radio sources with EGRET sources in the Northern sky. An analysis incorporating the radio and X-ray properties and the {gamma}-ray source localization is used to gauge the reliability of associations and to search for counterparts of previously unidentified EGRET sources. Above |b|=10{sup o}, where the classification is complete, we find that 70% of the Northern EGRET sources have counterparts similar to the bright EGRET blazars. For several of these we identify known blazar counterparts more likely than the earlier proposed 3EG association; for {approx}20 we have new identifications. Spectroscopic confirmation of these candidates is in progress and we have found flat spectrum radio quasars and BL Lac counterparts with redshifts as high as 4. We also find strong evidence for a set of 28 objects with no plausible counterpart like the known EGRET blazars. These thus represent either a new extragalactic population or a population of Galactic objects with a large scale height. The survey has been extended into the plane, where we find several new blazar candidates; the bulk of the sources are, however, Galactic. Looking ahead to the GLAST era, we predict that several of the present 3EG sources are composite and that higher resolution data will break these into multiple blazar IDs.

  7. Multiband Observations of the Quasar PKS 2326–502 during Active and Quiescent Gamma-Ray States in 2010–2012

    Energy Technology Data Exchange (ETDEWEB)

    Dutka, Michael S. [The Catholic University of America, 620 Michigan Avenue, NE, Washington, DC 20064 (United States); Carpenter, Bryce D.; Gehrels, Neil [NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Ojha, Roopesh [UMBC/NASA Goddard Space Flight Center, Astrophysics Science Division, Code 661, Greenbelt, MD 20771 (United States); Finke, Justin D. [Naval Research Laboratory, Space Science Division, Code 7653, 4555 Overlook Avenue, SW, Washington, DC 20375 (United States); D’Ammando, Filippo [Università di Bologna Dipartimento di Fisica e Astronomia, INAF-IRA, Bologna (Italy); Kadler, Matthias [Lehrstuhl für Astronomie, Universität Würzburg, Emil -Fischer-Straße 31, D-97074 Würzburg (Germany); Edwards, Philip G. [CSIRO Astronomy and Space Science, P.O. Box 76, Epping NSW 1710 (Australia); Stevens, Jamie [CSIRO Astronomy and Space Science, 1828 Yarrie Lake Road, Narrabri NSW 2390 (Australia); Torresi, Eleonora; Grandi, Paola [Istituto Nazionale di Astrofisica, (National Institute of Astrophysics) INAF-IASFBO, via Gobetti 101, I-40129 Bologna (Italy); Nesci, Roberto [Istituto Nazionale di Astrofisica, (National Institute of Astrophysics) INAF-IAPS, via Fosso del Cavaliere 100, I-00133 Roma (Italy); Krauß, Felicia [GRAPPA and Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Müller, Cornelia [Department of Astrophysics/IMAPP, Radboud University Nijmegen, P.O. Box 9010, 6500 GL, Nijmegen (Netherlands); Wilms, Joern, E-mail: ditko86@gmail.com, E-mail: carpbr01@gmail.com [Remeis Observatory and ECAP, Sternwartstr. 7, D-96049 Bamberg (Germany)

    2017-02-01

    Quasi-simultaneous observations of the Flat Spectrum Radio Quasar PKS 2326−502 were carried out in the γ -ray, X-ray, UV, optical, near-infrared, and radio bands. Using these observations, we are able to characterize the spectral energy distribution (SED) of the source during two flaring and one quiescent γ -ray states. These data were used to constrain one-zone leptonic models of the SEDs of each flare and investigate the physical conditions giving rise to them. While modeling one flare required only changes in the electron spectrum compared to the quiescent state, modeling the other flare required changes in both the electron spectrum and the size of the emitting region. These results are consistent with an emerging pattern of two broad classes of flaring states seen in blazars. Type 1 flares are explained by changes solely in the electron distribution, whereas type 2 flares require a change in an additional parameter. This suggests that different flares, even in the same source, may result from different physical conditions or different regions in the jet.

  8. HIGH-ENERGY NEUTRINOS FROM RECENT BLAZAR FLARES

    Energy Technology Data Exchange (ETDEWEB)

    Halzen, Francis; Kheirandish, Ali [Wisconsin IceCube Particle Astrophysics Center and Department of Physics, University of Wisconsin, Madison, WI 53706 (United States)

    2016-11-01

    The energy density of cosmic neutrinos measured by IceCube matches the one observed by Fermi in extragalactic photons that predominantly originate in blazars. This has inspired attempts to match Fermi sources with IceCube neutrinos. A spatial association combined with a coincidence in time with a flaring source may represent a smoking gun for the origin of the IceCube flux. In 2015 June, the Fermi Large Area Telescope observed an intense flare from blazar 3C 279 that exceeded the steady flux of the source by a factor of 40 for the duration of a day. We show that IceCube is likely to observe neutrinos, if indeed hadronic in origin, in data that are still blinded at this time. We also discuss other opportunities for coincident observations that include a recent flare from blazar 1ES 1959+650 that previously produced an intriguing coincidence with AMANDA observations.

  9. Blazar origin of some IceCube events

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Luis Salvador; Leon, Alberto Rosales de; Sahu, Sarira [Universidad Nacional Autonoma de Mexico, Circuito Exterior, C.U., Instituto de Ciencias Nucleares, Mexico, DF (Mexico)

    2016-07-15

    Recently the ANTARES collaboration presented a time dependent analysis of a selected number of flaring blazars to look for upward going muon events produced from the charge current interaction of the muon neutrinos. We use the same list of flaring blazars to look for a possible positional correlation with the IceCube neutrino events. In the context of the photohadronic model we propose that the neutrinos are produced within the nuclear region of the blazar where Fermi accelerated high energy protons interact with the background synchrotron/SSC photons. Although we found that some objects from the ANTARES list are within the error circles of a few IceCube events, the statistical analysis shows that none of these sources have a significant correlation. (orig.)

  10. Polarization Properties of 24 Fermi-Detected Blazars

    Science.gov (United States)

    Linford, Justin; Taylor, G. B.; Schinzel, F. K.; Zavala, R. T.

    2013-01-01

    Gamma-ray emitting blazars have been shown to frequently have significant polarization at radio wavelengths. In early 2012, we obtained Very Long Baseline Array (VLBA) observations of 24 blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. These observations utilized the new 2 gigabit-per-second mode of the VLBA. We observed each source with full polarization at 8.4 GHz, 15 GHz, and 22 GHz with 256 MHz of total bandwidth per polarization. Our sample contains 14 flat-spectrum radio quasars (FSRQs) and 10 BL Lacertae objects (BL Lacs). We analyze the spectral index, rotation measure, and magnetic field structures of these 24 gamma-ray loud blazars.

  11. Roma-BZCAT: a multifrequency catalogue of blazars

    Science.gov (United States)

    Massaro, E.; Giommi, P.; Leto, C.; Marchegiani, P.; Maselli, A.; Perri, M.; Piranomonte, S.; Sclavi, S.

    2009-02-01

    We present a new catalogue of blazars based on multifrequency surveys and on an extensive review of the literature. Blazars are classified as BL Lacertae objects, as flat spectrum radio quasars or as blazars of uncertain/transitional type. Each object is identified by a root name, coded as BZB, BZQ and BZU for these three subclasses respectively, and by its coordinates. This catalogue is being built as a tool useful for the identification of the extragalactic sources that will be detected by present and future experiments for X and gamma-ray astronomy, like Swift, AGILE, Fermi-GLAST and Simbol-X. An electronic version is available from the ASI Science Data Center web site at http://www.asdc.asi.it/bzcat.

  12. Intrinsic brightness temperatures of blazar jets at 15 GHz

    Directory of Open Access Journals (Sweden)

    Hovatta Talvikki

    2013-12-01

    Full Text Available We have developed a new Bayesian Markov Chain Monte Carlo method to deconvolve light curves of blazars into individual flares, including proper estimation of the fit errors. We use the method to fit 15GHzlight curves obtained within the OVRO 40-m blazar monitoring program where a large number of AGN have been monitored since 2008 in support of the Fermi Gamma-Ray Space Telescope mission. The time scales obtained from the fitted models are used to calculate the variability brightness temperature of the sources. Additionally, we have calculated brightness temperatures of a sample of these objects using Very Long Baseline Array data from the MOJAVE survey. Combining these two data sets enables us to study the intrinsic brightness temperature distribution in these blazars at 15 GHz. Our preliminary results indicate that the mean intrinsic brightness temperature in a sample of 14 sources is near the equipartition brightness temperature of ~ 1011K.

  13. Fusarium graminearum PKS14 is involved in orsellinic acid and orcinol synthesis

    DEFF Research Database (Denmark)

    Jørgensen, Simon Hartung; Frandsen, Rasmus John Normand; Nielsen, Kristian Fog

    2014-01-01

    and cultivated two of the resulting mutants on RM medium. This led to the production of two compounds, which were only detected in the PKS14 overexpressing mutants and not in the wild type or PKS14 deletion mutants. The two compounds were tentatively identified as orsellinic acid and orcinol by comparing...... spectroscopic data (mass spectroscopy and chromatography) to authentic standards. NMR analysis of putative orcinol isolated from the PKS14 overexpressing mutant supported our identification. Orcinol and orsellinic acid, not previously detected in Fusarium, have primarily been detected in lichen fungi...

  14. What We Talk about When We Talk about Blazars?

    Energy Technology Data Exchange (ETDEWEB)

    Foschini, Luigi, E-mail: luigi.foschini@brera.inaf.it [INAF – Osservatorio Astronomico di Brera, Lecco (Italy)

    2017-07-11

    After the discovery of powerful relativistic jets from Narrow-Line Seyfert 1 Galaxies, and the understanding of their similarity with those of blazars, a problem of terminology was born. The word blazar is today associated to BL Lac Objects and Flat-Spectrum Radio Quasars, which are somehow different from Narrow-Line Seyfert 1 Galaxies. Using the same word for all the three classes of AGN could drive either toward some misunderstanding, or to the oversight of some important characteristics. I review the main characteristics of these sources, and finally I propose a new scheme of classification.

  15. Multifrequency observations of the BL Lacertae object PKS 0537 - 441

    Science.gov (United States)

    Maraschi, L.; Treves, A.; Schwartz, D. A.; Tanzi, E. G.

    1985-01-01

    PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10.

  16. Multifrequency observations of the BL Lacertae object PKS 0537 - 441

    Energy Technology Data Exchange (ETDEWEB)

    Maraschi, L.; Treves, A.; Schwartz, D.A.; Tanzi, E.G.

    1985-07-01

    PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10. 28 references.

  17. Multifrequency observations of the BL Lacertae object PKS 0537 - 441

    International Nuclear Information System (INIS)

    Maraschi, L.; Treves, A.; Schwartz, D.A.; Tanzi, E.G.; CNR, Istituto di Fisica Cosmica, Milan, Italy; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA)

    1985-01-01

    PKS 0537 - 441 was repeatedly observed in the UV band with the International Ultraviolet Explorer and in the X-ray with the Einstein Observatory. On September 27, 1980, simultaneous observations in the two bands were obtained. Near-infrared photometry preceding and following the simultaneous observations by about one month is available from the literature, as is radio monitoring at 408 and 5000 MHz. Comparison of the observed X-ray flux with that predicted by the standard synchrotron self-Compton formalism, with a source dimension deduced from radio variability at 5 GHz, indicates that this component of the radio emission must be moving at relativistic speed with an effective projected Doppler beaming factor of about 10. 28 references

  18. Relation between Radio Polarization and Spectral Index of Blazars ...

    Indian Academy of Sciences (India)

    Introduction. Blazars are a very special class of extragalactic objects showing some special proper- ties, including rapid variability, high and variability polarization, high luminosity and superluminal motion, etc. Their optical variability timescales can cover a range of hours to years from radio to γ-rays (Fan et al. 2004; Ulrich ...

  19. High-redshift Blazars through NuSTAR Eyes

    International Nuclear Information System (INIS)

    Marcotulli, L.; Paliya, V. S.; Ajello, M.; Kaur, A.; Hartmann, D. H.; Gasparrini, D.; Greiner, J.; Rau, A.; Schady, P.; Baloković, M.; Stern, D.; Madejski, G.

    2017-01-01

    The most powerful sources among the blazar family are MeV blazars. Often detected at z > 2, they usually display high X- and γ -ray luminosities, larger-than-average jet powers, and black hole masses ≳10 9 M ☉ . In the present work, we perform a multiwavelength study of three high-redshift blazars: 3FGL J0325.5+2223 ( z = 2.06), 3FGL J0449.0+1121 ( z = 2.15), and 3FGL J0453.2−2808 ( z = 2.56), analyzing quasi-simultaneous data from GROND, Swift -UVOT and XRT, Nuclear Spectroscopic Telescope Array ( NuSTAR ), and Fermi -LAT. Our main focus is on the hard X-ray band recently unveiled by NuSTAR (3–79 keV) where these objects show a hard spectrum that enables us to constrain the inverse Compton (IC) peak and the jet power. We found that all three targets resemble the most powerful blazars, with the synchrotron peak located in the submillimeter range and the IC peak in the MeV range, and therefore belong to the MeV blazar class. Using a simple one-zone leptonic emission model to reproduce the spectral energy distributions, we conclude that a simple combination of synchrotron and accretion disk emission reproduces the infrared–optical spectra, while the X-ray to γ -ray part is well reproduced by the IC scattering of low-energy photons supplied by the broad-line region. The black hole masses for each of the three sources are calculated to be ≳4 × 10 8 M ☉ . The three studied sources have jet power at the level of, or beyond, the accretion luminosity.

  20. Redshift measurement of Fermi blazars for the Cherenkov telescope array

    Science.gov (United States)

    Pita, S.; Goldoni, P.; Boisson, C.; Cotter, G.; Lefaucheur, J.; Lenain, J.-P.; Lindfors, E.; Williams, D. A.

    2017-01-01

    Blazars are active galactic nuclei, and the most numerous High Energy (HE) and Very High Energy (VHE) γ-ray emitters. Their optical emission is often dominated by non-thermal, and, in the case of BL Lacs, featureless continuum radiation. This makes the determination of their redshift extremely difficult. Indeed, as of today only about 50% of γ-ray blazars have a measured spectroscopic redshift. The knowledge of redshift is fundamental because it allows the precise modeling of the VHE emission and also of its interaction with the extragalactic background light (EBL). The beginning of the Cherenkov Telescope Array (CTA) operations in the near future will allow the detection of several hundreds of new blazars. Using the Fermi catalogue of sources above 50 GeV (2FHL), we performed simulations which indicate that a significant fraction of the 2FHL blazars detectable by CTA will not have a measured redshift. As a matter of fact, the organization of observing campaigns to measure the redshift of these blazars has been recognized as a necessary support for the AGN Key Science Project of CTA. We are planning such an observing campaign. In order to optimize our chances of success, we will perform preliminary deep imaging observations aimed at detecting or setting upper limits to the host galaxy. We will then take spectra of the candidates with the brightest host galaxies. Taking advantage of the recent success of an X-shooter GTO observing campaign, these observations will be different with respect to previous ones due to the use of higher resolution spectrographs and of 8 meter class telescopes. We are starting to submit proposals for these observations. In this paper we briefly describe how candidates are selected and the corresponding observation program.

  1. CLUSTERING OF γ-RAY-SELECTED 2LAC FERMI BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Allevato, V.; Finoguenov, A. [Department of Physics, University of Helsinki, Gustaf Hällströmin katu 2a, FI-00014 Helsinki (Finland); Cappelluti, N. [University of Maryland, Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States)

    2014-12-20

    We present the first measurement of the projected correlation function of 485 γ-ray-selected blazars, divided into 175 BL Lacertae (BL Lacs) and 310 flat-spectrum radio quasars (FSRQs) detected in the 2 year all-sky survey by the Fermi-Large Area Telescope. We find that Fermi BL Lacs and FSRQs reside in massive dark matter halos (DMHs) with log M{sub h} = 13.35{sub −0.14}{sup +0.20} and log M{sub h} = 13.40{sub −0.19}{sup +0.15} h {sup –1} M {sub ☉}, respectively, at low (z ∼ 0.4) and high (z ∼ 1.2) redshift. In terms of clustering properties, these results suggest that BL Lacs and FSRQs are similar objects residing in the same dense environment typical of galaxy groups, despite their different spectral energy distributions, power, and accretion rates. We find no difference in the typical bias and hosting halo mass between Fermi blazars and radio-loud active galactic nuclei (AGNs), supporting the unification scheme simply equating radio-loud objects with misaligned blazar counterparts. This similarity in terms of the typical environment they preferentially live in, suggests that blazars tend to occupy the center of DMHs, as already pointed out for radio-loud AGNs. This implies, in light of several projects looking for the γ-ray emission from DM annihilation in galaxy clusters, a strong contamination from blazars to the expected signal from DM annihilation.

  2. High-redshift Blazars through NuSTAR Eyes

    Energy Technology Data Exchange (ETDEWEB)

    Marcotulli, L.; Paliya, V. S.; Ajello, M.; Kaur, A.; Hartmann, D. H. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Gasparrini, D. [Agenzia Spaziale Italiana (ASI) Science Data Center, I-00133 Roma (Italy); Greiner, J.; Rau, A.; Schady, P. [Max Planck Institute für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Baloković, M. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Madejski, G., E-mail: lmarcot@g.clemson.edu, E-mail: vpaliya@g.clemson.edu [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States)

    2017-04-20

    The most powerful sources among the blazar family are MeV blazars. Often detected at z > 2, they usually display high X- and γ -ray luminosities, larger-than-average jet powers, and black hole masses ≳10{sup 9} M {sub ☉}. In the present work, we perform a multiwavelength study of three high-redshift blazars: 3FGL J0325.5+2223 ( z = 2.06), 3FGL J0449.0+1121 ( z = 2.15), and 3FGL J0453.2−2808 ( z = 2.56), analyzing quasi-simultaneous data from GROND, Swift -UVOT and XRT, Nuclear Spectroscopic Telescope Array ( NuSTAR ), and Fermi -LAT. Our main focus is on the hard X-ray band recently unveiled by NuSTAR (3–79 keV) where these objects show a hard spectrum that enables us to constrain the inverse Compton (IC) peak and the jet power. We found that all three targets resemble the most powerful blazars, with the synchrotron peak located in the submillimeter range and the IC peak in the MeV range, and therefore belong to the MeV blazar class. Using a simple one-zone leptonic emission model to reproduce the spectral energy distributions, we conclude that a simple combination of synchrotron and accretion disk emission reproduces the infrared–optical spectra, while the X-ray to γ -ray part is well reproduced by the IC scattering of low-energy photons supplied by the broad-line region. The black hole masses for each of the three sources are calculated to be ≳4 × 10{sup 8} M {sub ☉}. The three studied sources have jet power at the level of, or beyond, the accretion luminosity.

  3. IDENTIFICATION OF NEW GAMMA-RAY BLAZAR CANDIDATES WITH MULTIFREQUENCY ARCHIVAL OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Cowperthwaite, Philip S. [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Massaro, F. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A.; Smith, Howard A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Tosti, G., E-mail: pcowpert@umd.edu [Dipartimento di Fisica, Università Degli Studi di Perugia, I-06123 Perugia (Italy)

    2013-11-01

    Blazars are a highly variable, radio-loud subclass of active galactic nuclei. In order to better understand such objects we must be able to easily identify candidate blazars from the growing population of unidentified sources. Working toward this goal, we attempt to identify new gamma-ray blazar candidates from a sample of 102 previously unidentified sources. These sources are selected from The Astronomer's Telegram and the literature on the basis of non-periodic variability and multi-wavelength behavior. We then attempt to associate these objects to an IR counterpart in the Wide-field Infrared Survey Explorer all-sky survey. We are able to identify 16 candidate sources whose IR colors are consistent with those of the blazar population. Of those, 13 sources have IR colors indicative of being gamma-ray emitting blazar candidates. These sources all possess archival multi-wavelength observations that support their blazar-like nature.

  4. Data reduction and analysis of the multiband optical images of the blazar Mrk180

    Directory of Open Access Journals (Sweden)

    M Sabzi Sarvestani

    2012-09-01

    Full Text Available  Nearly simultaneous multiband monitoring of blazars is very limited and most studies reported in literature are conflicting, too. Although optical variability on intra-night timescales is now a well established phenomenon for blazars, its relationship to long-term variability remains unclear. Possible clues could come from monitoring the optical spectrum for correlation with brightness. The presence or absence of bluer color in blazar color index, when its luminosity is increased on intra-night and inter-night timescales, can provide interesting clues to the origin of blazar variability from hourly to much longer timescales. Luminosity of blazars varies at all wavelengths over a variety of timescales. Various models have been proposed to explain blazar variability. However, the mechanism responsible for variability is not conclusively understood. One factor which can discriminate the various variability models is that of color (spectral index variations of blazars. This factor may help to better understand the mechanism of blazar variability. Therefore, it was initially proposed, by the second author of this paper to the OHP observatory, to carry out quasi-simultaneous multiband monitoring of one of the brightest blazer, Mrk180. Fortunately, it was accepted by the scientific team of the observatory and the 1.20m telescope time was allocated to the project from 23 to 28 April 2009. Because of the weather conditions, we could only monitor this blazar for three nights. Raw data processing and data reduction were performed using the standard system of Europe Southerner Observatory, ESO-MIDAS. We considered two reference stars and measured the magnitudes of the reference stars and the blazar Mrk 180 and then plotted the light curves and the color index diagrams. The light curves showed the optical variations of the blazar. The maximum amplitude value of its variations was 0.185 mag for the V filter. Investigating the blazar color index shows its

  5. Modeling linear and cyclic PKS intermediates through atom replacement.

    Science.gov (United States)

    Shakya, Gaurav; Rivera, Heriberto; Lee, D John; Jaremko, Matt J; La Clair, James J; Fox, Daniel T; Haushalter, Robert W; Schaub, Andrew J; Bruegger, Joel; Barajas, Jesus F; White, Alexander R; Kaur, Parminder; Gwozdziowski, Emily R; Wong, Fiona; Tsai, Shiou-Chuan; Burkart, Michael D

    2014-12-03

    The mechanistic details of many polyketide synthases (PKSs) remain elusive due to the instability of transient intermediates that are not accessible via conventional methods. Here we report an atom replacement strategy that enables the rapid preparation of polyketone surrogates by selective atom replacement, thereby providing key substrate mimetics for detailed mechanistic evaluations. Polyketone mimetics are positioned on the actinorhodin acyl carrier protein (actACP) to probe the underpinnings of substrate association upon nascent chain elongation and processivity. Protein NMR is used to visualize substrate interaction with the actACP, where a tetraketide substrate is shown not to bind within the protein, while heptaketide and octaketide substrates show strong association between helix II and IV. To examine the later cyclization stages, we extended this strategy to prepare stabilized cyclic intermediates and evaluate their binding by the actACP. Elongated monocyclic mimics show much longer residence time within actACP than shortened analogs. Taken together, these observations suggest ACP-substrate association occurs both before and after ketoreductase action upon the fully elongated polyketone, indicating a key role played by the ACP within PKS timing and processivity. These atom replacement mimetics offer new tools to study protein and substrate interactions and are applicable to a wide variety of PKSs.

  6. QUASI-PERIODICITIES AT YEAR-LIKE TIMESCALES IN BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Sandrinelli, A.; Treves, A. [Università degli Studi dell’Insubria, Dipartimento di Scienza ed Alta Tecnologia, Via Valleggio 11, I-22100 Como (Italy); Covino, S. [INAF—Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Dotti, M. [Università degli Studi di Milano Bicocca, Dipartimento di Fisica G. Occhialini, Piazza della Scienza 3, I-20126 Milano (Italy)

    2016-03-15

    We searched for quasi-periodicities on year-like timescales in the light curves of six blazars in the optical—near-infrared bands and we made a comparison with the high energy emission. We obtained optical/NIR light curves from Rapid Eye Mounting photometry plus archival Small and Moderate Aperture Research Telescope System data and we accessed the Fermi light curves for the γ-ray data. The periodograms often show strong peaks in the optical and γ-ray bands, which in some cases may be inter-related. The significance of the revealed peaks is then discussed, taking into account that the noise is frequency dependent. Quasi-periodicities on a year-like timescale appear to occur often in blazars. No straightforward model describing these possible periodicities is yet available, but some plausible interpretations for the physical mechanisms causing periodic variabilities of these sources are examined.

  7. The broadband spectral energy distributions of SDSS blazars

    Science.gov (United States)

    Li, Huai-Zhen; Chen, Luo-En; Jiang, Yun-Guo; Yi, Ting-Feng

    2015-07-01

    We compiled the radio, optical and X-ray data of blazars from the Sloan Digital Sky Survey database, and presented the distribution of luminosities and broadband spectral indices. The distribution of luminosities shows that the averaged luminosity of flat spectrum radio quasars (FSRQs) is larger than that of BL Lacertae (BL Lac) objects. On the other hand, the broadband spectral energy distribution reveals that FSRQs and low energy peaked BL Lac objects have similar spectral properties, but high energy peaked BL Lac objects have a distinct spectral property. This may be due to the fact that different subclasses of blazars have different intrinsic environments and are at different cooling levels. Even so, a unified scheme is also revealed from the color-color diagram, which hints that there are similar physical processes operating in all objects under a range of intrinsic physical conditions or beaming parameters. Supported by the National Natural Science Foundation of China.

  8. RELAXATION OF BLAZAR-INDUCED PAIR BEAMS IN COSMIC VOIDS

    Energy Technology Data Exchange (ETDEWEB)

    Miniati, Francesco [Physics Department, Wolfgang-Pauli-Strasse 27, ETH-Zuerich, CH-8093 Zuerich (Switzerland); Elyiv, Andrii, E-mail: fm@phys.ethz.ch [Institut d' Astrophysique et de Geophysique, Universite de Liege, B-4000 Liege (Belgium)

    2013-06-10

    The stability properties of a low-density ultrarelativistic pair beam produced in the intergalactic medium (IGM) by multi-TeV gamma-ray photons from blazars are analyzed. The problem is relevant for probes of magnetic field in cosmic voids through gamma-ray observations. In addition, dissipation of such beams could considerably affect the thermal history of the IGM and structure formation. We use a Monte Carlo method to quantify the properties of the blazar-induced electromagnetic shower, in particular the bulk Lorentz factor and the angular spread of the pair beam generated by the shower, as a function of distance from the blazar itself. We then use linear and nonlinear kinetic theory to study the stability of the pair beam against the growth of electrostatic plasma waves, employing the Monte Carlo results for our quantitative estimates. We find that the fastest growing mode, like any perturbation mode with even a very modest component perpendicular to the beam direction, cannot be described in the reactive regime. Due to the effect of nonlinear Landau damping, which suppresses the growth of plasma oscillations, the beam relaxation timescale is found to be significantly longer than the inverse Compton loss time. Finally, density inhomogeneities associated with cosmic structure induce loss of resonance between the beam particles and plasma oscillations, strongly inhibiting their growth. We conclude that relativistic pair beams produced by blazars in the IGM are stable on timescales that are long compared with the electromagnetic cascades. There appears to be little or no effect of pair beams on the IGM.

  9. BLAZAR OPTICAL VARIABILITY IN THE PALOMAR-QUEST SURVEY

    International Nuclear Information System (INIS)

    Bauer, Anne; Baltay, Charles; Coppi, Paolo; Ellman, Nancy; Jerke, Jonathan; Rabinowitz, David; Scalzo, Richard

    2009-01-01

    We study the ensemble optical variability of 276 flat-spectrum radio quasars (FSRQs) and 86 BL Lacs in the Palomar-QUEST Survey with the goal of searching for common fluctuation properties, examining the range of behavior across the sample, and characterizing the appearance of blazars in such a survey so that future work can more easily identify such objects. The survey, which covers 15,000 deg 2 multiple times over 3.5 years, allows for the first ensemble blazar study of this scale. Variability amplitude distributions are shown for the FSRQ and BL Lac samples for numerous time lags, and also studied through structure function analyses. Individual blazars show a wide range of variability amplitudes, timescales, and duty cycles. Of the best-sampled objects, 35% are seen to vary by more than 0.4 mag; for these, the fraction of measurements contributing to the high-amplitude variability ranges constantly from about 5% to 80%. Blazar variability has some similarities to that of type I quasi-stellar objects (QSOs) but includes larger amplitude fluctuations on all timescales. FSRQ variability amplitudes are particularly similar to those of QSOs on timescales of several months, suggesting significant contributions from the accretion disk to the variable flux at these timescales. Optical variability amplitudes are correlated with the maximum apparent velocities of the radio jet for the subset of FSRQs with MOJAVE Very Long Baseline Array measurements, implying that the optically variable flux's strength is typically related to that of the radio emission. We also study CRATES radio-selected FSRQ candidates, which show similar variability characteristics to known FSRQs; this suggests a high purity for the CRATES sample.

  10. Steady-state emission of blazars at very high energies

    International Nuclear Information System (INIS)

    Hoehne-Moench, Daniel

    2010-01-01

    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) γ-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE γ-ray flux, only X-ray selected sources with a flux F X >2 μJy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z X-γ between the X-ray range at 1 keV and the VHE γ-ray regime at 200 GeV were calculated. The majority of objects show a spectral behaviour as expected from the source class of HBLs: The energy output in the VHE regime is in general lower than in X-rays. For the stacked blazar sample the broad-band spectral index was calculated to α X-γ =1.09, confirming the result found for the individual objects. Another evidence for the revelation of the baseline emission is the broad-band spectral energy distribution (SED) comprising archival as well as contemporaneous multi-wavelength data from the radio to the VHE band. The SEDs of known VHE γ-ray sources in low flux states matches well the SED of the stacked blazar sample. (orig.)

  11. Modeling Blazar Spectra by Solving an Electron Transport Equation

    Science.gov (United States)

    Lewis, Tiffany; Finke, Justin; Becker, Peter A.

    2018-01-01

    Blazars are luminous active galaxies across the entire electromagnetic spectrum, but the spectral formation mechanisms, especially the particle acceleration, in these sources are not well understood. We develop a new theoretical model for simulating blazar spectra using a self-consistent electron number distribution. Specifically, we solve the particle transport equation considering shock acceleration, adiabatic expansion, stochastic acceleration due to MHD waves, Bohm diffusive particle escape, synchrotron radiation, and Compton radiation, where we implement the full Compton cross-section for seed photons from the accretion disk, the dust torus, and 26 individual broad lines. We used a modified Runge-Kutta method to solve the 2nd order equation, including development of a new mathematical method for normalizing stiff steady-state ordinary differential equations. We show that our self-consistent, transport-based blazar model can qualitatively fit the IR through Fermi g-ray data for 3C 279, with a single-zone, leptonic configuration. We use the solution for the electron distribution to calculate multi-wavelength SED spectra for 3C 279. We calculate the particle and magnetic field energy densities, which suggest that the emitting region is not always in equipartition (a common assumption), but sometimes matter dominated. The stratified broad line region (based on ratios in quasar reverberation mapping, and thus adding no free parameters) improves our estimate of the location of the emitting region, increasing it by ~5x. Our model provides a novel view into the physics at play in blazar jets, especially the relative strength of the shock and stochastic acceleration, where our model is well suited to distinguish between these processes, and we find that the latter tends to dominate.

  12. Detecting The EBL Attenuation Of Blazars With GLAST

    Science.gov (United States)

    Reyes, Luis C.

    2006-09-01

    The Large Area Telescope (LAT) on board GLAST (Gamma-ray Large Area Space Telescope) due for launch in Fall 2007 will study the gamma-ray sky in the energy range 20 MeV to >300 GeV. GLAST-LAT's improved sensitivity with respect to previous missions will increase the number of known Blazars from about 100 to thousands, with redshifts up to z 5. Since Gamma rays with energy above 10 GeV interact via pair-production with photons from the Extragalactic Background Light (EBL), the systematic attenuation of GLAST-detected Blazars as a function of redshift would constitute and effective and unique probe to the optical-UV EBL density and its evolution over cosmic history. Based on the GLAST-LAT instrument performance, detailed simulations of expected blazar populations attenuated by EBL have been performed. In this poster we present an analysis of such simulations in order to measure the EBL attenuation, ensuing a clear distinction between competing EBL models.

  13. The polyketide synthase gene pks4 is essential for sexual development and regulates fruiting body morphology in Sordaria macrospora.

    Science.gov (United States)

    Schindler, Daniel; Nowrousian, Minou

    2014-07-01

    Filamentous ascomycetes have long been known as producers of a variety of secondary metabolites, many of which have toxic effects on other organisms. However, the role of these metabolites in the biology of the fungi that produce them remains in most cases enigmatic. A major group of fungal secondary metabolites are polyketides. They are chemically diverse, but have in common that their chemical scaffolds are synthesized by polyketide synthases (PKSs). In a previous study, we analyzed development-dependent expression of pks genes in the filamentous ascomycete Sordaria macrospora. Here, we show that a deletion mutant of the pks4 gene is sterile, producing only protoperithecia but no mature perithecia, whereas overexpression of pks4 leads to enlarged, malformed fruiting bodies. Thus, correct expression levels of pks4 are essential for wild type-like perithecia formation. The predicted PKS4 protein has a domain structure that is similar to homologs in other fungi, but conserved residues of a methyl transferase domain present in other fungi are mutated in PKS4. Expression of several developmental genes is misregulated in the pks4 mutant. Surprisingly, the development-associated app gene is not downregulated in the mutant, in contrast to all other previously studied mutants with a block at the protoperithecial stage. Our data show that the polyketide synthase gene pks4 is essential for sexual development and plays a role in regulating fruiting body morphology. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. UV and X-ray Variability of Blazars Alok C. Gupta

    Indian Academy of Sciences (India)

    mostly soft X-rays hardness ratio show correlations with blazar luminos- ity and different modes of variability might be operating for different time scales and ... The real cause of blazar variability on diverse time scales is not yet well under- stood. ... stereoscopic system (HESS) at a 45σ significance level (Aharonian et al.

  15. Linker Flexibility Facilitates Module Exchange in Fungal Hybrid PKS-NRPS Engineering

    DEFF Research Database (Denmark)

    Nielsen, Maria Lund; Petersen, Thomas Isbrandt; Petersen, Lene Maj

    2016-01-01

    Polyketide synthases (PKSs) and nonribosomal peptide synthetases (NRPSs) each give rise to a vast array of complex bioactive molecules with further complexity added by the existence of natural PKS-NRPS fusions. Rational genetic engineering for the production of natural product derivatives....... We succeeded in the construction of a functional cross-species chimeric PKS-NRPS expressed in Aspergillus nidulans. Module swapping of the two PKS-NRPS natural hybrids CcsA from Aspergillus clavatus involved in the biosynthesis of cytochalasin E and related Syn2 from rice plant pathogen Magnaporthe...... oryzae lead to production of novel hybrid products, demonstrating that the rational re-design of these fungal natural product enzymes is feasible. We also report the structure of four novel pseudo pre-cytochalasin intermediates, niduclavin and niduporthin along with the chimeric compounds niduchimaeralin...

  16. In silicio expression analysis of PKS genes isolated from Cannabis sativa L.

    Directory of Open Access Journals (Sweden)

    Isvett J. Flores-Sanchez

    2010-01-01

    Full Text Available Cannabinoids, flavonoids, and stilbenoids have been identified in the annual dioecious plant Cannabis sativa L. Of these, the cannabinoids are the best known group of this plant's natural products. Polyketide synthases (PKSs are responsible for the biosynthesis of diverse secondary metabolites, including flavonoids and stilbenoids. Biosynthetically, the cannabinoids are polyketide substituted with terpenoid moiety. Using an RT-PCR homology search, PKS cDNAs were isolated from cannabis plants. The deduced amino acid sequences showed 51%-73% identity to other CHS/STS type sequences of the PKS family. Further, phylogenetic analysis revealed that these PKS cDNAs grouped with other non-chalcone-producing PKSs. Homology modeling analysis of these cannabis PKSs predicts a 3D overall fold, similar to alfalfa CHS2, with small steric differences on the residues that shape the active site of the cannabis PKSs.

  17. SMARTScience Tools: Interacting With Blazar Data In The Web Browser

    Science.gov (United States)

    Hasan, Imran; Isler, Jedidah; Urry, C. Megan; MacPherson, Emily; Buxton, Michelle; Bailyn, Charles D.; Coppi, Paolo S.

    2014-08-01

    The Yale-SMARTS blazar group has accumulated 6 years of optical-IR photometry of more than 70 blazars, mostly bright enough in gamma-rays to be detected with Fermi. Observations were done with the ANDICAM instrument on the SMARTS 1.3 m telescope at the Cerro Tololo Inter-American Observatory. As a result of this long-term, multiwavelength monitoring, we have produced a calibrated, publicly available data set (see www.astro.yale.edu/smarts/glast/home.php), which we have used to find that (i) optical-IR and gamma-ray light curves are well correlated, supporting inverse-Compton models for gamma-ray production (Bonning et al. 2009, 2012), (ii) at their brightest, blazar jets can contribute significantly to the photoionization of the broad-emission-line region, indicating that gamma-rays are produced within 0.1 pc of the black hole in at least some cases (Isler et al. 2014), and (iii) optical-IR and gamma-ray flares are symmetric, implying the time scales are dominated by light-travel-time effects rather than acceleration or cooling (Chatterjee et al. 2012). The volume of data and diversity of projects for which it is used calls out for an efficient means of visualization. To this end, we have developed a suite of visualization tools called SMARTScience Tools, which allow users to interact dynamically with our dataset. The SMARTScience Tools is publicly available via our webpage and can be used to customize multiwavelength light curves and color magnitude diagrams quickly and intuitively. Users can choose specific bands to construct plots, and the plots include features such as band-by-band panning, dynamic zooming, and direct mouse interaction with individual data points. Human and machine readable tables of the plotted data can be directly printed for the user's convenience and for further independent study. The SMARTScience Tools significantly improves the public’s ability to interact with the Yale-SMARTS 6-year data base of blazar photometry, and should make

  18. Polyketide synthases of Diaporthe helianthi and involvement of DhPKS1 in virulence on sunflower.

    Science.gov (United States)

    Ruocco, Michelina; Baroncelli, Riccardo; Cacciola, Santa Olga; Pane, Catello; Monti, Maurilia Maria; Firrao, Giuseppe; Vergara, Mariarosaria; Magnano di San Lio, Gaetano; Vannacci, Giovanni; Scala, Felice

    2018-01-06

    The early phases of Diaporthe helianthi pathogenesis on sunflower are characterized by the production of phytotoxins that may play a role in host colonisation. In previous studies, phytotoxins of a polyketidic nature were isolated and purified from culture filtrates of virulent strains of D. helianthi isolated from sunflower. A highly aggressive isolate (7/96) from France contained a gene fragment of a putative nonaketide synthase (lovB) which was conserved in a virulent D. helianthi population. In order to investigate the role of polyketide synthases in D. helianthi 7/96, a draft genome of this isolate was examined. We were able to find and phylogenetically analyse 40 genes putatively coding for polyketide synthases (PKSs). Analysis of their domains revealed that most PKS genes of D. helianthi are reducing PKSs, whereas only eight lacked reducing domains. Most of the identified PKSs have orthologs shown to be virulence factors or genetic determinants for toxin production in other pathogenic fungi. One of the genes (DhPKS1) corresponded to the previously cloned D. helianthi lovB gene fragment and clustered with a nonribosomal peptide synthetase (NRPS) -PKS hybrid/lovastatin nonaketide like A. nidulans LovB. We used DhPKS1 as a case study and carried out its disruption through Agrobacterium-mediated transformation in the isolate 7/96. D. helianthi DhPKS1 deleted mutants were less virulent to sunflower compared to the wild type, indicating a role for this gene in the pathogenesis of the fungus. The PKS sequences analysed and reported here constitute a new genomic resource that will be useful for further research on the biology, ecology and evolution of D. helianthi and generally of fungal plant pathogens.

  19. GERAKAN REVIVALISME ISLAM DAN WACANA PENERAPAN SYARIAH DI INDONESIA: Telaah Pengalaman PKS dan Salafi

    Directory of Open Access Journals (Sweden)

    Moh. Nurhakim

    2013-09-01

    Full Text Available This essay tries to critically evaluate a way of thinking developed among Salafi leader dan PKS as a movement of Islamic revivalism which related to the implementation of Islamic law (syari’ah into the Indonesian democracy context. There are a number of critical notes was discovered from literary researches and interviews with several leader of the movement. Firstly, basicly both PKS and Salafi leader longing for the implementation of Islamic law in the Indonesian democracy context. Despite the fact that PKS tend to act disparagingly toward democracy, while Salafi clearly repudiate democracy system, however, both of this group agree to “manipulate” this system to strugle for the embodiment of Islamic law with different strategies and substance. Secondly, PKS enters this system while trying to “objectify” Islamic values through preaching dan politics (structurally and culturally. In the same vein, Salafi manipulates democracy to strenghthen their ideological basis and their Islamic puritans awareness through preaching. Regarding politics, Salafi tends to be “pasive”.  Lastly, there are indications that the idea of the Islamic law implementation among PKS leader has dynamically changed following the politics dynamics. This often percieved as an inconsistency by the society. Meanwhile, the idea and efforts to implement Islamic law among Salafi leader is limited to the area of family rule and rarely about public rules. The result of this critical evaluation upon the implementation of Islamic law done by PKS and Salafi leaders, up to this point, have not provide a viable  recomendation as an ideal model of strengthening democracy system and implementing Islamic law in Indonesia.

  20. EXTENDED RADIO EMISSION IN MOJAVE BLAZARS: CHALLENGES TO UNIFICATION

    International Nuclear Information System (INIS)

    Kharb, P.; Lister, M. L.; Cooper, N. J.

    2010-01-01

    We present the results of a study on the kiloparsec-scale radio emission in the complete flux density limited MOJAVE sample, comprising 135 radio-loud active galactic nuclei. New 1.4 GHz Very Large Array (VLA) radio images of six quasars and previously unpublished images of 21 blazars are presented, along with an analysis of the high-resolution (VLA A-array) 1.4 GHz emission for the entire sample. While extended emission is detected in the majority of the sources, about 7% of the sources exhibit only radio core emission. We expect more sensitive radio observations, however, to detect faint emission in these sources, as we have detected in the erstwhile 'core-only' source, 1548+056. The kiloparsec-scale radio morphology varies widely across the sample. Many BL Lac objects exhibit extended radio power and kiloparsec-scale morphology typical of powerful FRII jets, while a substantial number of quasars possess radio powers intermediate between FRIs and FRIIs. This poses challenges to the simple radio-loud unified scheme, which links BL Lac objects to FRIs and quasars to FRIIs. We find a significant correlation between extended radio emission and parsec-scale jet speeds: the more radio powerful sources possess faster jets. This indicates that the 1.4 GHz (or low-frequency) radio emission is indeed related to jet kinetic power. Various properties such as extended radio power and apparent parsec-scale jet speeds vary smoothly between different blazar subclasses, suggesting that, at least in terms of radio jet properties, the distinction between quasars and BL Lac objects, at an emission-line equivalent width of 5 A, is essentially an arbitrary one. While the two blazar subclasses display a smooth continuation in properties, they often reveal differences in the correlation test results when considered separately. This can be understood if, unlike quasars, BL Lac objects do not constitute a homogeneous population, but rather include both FRI and FRII radio galaxies for

  1. Extended Radio Emission in MOJAVE Blazars: Challenges to Unification

    Science.gov (United States)

    Kharb, P.; Lister, M. L.; Cooper, N. J.

    2010-02-01

    We present the results of a study on the kiloparsec-scale radio emission in the complete flux density limited MOJAVE sample, comprising 135 radio-loud active galactic nuclei. New 1.4 GHz Very Large Array (VLA) radio images of six quasars and previously unpublished images of 21 blazars are presented, along with an analysis of the high-resolution (VLA A-array) 1.4 GHz emission for the entire sample. While extended emission is detected in the majority of the sources, about 7% of the sources exhibit only radio core emission. We expect more sensitive radio observations, however, to detect faint emission in these sources, as we have detected in the erstwhile "core-only" source, 1548+056. The kiloparsec-scale radio morphology varies widely across the sample. Many BL Lac objects exhibit extended radio power and kiloparsec-scale morphology typical of powerful FRII jets, while a substantial number of quasars possess radio powers intermediate between FRIs and FRIIs. This poses challenges to the simple radio-loud unified scheme, which links BL Lac objects to FRIs and quasars to FRIIs. We find a significant correlation between extended radio emission and parsec-scale jet speeds: the more radio powerful sources possess faster jets. This indicates that the 1.4 GHz (or low-frequency) radio emission is indeed related to jet kinetic power. Various properties such as extended radio power and apparent parsec-scale jet speeds vary smoothly between different blazar subclasses, suggesting that, at least in terms of radio jet properties, the distinction between quasars and BL Lac objects, at an emission-line equivalent width of 5 Å, is essentially an arbitrary one. While the two blazar subclasses display a smooth continuation in properties, they often reveal differences in the correlation test results when considered separately. This can be understood if, unlike quasars, BL Lac objects do not constitute a homogeneous population, but rather include both FRI and FRII radio galaxies for

  2. Characterisation of pks15/1 in clinical isolates of Mycobacterium tuberculosis from Mexico

    Directory of Open Access Journals (Sweden)

    Roberto Zenteno-Cuevas

    2013-09-01

    Full Text Available Tuberculosis (TB is an infectocontagious respiratory disease caused by members of the Mycobacterium tuberculosis complex. A 7 base pair (bp deletion in the locus polyketide synthase (pks15/1 is described as polymorphic among members of the M. tuberculosis complex, enabling the identification of Euro-American, Indo-Oceanic and Asian lineages. The aim of this study was to characterise this locus in TB isolates from Mexico. One hundred twenty clinical isolates were recovered from the states of Veracruz and Estado de Mexico. We determined the nucleotide sequence of a ± 400 bp fragment of the locus pks15/1, while genotypic characterisation was performed by spoligotyping. One hundred and fifty isolates contained the 7 bp deletion, while five had the wild type locus. Lineages X (22%, LAM (18% and T (17% were the most frequent; only three (2% of the isolates were identified as Beijing and two (1% EAI-Manila. The wild type pks15/1 locus was observed in all Asian lineage isolates tested. Our results confirm the utility of locus pks15/1 as a molecular marker for identifying Asian lineages of the M. tuberculosis complex. This marker could be of great value in the epidemiological surveillance of TB, especially in countries like Mexico, where the prevalence of such lineages is unknown.

  3. PERAN BUDAYA ORGANISASI DALAM MEWUJUDKAN VISI MISI PARTAI KEADILAN SEJAHTERA (PKS

    Directory of Open Access Journals (Sweden)

    Much. Yulianto

    2016-11-01

    The results showed: (1 organizational culture play a role in shaping the identity and character of party members; (2 The organizational culture also plays a role in encouraging loyalty and solidity of party members; (3 the organizational culture at PKS played role in strengthening the confidence of individual members.

  4. Multi-Wavelength Variability in PKS 2155-304 Y. G. Zheng1,2, L ...

    Indian Academy of Sciences (India)

    2009), we attempt to model the multi-wavelength variability in PKS 2155-304. We assume that the acceleration process is a stochastic process and we describe it as the diffusion of the particle momentum. Throughout the paper, we assume the. Hubble constant H0 = 70 km s−1. Mpc. −1. , the matter energy density M = 0.27,.

  5. The RINGO2 and DIPOL optical polarization catalogue of blazars

    Science.gov (United States)

    Jermak, H.; Steele, I. A.; Lindfors, E.; Hovatta, T.; Nilsson, K.; Lamb, G. P.; Mundell, C.; Barres de Almeida, U.; Berdyugin, A.; Kadenius, V.; Reinthal, R.; Takalo, L.

    2016-11-01

    We present ˜2000 polarimetric and ˜3000 photometric observations of 15 γ-ray bright blazars over a period of 936 days (2008-10-11 to 2012-10-26) using data from the Tuorla blazar monitoring program (KVA DIPOL) and Liverpool Telescope (LT) RINGO2 polarimeters (supplemented with data from SkyCamZ (LT) and Fermi-LAT γ-ray data). In 11 out of 15 sources we identify a total of 19 electric vector position angle (EVPA) rotations and 95 flaring episodes. We group the sources into subclasses based on their broad-band spectral characteristics and compare their observed optical and γ-ray properties. We find that (1) the optical magnitude and γ-ray flux are positively correlated, (2) EVPA rotations can occur in any blazar subclass, four sources show rotations that go in one direction and immediately rotate back, (3) we see no difference in the γ-ray flaring rates in the sample; flares can occur during and outside of rotations with no preference for this behaviour, (4) the average degree of polarization (DoP), optical magnitude and γ-ray flux are lower during an EVPA rotation compared with during non-rotation and the distribution of the DoP during EVPA rotations is not drawn from the same parent sample as the distribution outside rotations, (5) the number of observed flaring events and optical polarization rotations are correlated, however we find no strong evidence for a temporal association between individual flares and rotations and (6) the maximum observed DoP increases from ˜10 per cent to ˜30 per cent to ˜40 per cent for subclasses with synchrotron peaks at high, intermediate and low frequencies, respectively.

  6. Genetic diversity, phylogroup distribution and virulence gene profile of pks positive Escherichia coli colonizing human intestinal polyps.

    Science.gov (United States)

    Sarshar, Meysam; Scribano, Daniela; Marazzato, Massimiliano; Ambrosi, Cecilia; Aprea, Maria Rita; Aleandri, Marta; Pronio, Annamaria; Longhi, Catia; Nicoletti, Mauro; Zagaglia, Carlo; Palamara, Anna Teresa; Conte, Maria Pia

    2017-11-01

    Some Escherichia coli strains of phylogroup B2 harbor a (pks) pathogenicity island that encodes a polyketide-peptide genotoxin called colibactin. It causes DNA double-strand breaks and megalocytosis in eukaryotic cells and it may contribute to cancer development. Study of bacterial community that colonizes the adenomatous polyp lesion, defined as precancerous lesions, could be helpful to assess if such pathogenic bacteria possess a role in the polyp progression to cancer. In this cross-sectional study, a total of 1500 E. coli isolates were obtained from biopsies of patients presenting adenomatous colon polyps, the normal tissues adjacent to the polyp lesion and patients presenting normal mucosa. pks island frequency, phylogenetic grouping, fingerprint genotyping, and virulence gene features of pks positive (pks + ) E. coli isolates were performed. We found pks + E. coli strongly colonize two patients presenting polypoid lesions and none were identified in patients presenting normal mucosa. Predominant phylogroups among pks + E. coli isolates were B2, followed by D. Clustering based on fragment profiles of composite analysis, typed the pks + isolates into 5 major clusters (I-V) and 17 sub-clusters, demonstrating a high level of genetic diversity among them. The most prevalent virulence genes were fimH and fyuA (100%), followed by vat (92%), hra and papA (69%), ibeA (28%), and hlyA (25%). Our results revealed that pks + E. coli can colonize the precancerous lesions, with a high distribution in both the polyp lesions and in normal tissues adjacent to the lesion. The high differences in fingerprinting patterns obtained indicate that pks + E. coli strains were genetically diverse, possibly allowing them to more easily adapt to environmental variations. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. The radio-γ-ray connection in Fermi blazars

    Science.gov (United States)

    Ghirlanda, G.; Ghisellini, G.; Tavecchio, F.; Foschini, L.; Bonnoli, G.

    2011-05-01

    We study the correlation between the γ-ray flux (Fγ), averaged over the first 11 months of the Fermi survey and integrated above 100 MeV, and the radio flux density (Fr at 20 GHz) of Fermi sources associated with a radio counterpart in the 20-GHz Australia Telescope Compact Array (AT20G) survey. Considering the blazars detected in both bands, the correlation is highly significant and has the form Fγ∝F0.85±0.04r, similar to BL Lacertae objects and flat-spectrum radio quasars. However, only a small fraction (˜1/15) of the AT20G radio sources with flat radio spectra are detected by Fermi. To understand if this correlation is real, we examine the selection effects introduced by the flux limits of both the radio and the γ-ray surveys, and the importance of variability of the γ-ray flux. After accounting for these effects, we find that the radio-γ-ray flux correlation is real, but its slope is steeper than the observed one, that is, Fγ∝Fδr with δ in the range 1.25-1.5. The observed Fγ-Fr correlation and the fraction of radio sources detected by Fermi are reproduced assuming a long-term γ-ray flux variability, following a lognormal probability distribution with standard deviation σ≥ 0.5 (corresponding to Fγ varying by at least a factor of 3). Such a variability is compatible, even if not necessarily equal, with what is observed when comparing, for the sources in common, the EGRET and the Fermi γ-ray fluxes (even if the Fermi fluxes are averaged over ˜1 yr). Another indication of variability is the non-detection of 12 out of 66 EGRET blazars by Fermi, despite its higher sensitivity. We also study the strong linear correlation between the γ-ray and the radio luminosity of the 144 AT20G-Fermi associations with known redshift and show, through partial correlation analysis, that it is statistically robust. Two possible implications of these correlations are discussed: the contribution of blazars to the extragalactic γ-ray background and the prediction

  8. Simultaneous optical and infrared polarization measurements of blazars

    International Nuclear Information System (INIS)

    Brindle, C.; Hough, J.H.; Bailey, J.A.; Axon, D.J.; Hyland, A.R.

    1986-01-01

    Measurements are presented of the polarization and flux of a sample of 28 blazars (21 BL Lacs and 7 OVV quasars) at optical and near-infrared wavelengths, with repeated observations for some objects. For 20 objects, these are the first reported polarization measurements in either the optical or infrared, and for most of them the first simultaneous measurements at these wavelengths. Out of a total of 42 observations a spectral dependence of polarization level and position angle is found, although not necessarily occurring together, on 15 occasions. (author)

  9. FACT — LONGTERM MONITORING OF BRIGHT TeV BLAZARS

    Directory of Open Access Journals (Sweden)

    Katja Meier

    2014-06-01

    Full Text Available The First G-APD Cherenkov Telescope (FACT, located on the Canary Island of La Palma, has been taking data since October 2011. FACT has been optimized for longterm monitoring of bright TeV blazars, to study their variability time scales and flare probability. G-APD photo-sensors allow for observations even under strong moonlight conditions, and the telescope can be operated remotely. The monitoring strategy of FACT is discussed and preliminary results of the flare of Mrk501 in June 2012 are shown.

  10. High-energy sources at low radio frequency: the Murchison Widefield Array view of Fermi blazars

    International Nuclear Information System (INIS)

    Giroletti, M.; Massaro, F.; D’Abrusco, R.; Lico, R.; Burlon, D.

    2016-01-01

    Low-frequency radio arrays are opening a new window for the study of the sky, both to study new phenomena and to better characterize known source classes. Being flat-spectrum sources, blazars are so far poorly studied at low radio frequencies. In this paper, we characterize the spectral properties of the blazar population at low radio frequency, compare the radio and high-energy properties of the gamma-ray blazar population, and search for radio counterparts of unidentified gamma-ray sources. We cross-correlated the 6100 deg"2 Murchison Widefield Array Commissioning Survey catalogue with the Roma blazar catalogue, the third catalogue of active galactic nuclei detected by Fermi-LAT, and the unidentified members of the entire third catalogue of gamma-ray sources detected by Fermi-LAT. When available, we also added high-frequency radio data from the Australia Telescope 20 GHz catalogue. We find low-frequency counterparts for 186 out of 517 (36%) blazars, 79 out of 174 (45%) gamma-ray blazars, and 8 out of 73 (11%) gamma-ray blazar candidates. The mean low-frequency (120–180 MHz) blazar spectral index is (α_l_o_w) = 0.57 ± 0.02: blazar spectra are flatter than the rest of the population of low-frequency sources, but are steeper than at ~GHz frequencies. Low-frequency radio flux density and gamma-ray energy flux display a mildly significant and broadly scattered correlation. Ten unidentified gamma-ray sources have a (probably fortuitous) positional match with low radio frequency sources. Low-frequency radio astronomy provides important information about sources with a flat radio spectrum and high energy. However, the relatively low sensitivity of the present surveys still misses a significant fraction of these objects. Finally, upcoming deeper surveys, such as the GaLactic and Extragalactic All-Sky MWA (GLEAM) survey, will provide further insight into this population.

  11. Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein

    DEFF Research Database (Denmark)

    Fuglsang, Anja Thoe; Guo, Yan; Cuin, Tracey A.

    2007-01-01

    Regulation of the trans-plasma membrane pH gradient is an important part of plant responses to several hormonal and environmental cues, including auxin, blue light, and fungal elicitors. However, little is known about the signaling components that mediate this regulation. Here, we report...... that an Arabidopsis thaliana Ser/Thr protein kinase, PKS5, is a negative regulator of the plasma membrane proton pump (PM Hþ-ATPase). Loss-of-function pks5 mutant plants are more tolerant of high external pH due to extrusion of protons to the extracellular space. PKS5 phosphorylates the PM Hþ-ATPase AHA2 at a novel...

  12. Both a PKS and a PPTase are involved in melanin biosynthesis and regulation of Aureobasidium melanogenum XJ5-1 isolated from the Taklimakan desert.

    Science.gov (United States)

    Jiang, Hong; Liu, Guang-Lei; Chi, Zhe; Wang, Jian-Ming; Zhang, Ly-Ly; Chi, Zhen-Ming

    2017-02-20

    A PKS1 gene responsible for the melanin biosynthesis and a NPG1 gene in Aureobasidium melanogenum XJ5-1 were cloned and characterized. An ORF of the PKS1 gene encoding a protein with 2165 amino acids contained 6495bp while an ORF of the NPG1 gene encoding a protein with 340 amino acids had 1076bp. After analysis of their promoters, it was found that expression of both the PKS1 gene and the NPG1 gene was repressed by nitrogen sources and glucose, respectively. The PKS deduced from the cloned gene consisted of one ketosynthase, one acyl transferase, two acyl carrier proteins, one thioesterase and one cyclase while the PPTase belonged to the family Sfp-type. After disruption of the PKS1 gene and the NPG1 gene, expression of the PKS1 gene and the NPG1 gene and the melanin biosynthesis in the disruptants K5 and DP107 disappeared and expression of the PKS1 gene in the disruptant DP107 was also negatively influenced. However, after the NPG1 gene was complemented in the disruptant DP107, the melanin biosynthesis in the complementary strain BP17 was restored and expression of the PKS1 gene and the NPG1 gene was greatly enhanced, suggesting that the PKS was indeed activated and regulated by the PPTase and expression of the PKS1 gene and the NPG1 gene had a coordinate regulation. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. A Model of Polarisation Rotations in Blazars from Kink Instabilities in Relativistic Jets

    Directory of Open Access Journals (Sweden)

    Krzysztof Nalewajko

    2017-10-01

    Full Text Available This paper presents a simple model of polarisation rotation in optically thin relativistic jets of blazars. The model is based on the development of helical (kink mode of current-driven instability. A possible explanation is suggested for the observational connection between polarisation rotations and optical/gamma-ray flares in blazars, if the current-driven modes are triggered by secular increases of the total jet power. The importance of intrinsic depolarisation in limiting the amplitude of coherent polarisation rotations is demonstrated. The polarisation rotation amplitude is thus very sensitive to the viewing angle, which appears to be inconsistent with the observational estimates of viewing angles in blazars showing polarisation rotations. Overall, there are serious obstacles to explaining large-amplitude polarisation rotations in blazars in terms of current-driven kink modes.

  14. CHARACTERIZING THE OPTICAL VARIABILITY OF BRIGHT BLAZARS: VARIABILITY-BASED SELECTION OF FERMI ACTIVE GALACTIC NUCLEI

    International Nuclear Information System (INIS)

    Ruan, John J.; Anderson, Scott F.; MacLeod, Chelsea L.; Becker, Andrew C.; Davenport, James R. A.; Ivezić, Željko; Burnett, T. H.; Kochanek, Christopher S.; Plotkin, Richard M.; Sesar, Branimir; Stuart, J. Scott

    2012-01-01

    We investigate the use of optical photometric variability to select and identify blazars in large-scale time-domain surveys, in part to aid in the identification of blazar counterparts to the ∼30% of γ-ray sources in the Fermi 2FGL catalog still lacking reliable associations. Using data from the optical LINEAR asteroid survey, we characterize the optical variability of blazars by fitting a damped random walk model to individual light curves with two main model parameters, the characteristic timescales of variability τ, and driving amplitudes on short timescales σ-circumflex. Imposing cuts on minimum τ and σ-circumflex allows for blazar selection with high efficiency E and completeness C. To test the efficacy of this approach, we apply this method to optically variable LINEAR objects that fall within the several-arcminute error ellipses of γ-ray sources in the Fermi 2FGL catalog. Despite the extreme stellar contamination at the shallow depth of the LINEAR survey, we are able to recover previously associated optical counterparts to Fermi active galactic nuclei with E ≥ 88% and C = 88% in Fermi 95% confidence error ellipses having semimajor axis r < 8'. We find that the suggested radio counterpart to Fermi source 2FGL J1649.6+5238 has optical variability consistent with other γ-ray blazars and is likely to be the γ-ray source. Our results suggest that the variability of the non-thermal jet emission in blazars is stochastic in nature, with unique variability properties due to the effects of relativistic beaming. After correcting for beaming, we estimate that the characteristic timescale of blazar variability is ∼3 years in the rest frame of the jet, in contrast with the ∼320 day disk flux timescale observed in quasars. The variability-based selection method presented will be useful for blazar identification in time-domain optical surveys and is also a probe of jet physics.

  15. POLA REKRUTMEN CALONLEGISLATIF DAPIL 1 PROVINSI ACEH YANG DILAKUKAN OLEH PARTAI KEADILAN SEJAHTERA (PKS DAN PARTAI NASIONAL DEMOKRAT (NASDEM

    Directory of Open Access Journals (Sweden)

    Ruslan Ruslan

    2016-12-01

    Full Text Available Political recruitment is the process of filling positions in political institutions, including political parties. While the Political Party is a vehicle to bring a particular party political interests in the throne of power in order to achieve what is expected. The purpose of this research is to see how the pattern of recruiting candidates for legislative constituency 1 Aceh province conducted by PKS and NasDem Party, criteria to be used in recruiting candidates for legislative constituency 1 Aceh province conducted by PKS and NasDem Party and what the opportunities and challenges in recruiting candidates one electoral district conducted by PKS and NasDem Party. The method used is descriptive method with qualitative approach. The data collection was done by interview and documentation. The result showed that the pattern of recruiting candidates for the electoral district legilatif 1 Aceh province conducted by the PKS and NasDem show that much different. In connection with this, it is an opportunity and a challenge PKS namely the legislative elections of 2014 more challenges than opportunities obtained by the PKS because of money politics so were experienced by the Party NasDem money politics becomes the greatest challenge in the legislative election first times followed by the Party NasDem   DOI : http://dx.doi.org/10.17977/um019v1i22016p111

  16. Steady-state emission of blazars at very high energies

    Energy Technology Data Exchange (ETDEWEB)

    Hoehne-Moench, Daniel

    2010-07-01

    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018

  17. SYSTEMATIC STUDY OF GAMMA-RAY-BRIGHT BLAZARS WITH OPTICAL POLARIZATION AND GAMMA-RAY VARIABILITY

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Ryosuke; Fukazawa, Yasushi; Kanda, Yuka; Shiki, Kensei; Kawabata, Miho; Nakaoka, Tatsuya; Takaki, Katsutoshi; Takata, Koji; Ui, Takahiro [Department of Physical Science, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Nalewajko, Krzysztof; Madejski, Greg M. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Stanford University, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Uemura, Makoto; Tanaka, Yasuyuki T.; Kawabata, Koji S.; Akitaya, Hiroshi; Ohsugi, Takashi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Schinzel, Frank K. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Moritani, Yuki [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo Institutes for Advanced Study, The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Sasada, Mahito [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Yamanaka, Masayuki, E-mail: itoh@hep01.hepl.hiroshima-u.ac.jp, E-mail: itoh@hp.phys.titech.ac.jp [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); and others

    2016-12-10

    Blazars are highly variable active galactic nuclei that emit radiation at all wavelengths from radio to gamma rays. Polarized radiation from blazars is one key piece of evidence for synchrotron radiation at low energies, and it also varies dramatically. The polarization of blazars is of interest for understanding the origin, confinement, and propagation of jets. However, even though numerous measurements have been performed, the mechanisms behind jet creation, composition, and variability are still debated. We performed simultaneous gamma-ray and optical photopolarimetry observations of 45 blazars between 2008 July and 2014 December to investigate the mechanisms of variability and search for a basic relation between the several subclasses of blazars. We identify a correlation between the maximum degree of optical linear polarization and the gamma-ray luminosity or the ratio of gamma-ray to optical fluxes. Since the maximum polarization degree depends on the condition of the magnetic field (chaotic or ordered), this result implies a systematic difference in the intrinsic alignment of magnetic fields in parsec-scale relativistic jets between different types of blazars (flat-spectrum radio quasars vs. BL Lacs) and consequently between different types of radio galaxies (FR I versus FR II).

  18. New bounds on axionlike particles from the Fermi Large Area Telescope observation of PKS 2155 -304

    Science.gov (United States)

    Zhang, Cun; Liang, Yun-Feng; Li, Shang; Liao, Neng-Hui; Feng, Lei; Yuan, Qiang; Fan, Yi-Zhong; Ren, Zhong-Zhou

    2018-03-01

    The axionlike particle (ALP)-photon mixing in the magnetic field around γ -ray sources or along the line of sight could induce oscillation between photons and ALPs, which then causes irregularities in the γ -ray spectra. In this work we search for such spectral irregularities in the spectrum of PKS 2155 -304 using 8.6 years of data from the Fermi Large Area Telescope (Fermi-LAT). No significant evidence for the presence of ALP-photon oscillation is obtained, and the parameter space of ALPs is constrained. The exclusion region sensitively depends on the poorly known magnetic field of the host galaxy cluster of PKS 2155 -304 . If the magnetic field is as high as ˜10 μ G , the "holelike" parameter region allowed in Ref. [1] can be ruled out.

  19. A test of unification towards the radio source PKS1413+135

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, M.C., E-mail: up200802537@fc.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Ciências, Universidade do Porto, Rua do Campo Alegre, 4150-007 Porto (Portugal); Julião, M.D., E-mail: meinf12013@fe.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Engenharia, Universidade do Porto, Rua Dr Roberto Frias, 4200-465 Porto (Portugal); Martins, C.J.A.P., E-mail: Carlos.Martins@astro.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Monteiro, A.M.R.V.L., E-mail: mmonteiro@fc.up.pt [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Faculdade de Ciências, Universidade do Porto, Rua do Campo Alegre, 4150-007 Porto (Portugal); Department of Applied Physics, Delft University of Technology, P.O. Box 5046, 2600 GA Delft (Netherlands)

    2013-07-09

    We point out that existing astrophysical measurements of combinations of the fine-structure constant α, the proton-to-electron mass ratio μ and the proton gyromagnetic ratio g{sub p} towards the radio source PKS1413+135 can be used to individually constrain each of these fundamental couplings. While the accuracy of the available measurements is not yet sufficient to test the spatial dipole scenario, our analysis serves as a proof of concept as new observational facilities will soon allow significantly more robust tests. Moreover, these measurements can also be used to obtain constraints on certain classes of unification scenarios, and we compare the constraints obtained for PKS1413+135 with those previously obtained from local atomic clock measurements.

  20. A test of unification towards the radio source PKS1413+135

    International Nuclear Information System (INIS)

    Ferreira, M.C.; Julião, M.D.; Martins, C.J.A.P.; Monteiro, A.M.R.V.L.

    2013-01-01

    We point out that existing astrophysical measurements of combinations of the fine-structure constant α, the proton-to-electron mass ratio μ and the proton gyromagnetic ratio g p towards the radio source PKS1413+135 can be used to individually constrain each of these fundamental couplings. While the accuracy of the available measurements is not yet sufficient to test the spatial dipole scenario, our analysis serves as a proof of concept as new observational facilities will soon allow significantly more robust tests. Moreover, these measurements can also be used to obtain constraints on certain classes of unification scenarios, and we compare the constraints obtained for PKS1413+135 with those previously obtained from local atomic clock measurements

  1. OPTICAL SPECTROSCOPIC OBSERVATIONS OF GAMMA-RAY BLAZAR CANDIDATES. V. TNG, KPNO, AND OAN OBSERVATIONS OF BLAZAR CANDIDATES OF UNCERTAIN TYPE IN THE NORTHERN HEMISPHERE

    Energy Technology Data Exchange (ETDEWEB)

    Álvarez Crespo, N.; Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Masetti, N. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Ricci, F.; La Franca, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Patiño-Álvarez, V.; Chavushyan, V.; Torrealba, J. [Instituto Nacional de Astrofisica, Óptica y Electrónica, Apartado Postal 51-216, 72000 Puebla, México (Mexico); D’Abrusco, R.; Paggi, A.; Smith, Howard A. [Harvard—Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Jiménez-Bailón, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 877, Ensenada, 22800 Baja California, México (Mexico); Latronico, L. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)

    2016-02-15

    The extragalactic γ-ray sky is dominated by emission from blazars, a peculiar class of active galactic nuclei. Many of the γ-ray sources included in the Fermi-Large Area Telescope Third Source catalog (3FGL) are classified as blazar candidates of uncertain type (BCUs) because there are no optical spectra available in the literature to confirm their nature. In 2013, we started a spectroscopic campaign to look for the optical counterparts of the BCUs and of the unidentified γ-ray sources to confirm their blazar nature. Whenever possible we also determine their redshifts. Here, we present the results of the observations carried out in the northern hemisphere in 2013 and 2014 at the Telescopio Nazionale Galileo, Kitt Peak National Observatory, and Observatorio Astronómico Nacional in San Pedro Mártir. In this paper, we describe the optical spectra of 25 sources. We confirmed that all of the 15 BCUs observed in our campaign and included in our sample are blazars and we estimated the redshifts for three of them. In addition, we present the spectra for three sources classified as BL Lacs in the literature but with no optical spectra available to date. We found that one of them is a quasar (QSO) at a redshift of z = 0.208 and the other two are BL Lacs. Moreover, we also present seven new spectra for known blazars listed in the Roma-BZCAT that have an uncertain redshift or are classified as BL Lac candidates. We found that one of them, 5BZB J0724+2621, is a “changing look” blazar. According to the spectrum available in the literature, it was classified as a BL Lac, but in our observation we clearly detected a broad emission line that led us to classify this source as a QSO at z = 1.17.

  2. Dinamika Islam Politik Pasca Orde baru: Kajian Psikoanalisi Lacanian atas Hubungan KAMMI dan PKS

    Directory of Open Access Journals (Sweden)

    Ahmad Rizky Mardhatillah Umar

    2014-07-01

    Full Text Available This article aims at analyzing the relations between student movement andpolitical party in post-reform era of Indonesia. KAMMI, a prominent Islamiststudent movement in Indonesia, often associated with PKS (Prosperous JusticeParty in terms of identity and political practices. It has created ‘independencedilemma’ for KAMMI because since its first Congress in 1998, this studentorganization has declared ‘independent from all political forces’. This article,using Lacanian psychoanalytical tradition, exposes the forms of KAMMI’ssubjectivity and PKS interpellation that enable this political party to dominateKAMMI’s articulatory practices. The interpellation process is supported withthe projection of fantacy, emotion, and mirror in the development of KAMMIsince 1998 until present. It leads to PKS creating the KAMMI identity andthus made KAMMI’s articulatory practices identical with this party. However,there were several attempts to dislocate the hegemony through several internalreform movements. These attempts, although made contribution to internaldynamics within KAMMI, were unable to create alternative discourse dueto several limits of those movements. The case of KAMMI can be a model toexplain how other student movements develop and relate to political parties inIndonesian post-reform.

  3. Radio variability of the blazar AO 0235 + 164

    International Nuclear Information System (INIS)

    O'dell, S.L.; Dennison, B.; Broderick, J.J.; Altschuler, D.R.; Condon, J.J.; Payne, H.E.; Mitchell, K.J.

    1988-01-01

    The high-redshift blazar A0 0235 + 164 exhibits flux-density variations which are primarily of the less common variety in which low-frequency flux-density variations track the high-frequency variations but are delayed and of smaller amplitude. Observational results based on five years of monitoring are presented which are correlated over at least a factor of 50 frequency range in the sense expected for an expanding synchrotron component: outbursts propagating toward lower frequencies with diminishing amplitudes. A simple, semiempirical jet model is developed which accounts reasonably well for the radio properties of the object. The predictions of the model are compared with observations, examining the radio flux-density histories, the radio spectral evolution, the radio structure, and evidence for relativistic bulk motion. 59 references

  4. The VLBA-BU-BLAZAR Multi-Wavelength Monitoring Program

    Directory of Open Access Journals (Sweden)

    Svetlana Jorstad

    2016-10-01

    Full Text Available We describe a multiwavelength program of monitoring of a sample of bright γ-ray blazars, which the Boston University (BU group has being carrying out since June 2007. The program includes monthly monitoring with the Very Long Baseline Array at 43 GHz, optical photometric and polarimetric observations, construction and analysis of UV and X-ray light curves obtained with the Rossi X-ray Timing Explorer (RXTE and Swift satellites, and construction and analysis of γ-ray light curves based on data provided by the Large Area Telescope of the Fermi Gamma-ray Space Telescope. We present general results about the kinematics of parsec-scale radio jets, as well as the connection between γ-ray outbursts and jet events.

  5. BLAZAR ANTI-SEQUENCE OF SPECTRAL VARIATION WITHIN INDIVIDUAL BLAZARS: CASES FOR MRK 501 AND 3C 279

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jin; Zhang, Shuang-Nan; Liang, En-Wei, E-mail: zhang.jin@hotmail.com [National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)

    2013-04-10

    The jet properties of Mrk 501 and 3C 279 are derived by fitting broadband spectral energy distributions (SEDs) with lepton models. The derived {gamma}{sub b} (the break Lorenz factor of the electron distribution) is 10{sup 4}-10{sup 6} for Mrk 501 and 200 {approx} 600 for 3C 279. The magnetic field strength (B) of Mrk 501 is usually one order of magnitude lower than that of 3C 279, but their Doppler factors ({delta}) are comparable. A spectral variation feature where the peak luminosity is correlated with the peak frequency, which is opposite from the blazar sequence, is observed in the two sources. We find that (1) the peak luminosities of the two bumps in the SEDs for Mrk 501 depend on {gamma}{sub b} in both the observer and co-moving frames, but they are not correlated with B and {delta} and (2) the luminosity variation of 3C 279 is dominated by the external Compton (EC) peak and its peak luminosity is correlated with {gamma}{sub b} and {delta}, but anti-correlated with B. These results suggest that {gamma}{sub b} may govern the spectral variation of Mrk 501 and {delta} and B would be responsible for the spectral variation of 3C 279. The narrow distribution of {gamma}{sub b} and the correlation of {gamma}{sub b} and B in 3C 279 would be due to the cooling from the EC process and the strong magnetic field. Based on our brief discussion, we propose that this spectral variation feature may originate from the instability of the corona but not from the variation of the accretion rate as does the blazar sequence.

  6. PROFIL PEMBELAJARAN SAINS BERBASIS KELASS SEBAGAI UPAYA MENGEMBANGKAN KPS DAN MENINGKATKAN PKS SISWA (STUDI KASUS DI SMPN 1 KOTA JAMBI

    Directory of Open Access Journals (Sweden)

    Sukarno Sukarno

    2014-10-01

    Full Text Available Kegiatan Belajar Mengajar (KBM sains di tingkat SMP bertujuan untuk mengembangkan Keterampilan Proses Sains (KPS dan menanamkan Penguasaan Konsep Sains (PKS. Oleh karena itu, KBM sains harus memberikan peluang untuk mengembangkan KPS dan PKS secara bersama-sama dan tidak terpisahkan. KBM sains berbasis Kegiatan Eksplorasi Lingkungan Alam di Sekitar Sekolah (KELASS dianggap mampu memberikan ruang yang luas untuk mengembangkan KPS siswa dan PKS. Oleh karena itu, penelitian kualitatif ini dilakukan dengan tujuan untuk mengetahui apa saja faktor pendukung dan faktor penghambat pelaksanaan KBM sains berbasis KELASS dan implikasinya terhadap KPS dan PKS siswa. Data hasil wawancara, observasi dan tes menunjukkan bahwa faktor pendukung KBM sains berbasis KELASS adalah sarana dan prasarana (indoor dan outdoor yang memadai. Sedangkan kendala utama bagi para guru sains adalah tidak adanya bahan ajar sains yang berorientasi pada eksplorasi lingkungan alam sekitar sekolah untuk mengembangkan mahasiswa KPS dan PKS. Oleh karena itu, perlu dikembangkan bahan ajar sains yang dapat mempermudah guru sains dalam melakukan KBM sains berbasis KELASS.   Kata kunci:    eksplorasi lingkungan alam di sekitar sekolah, keterampilan proses sains, penguasaan konsep sains

  7. On the intrinsic shape of the gamma-ray spectrum for Fermi blazars

    Science.gov (United States)

    Kang, Shi-Ju; Wu, Qingwen; Zheng, Yong-Gang; Yin, Yue; Song, Jia-Li; Zou, Hang; Feng, Jian-Chao; Dong, Ai-Jun; Wu, Zhong-Zu; Zhang, Zhi-Bin; Wu, Lin-Hui

    2018-05-01

    The curvature of the γ-ray spectrumin blazarsmay reflect the intrinsic distribution of emitting electrons, which will further give some information on the possible acceleration and cooling processes in the emitting region. The γ-ray spectra of Fermi blazars are normally fitted either by a single power-law (PL) or a log-normal (call Logarithmic Parabola, LP) form. The possible reason for this difference is not clear. We statistically explore this issue based on the different observational properties of 1419 Fermi blazars in the 3LAC Clean Sample.We find that the γ-ray flux (100MeV–100GeV) and variability index follow bimodal distributions for PL and LP blazars, where the γ-ray flux and variability index show a positive correlation. However, the distributions of γ-ray luminosity and redshift follow a unimodal distribution. Our results suggest that the bimodal distribution of γ-ray fluxes for LP and PL blazars may not be intrinsic and all blazars may have an intrinsically curved γ-ray spectrum, and the PL spectrum is just caused by the fitting effect due to less photons.

  8. VizieR Online Data Catalog: Blazars equivalent widths and radio luminosity (Landt+, 2004)

    Science.gov (United States)

    Landt, H.; Padovani, P.; Perlman, E. S.; Giommi, P.

    2004-07-01

    Blazars are currently separated into BL Lacertae objects (BL Lacs) and flat spectrum radio quasars based on the strength of their emission lines. This is performed rather arbitrarily by defining a diagonal line in the Ca H&K break value-equivalent width plane, following Marcha et al. (1996MNRAS.281..425M). We readdress this problem and put the classification scheme for blazars on firm physical grounds. We study ~100 blazars and radio galaxies from the Deep X-ray Radio Blazar Survey (DXRBS, Cat. and ) and 2-Jy radio survey and find a significant bimodality for the narrow emission line [OIII]{lambda}5007. This suggests the presence of two physically distinct classes of radio-loud active galactic nuclei (AGN). We show that all radio-loud AGN, blazars and radio galaxies, can be effectively separated into weak- and strong-lined sources using the [OIII]{lambda}5007-[OII]{lambda}3727 equivalent width plane. This plane allows one to disentangle orientation effects from intrinsic variations in radio-loud AGN. Based on DXRBS, the strongly beamed sources of the new class of weak-lined radio-loud AGN are made up of BL Lacs at the ~75 per cent level, whereas those of the strong-lined radio-loud AGN include mostly (~97 per cent) quasars. (4 data files).

  9. Parsec-Scale Properties of Gamma-Ray Bright Blazars

    Science.gov (United States)

    Linford, Justin Dee

    The parsec-scale radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been investigated using observations with the Very Long Baseline Array (VLBA). Comparisons between LAT and non-LAT detected samples were made using both archival and contemporaneous data. In total, 244 sources were used in the LAT-detected sample. This very large, radio flux-limited sample of active galactic nuclei (AGN) provides insights into the mechanism that produces strong gamma-ray emission. It has been found that LAT-detected BL Lac objects are very similar to the non-LAT BL Lac objects in most properties, although LAT BL Lac objects may have longer jets. The LAT flat spectrum radio quasars (FSRQs) are significantly different from non-LAT FSRQs and are likely extreme members of the FSRQ population. Archival radio data indicated that there was no significant correlation between radio flux density and gamma-ray flux, especially at lower flux levels. However, contemporaneous observations showed a strong correlation. Most of the differences between the LAT and non-LAT populations are related to the cores of the sources, indicating that the gamma-ray emission may originate near the base of the jets (i.e., within a few pc of the central engine). There is some indication that LAT-detected sources may have larger jet opening angles than the non-LAT sources. Strong core polarization is significantly more common among the LAT sources, suggesting that gamma-ray emission is related to strong, uniform magnetic fields at the base of the jets of the blazars. Observations of sources in two epochs indicate that core fractional polarization was higher when the objects were detected by the LAT. The low-synchrotron peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac

  10. Crystallization and preliminary X-ray analysis of the bacillaene synthase trans-acting acyltransferase PksC

    International Nuclear Information System (INIS)

    Cuskin, Fiona; Solovyova, Alexandra S.; Lewis, Richard J.; Race, Paul R.

    2011-01-01

    The expression, purification and crystallization of the trans-acting acyltransferase PksC from the bacillaene hybrid polyketide synthase/nonribosomal peptide synthetase is described. The crystals belonged to the orthorhombic space group P2 1 2 1 2 1 and diffracted to 1.44 Å resolution. The antibiotic bacillaene is biosynthesized in Bacillus subtilis by a hybrid type 1 modular polyketide synthase/nonribosomal peptide synthetase of the trans-acyltransferase (trans-AT) class. Within this system, the essential acyl-group loading activity is provided by the action of three free-standing trans-acting acyltransferases. Here, the recombinant expression, purification and crystallization of the bacillaene synthase trans-acting acyltransferase PksC are reported. A diffraction data set has been collected from a single PksC crystal to 1.44 Å resolution and the crystal was found to belong to the orthorhombic space group P2 1 2 1 2 1

  11. ALMA observations of AGN fuelling. The case of PKS B1718-649

    Science.gov (United States)

    Maccagni, F. M.; Morganti, R.; Oosterloo, T. A.; Oonk, J. B. R.; Emonts, B. H. C.

    2018-06-01

    We present ALMA observations of the 12CO (2-1) line of the newly born (tradio 102 years) active galactic nucleus (AGN), PKS B1718-649. These observations reveal that the carbon monoxide in the innermost 15 kpc of the galaxy is distributed in a complex warped disk. In the outer parts of this disk, the CO gas follows the rotation of the dust lane and of the stellar body of the galaxy hosting the radio source. In the innermost kiloparsec, the gas abruptly changes orientation and forms a circumnuclear disk (r ≲ 700 pc) with its major axis perpendicular to that of the outer disk. Against the compact radio emission of PKS B1718-649 (r 2 pc), we detect an absorption line at red-shifted velocities with respect to the systemic velocity (Δv = +365 ± 22 km s-1). This absorbing CO gas could trace molecular clouds falling onto the central super-massive black hole. A comparison with the near-infrared H2 1-0 S(1) observations shows that the clouds must be close to the black hole (r ≲ 75 pc). The physical conditions of these clouds are different from the gas at larger radii, and are in good agreement with the predictions for the conditions of the gas when cold chaotic accretion triggers an active galactic nucleus. These observations on the centre of PKS B1718-649 provide one of the best indications that a population of cold clouds is falling towards a radio AGN, likely fuelling its activity. The reduced datacube is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/A42

  12. Infrared polarimetry of the nucleus of Centaurus A: the nearest blazar

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, J; Sparks, W B; Hough, J H; Axon, D J

    1986-07-10

    As one of the nearest examples of an active galaxy, NGC5128 (Centaurus A) has been studied in detail over a wide range of wavelengths. The authors have made polarization observations of the infrared nucleus at wavelengths from 1.2 to 3.8 ..mu..m. The nucleus is found to have a large intrinsic polarization of approx.=9% at position angle 147/sup 0/. This position angle is perpendicular to the direction of the X-ray and radio jet. The polarized emission from the nucleus is interpreted as synchrotron radiation from a region whose magnetic field is parallel to the jet direction. The properties of the Cen A nucleus are essentially identical to those of the much more luminous blazars. This suggest that blazar-type activity extends over a very wide range in luminosity, and low-luminosity blazars may be common in elliptical galaxies.

  13. Polarization and brightness of the blazar S5 0716+714 in 1991-2004

    Science.gov (United States)

    Doroshenko, V. T.; Kiselev, N. N.

    2017-06-01

    We investigate the photometric and polarimetric behavior of the blazar S5 0716+714 based on the observations carried out in 1991-2004 at the 125-cm Crimean Astrophysical Observatory telescope (AZT11) with a photopolarimeter that allows simultaneous polarization and brightness measurements to be made in the U BV RI bands. We also provide the U BV photometry for the blazar obtained in 2000-2009 with a 60-cm telescope at the Crimean Station of the Sternberg Astronomical Institute. The pattern of flux variability and the correlation between the brightness, color, and polarization variations have been investigated. In this time interval the blazar showed a significant brightness and polarization variability similar to noise processes.

  14. GAMMA-RAY OBSERVATIONAL PROPERTIES OF TeV-DETECTED BLAZARS

    International Nuclear Information System (INIS)

    Şentürk, G. D.; Errando, M.; Mukherjee, R.; Böttcher, M.

    2013-01-01

    The synergy between the Fermi-LAT and ground-based Cherenkov telescope arrays gives us the opportunity for the first time to characterize the high-energy emission from blazars over 5 decades in energy, from 100 MeV to 10 TeV. In this study, we perform a Fermi-LAT spectral analysis for TeV-detected blazars and combine it with archival TeV data. We examine the observational properties in the γ-ray band of our sample of TeV-detected blazars and compare the results with X-ray and GeV-selected populations. The spectral energy distributions (SEDs) that result from combining Fermi-LAT and ground-based spectra are studied in detail. Simple parameterizations such as a power-law function do not always reproduce the high-energy SEDs, where spectral features that could indicate intrinsic absorption are observed.

  15. DETECTION OF VERY HARD γ -RAY SPECTRUM FROM THE TEV BLAZAR MRK 501

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, A.; Chitnis, V. R.; Acharya, B. S. [Department of High Energy Physics, Tata Institute of Fundamental Research, Mumbai 400005 (India); Mannheim, K.; Dorner, D. [Institute for Theoretical Physics and Astrophysics, Universität Würzburg, D-97074 Würzburg (Germany); Roy, J. [UM-DAE Center for Excellence in Basic Sciences, Mumbai 400098 (India); Hughes, G.; Biland, A. [ETH Zurich, Institute for Particle Physics, Otto-Stern-Weg 5, 8093 Zurich (Switzerland)

    2016-12-01

    The occasional hardening of the GeV-to-TeV spectrum observed from the blazar Mrk 501 has reopened the debate on the physical origin of radiation and particle acceleration processes in TeV blazars. We have used the ∼7 years of Fermi -LAT data to search for the time intervals with unusually hard spectra from the nearby TeV blazar Mrk 501. We detected hard spectral components above 10 GeV with photon index <1.5 at a significance level of more than 5 sigma on 17 occasions, each with 30 day integration time. The photon index of the hardest component reached a value of 0.89 ± 0.29. We interpret these hard spectra as signatures of intermittent injection of sharply peaked and localized particle distributions from the base of the jet.

  16. Multifrequency VLA observations of PKS 0745-191: the archetypal 'cooling flow' radio source?

    International Nuclear Information System (INIS)

    Baum, S.A.; O'Dea, C.P.

    1991-01-01

    We present 90-, 20-, 6- and 2-cm VLA observations of the high radio luminosity, cooling flow radio source PKS 0745-191. We find that the radio source has a core with a very steep spectrum and diffuse emission with an even steeper spectrum without clear indications of the jets, hotspots or double lobes found in other radio sources of comparable luminosity. The appearance of the source is highly dependent on frequency and resolution. This dependence reflects both the diffuse nature of the extended emission and the steep, but position-dependent, spectrum of the radio emission. (author)

  17. Characterizing the Optical Variability of Bright Blazars: Variability-based Selection of Fermi Active Galactic Nuclei

    Science.gov (United States)

    Ruan, John J.; Anderson, Scott F.; MacLeod, Chelsea L.; Becker, Andrew C.; Burnett, T. H.; Davenport, James R. A.; Ivezić, Željko; Kochanek, Christopher S.; Plotkin, Richard M.; Sesar, Branimir; Stuart, J. Scott

    2012-11-01

    We investigate the use of optical photometric variability to select and identify blazars in large-scale time-domain surveys, in part to aid in the identification of blazar counterparts to the ~30% of γ-ray sources in the Fermi 2FGL catalog still lacking reliable associations. Using data from the optical LINEAR asteroid survey, we characterize the optical variability of blazars by fitting a damped random walk model to individual light curves with two main model parameters, the characteristic timescales of variability τ, and driving amplitudes on short timescales \\hat{\\sigma }. Imposing cuts on minimum τ and \\hat{\\sigma } allows for blazar selection with high efficiency E and completeness C. To test the efficacy of this approach, we apply this method to optically variable LINEAR objects that fall within the several-arcminute error ellipses of γ-ray sources in the Fermi 2FGL catalog. Despite the extreme stellar contamination at the shallow depth of the LINEAR survey, we are able to recover previously associated optical counterparts to Fermi active galactic nuclei with E >= 88% and C = 88% in Fermi 95% confidence error ellipses having semimajor axis r beaming. After correcting for beaming, we estimate that the characteristic timescale of blazar variability is ~3 years in the rest frame of the jet, in contrast with the ~320 day disk flux timescale observed in quasars. The variability-based selection method presented will be useful for blazar identification in time-domain optical surveys and is also a probe of jet physics.

  18. THE CONTRIBUTION OF FERMI -2LAC BLAZARS TO DIFFUSE TEV–PEV NEUTRINO FLUX

    Energy Technology Data Exchange (ETDEWEB)

    Aartsen, M. G. [Department of Physics, University of Adelaide, Adelaide, 5005 (Australia); Abraham, K. [Physik-department, Technische Universität München, D-85748 Garching (Germany); Ackermann, M. [DESY, D-15735 Zeuthen (Germany); Adams, J. [Dept. of Physics and Astronomy, University of Canterbury, Private Bag 4800, Christchurch (New Zealand); Aguilar, J. A.; Ansseau, I. [Université Libre de Bruxelles, Science Faculty CP230, B-1050 Brussels (Belgium); Ahlers, M. [Dept. of Physics and Wisconsin IceCube Particle Astrophysics Center, University of Wisconsin, Madison, WI 53706 (United States); Ahrens, M. [Oskar Klein Centre and Dept. of Physics, Stockholm University, SE-10691 Stockholm (Sweden); Altmann, D.; Anton, G. [Erlangen Centre for Astroparticle Physics, Friedrich-Alexander-Universität Erlangen-Nürnberg, D-91058 Erlangen (Germany); Andeen, K. [Department of Physics, Marquette University, Milwaukee, WI, 53201 (United States); Anderson, T.; Arlen, T. C. [Dept. of Physics, Pennsylvania State University, University Park, PA 16802 (United States); Archinger, M.; Baum, V. [Institute of Physics, University of Mainz, Staudinger Weg 7, D-55099 Mainz (Germany); Arguelles, C.; Axani, S. [Dept. of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Auffenberg, J. [III. Physikalisches Institut, RWTH Aachen University, D-52056 Aachen (Germany); Bai, X. [Physics Department, South Dakota School of Mines and Technology, Rapid City, SD 57701 (United States); Barwick, S. W., E-mail: thorsten.gluesenkamp@fau.de [Dept. of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Collaboration: IceCube Collaboration; and others

    2017-01-20

    The recent discovery of a diffuse cosmic neutrino flux extending up to PeV energies raises the question of which astrophysical sources generate this signal. Blazars are one class of extragalactic sources which may produce such high-energy neutrinos. We present a likelihood analysis searching for cumulative neutrino emission from blazars in the 2nd Fermi -LAT AGN catalog (2LAC) using IceCube neutrino data set 2009-12, which was optimized for the detection of individual sources. In contrast to those in previous searches with IceCube, the populations investigated contain up to hundreds of sources, the largest one being the entire blazar sample in the 2LAC catalog. No significant excess is observed, and upper limits for the cumulative flux from these populations are obtained. These constrain the maximum contribution of 2LAC blazars to the observed astrophysical neutrino flux to 27% or less between around 10 TeV and 2 PeV, assuming the equipartition of flavors on Earth and a single power-law spectrum with a spectral index of −2.5. We can still exclude the fact that 2LAC blazars (and their subpopulations) emit more than 50% of the observed neutrinos up to a spectral index as hard as −2.2 in the same energy range. Our result takes into account the fact that the neutrino source count distribution is unknown, and it does not assume strict proportionality of the neutrino flux to the measured 2LAC γ -ray signal for each source. Additionally, we constrain recent models for neutrino emission by blazars.

  19. FACT. More than four years of blazar monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Dorner, Daniela [Universitaet Wuerzburg (Germany); Collaboration: FACT-Collaboration

    2016-07-01

    Since October 2011, the First G-APD Cherenkov Telescope (FACT) has been collecting more than 5500 hours of physics data. Thanks to the silicon based photosensors (SiPMs, aka G-APDs), observations during bright ambient light like full moon can be carried out without degradation of the sensors. Keeping the gain of the SiPMs stable using an online feedback system, a stable and homogeneous detector performance is achieved. Based on this and an automatic data taking procedure, an unbiased longterm data sample is collected. An automatic quick look analysis provides results shortly after the data are taken allowing to send flare alerts within the same night. The main targets for FACT are the bright TeV blazars Mrk 421 and Mrk 501 which are monitored since January 2012. In addition, several other sources like for example the Crab Nebula, 1ES 1959+650, 1ES 2344+54.1 are observed. In this presentation, the results from more than four years of monitoring are summarized. Several flares from Mrk 501 and Mrk 421 are discussed in the multi-wavelength (MWL) context. Mrk 501 underwent major outbursts in June 2012 and June 2014 during the yearly MWL campaigns. Mrk 421 showed a bright flare in April 2013 where also MWL observations are available. 1ES 1959+650 showed enhanced flux in autumn 2015. Results from these observations are discussed.

  20. Long-term monitoring of blazars - the DWARF network

    Science.gov (United States)

    Backes, Michael; Biland, Adrian; Boller, Andrea; Braun, Isabel; Bretz, Thomas; Commichau, Sebastian; Commichau, Volker; Dorner, Daniela; von Gunten, Hanspeter; Gendotti, Adamo; Grimm, Oliver; Hildebrand, Dorothée; Horisberger, Urs; Krähenbühl, Thomas; Kranich, Daniel; Lustermann, Werner; Mannheim, Karl; Neise, Dominik; Pauss, Felicitas; Renker, Dieter; Rhode, Wolfgang; Rissi, Michael; Rollke, Sebastian; Röser, Ulf; Stark, Luisa Sabrina; Stucki, Jean-Pierre; Viertel, Gert; Vogler, Patrick; Weitzel, Quirin

    The variability of the very high energy (VHE) emission from blazars seems to be connected with the feeding and propagation of relativistic jets and with their origin in supermassive black hole binaries. The key to understanding their properties is measuring well-sampled gamma-ray lightcurves, revealing the typical source behavior unbiased by prior knowledge from other wavebands. Using ground-based gamma-ray observatories with exposures limited by dark-time, a global network of several telescopes is needed to carry out fulltime measurements. Obviously, such observations are time-consuming and, therefore, cannot be carried out with the present state of the art instruments. The DWARF telescope on the Canary Island of La Palma is dedicated to monitoring observations. It is currently being set up, employing a costefficient and robotic design. Part of this project is the future construction of a distributed network of small telescopes. The physical motivation of VHE long-term monitoring will be outlined in detail and the perspective for a network for 24/7 observations will be presented.

  1. Search for Magnetically Broadened Cascade Emission from Blazars with VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Archambault, S.; Griffin, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Alonso, M. Fernández [Instituto de Astronomía y Física del Espacio (IAFE, CONICET-UBA), CC 67—Suc. 28, (C1428ZAA) Ciudad Autónoma de Buenos Aires (Argentina); Fleischhack, H.; Hütten, M. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Fortson, L. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Furniss, A. [Department of Physics, California State University—East Bay, Hayward, CA 94542 (United States); Hervet, O.; Johnson, C. A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Holder, J. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Humensky, T. B., E-mail: elisa.pueschel@ucd.ie, E-mail: weisgarber@physics.wisc.edu [Physics Department, Columbia University, New York, NY 10027 (United States); and others

    2017-02-01

    We present a search for magnetically broadened gamma-ray emission around active galactic nuclei (AGNs), using VERITAS observations of seven hard-spectrum blazars. A cascade process occurs when multi-TeV gamma-rays from an AGN interact with extragalactic background light (EBL) photons to produce electron–positron pairs, which then interact with cosmic microwave background photons via inverse-Compton scattering to produce gamma-rays. Due to the deflection of the electron–positron pairs, a non-zero intergalactic magnetic field (IGMF) would potentially produce detectable effects on the angular distribution of the cascade emission. In particular, an angular broadening compared to the unscattered emission could occur. Through non-detection of angularly broadened emission from 1ES 1218+304, the source with the largest predicted cascade fraction, we exclude a range of IGMF strengths around 10{sup −14} G at the 95% confidence level. The extent of the exclusion range varies with the assumptions made about the intrinsic spectrum of 1ES 1218+304 and the EBL model used in the simulation of the cascade process. All of the sources are used to set limits on the flux due to extended emission.

  2. Search for neutrino emission from gamma-ray flaring blazars with the ANTARES telescope

    OpenAIRE

    Adrián-Martínez, S.; Al Samarai, Imen; Albert, A.; André, Michel; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Astraatmadja, T.; Aubert, J.-J.; Baret, B.; Basa, S.; Bertin, V.; Biagi, S.; Bigongiari, C.

    2011-01-01

    The ANTARES telescope is well-suited to detect neutrinos produced in astrophysical transient sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. Radio-loud active galactic nuclei with jets pointing almost directly towards the observer, the so-called blazars, are particularly attractive potential neutrino point sources. The all-sky monitor LAT on board the Fermi satellite probes the variability of any given gamma-ray bright blazar in the sky on time scal...

  3. An unusually strong Einstein ring in the radio source PKS1830-211

    International Nuclear Information System (INIS)

    Jauncey, D.L.

    1991-01-01

    RADIO observations of the strong, flat-spectrum radio source PKS1830-211 revealed a double structure, with a separation of 1 arcsec, suggesting that it might be a gravitationally lensed object. We have now obtained high-resolution radio images of PKS1830-211 from several interferometric radiotelescope networks, which show an unusual elliptical ring-like structure connecting the two brighter components. The presence of the ring, and the similarity of the two brighter spots, argue strongly that this is indeed a gravitationally lensed system, specifically an Einstein ring in which lens and lensed object are closely aligned. Although the source is close to the galactic plane, it seems that both the lens and background (lensed) object are extragalactic. This object is one hundred times brighter than either of the two previously discovered radio Einstein rings, and is among the six brightest flat-spectrum sources in the sky. Its brightness makes it a peculiar object: it must involve either a chance alignment of a lensing object with an unusually bright background source, or an alignment with a less bright object but amplified to an unusual degree. (author)

  4. Blazar Sheath Illumination of the Outer Molecular Torus: A Resolution of the Seed Photon Problem for the Far-GeV Blazar Flares

    Science.gov (United States)

    Breiding, Peter; Georganopoulos, Markos; Meyer, Eileen T.

    2018-01-01

    Recent multiwavelength work led by the Boston University blazar group (e.g., Marscher et al.) strongly suggests that a fraction of the blazar flares seen by the Fermi Large Area Telescope (LAT) take place a few to several pc away from the central engine. However, at such distances from the central engine, there is no adequate external photon field to provide the seed photons required for producing the observed GeV emission under leptonic inverse Compton (IC) models. A possible solution is a spine-sheath geometry for the emitting region (MacDonald et al., but see Nalewajko et al.). Here we use the current view of the molecular torus (e.g., Elitzur; Netzer), in which the torus extends a few pc beyond the dust sublimation radius with dust clouds distributed with a declining density for decreasing polar angle. We show that for a spine-sheath blazar jet embedded in the torus, the wide beaming pattern of the synchrotron radiation of the relatively slow sheath will heat molecular clouds with subsequent IR radiation that will be highly boosted in the spine comoving frame, and that under reasonable conditions this photon field can dominate over the sheath photons directly entering the spine. If the sheath is sufficiently luminous it will sublimate the dust, and if the sheath synchrotron radiation extends to optical-UV energies (as may happen during flares), this will illuminate the sublimated dust clouds to produce emission lines that will vary in unison with the optical-UV continuum, as has been very recently reported for blazar CTA 102 (Jorstad et al.).

  5. Energy distribution and variability of BL Lac objects. The cases of PKS 2155-304 and 3C 66A

    International Nuclear Information System (INIS)

    Maraschi, L.; Maccagni, D.; Tanzi, E.G.; Treves, A.

    1983-01-01

    The BL Lacertae objects, PKS 2155-304 and 3C66A have been observed in the ultraviolet and the X-ray region. The radiation flux in both regions are discussed with respect to its energy and time dependence. (Auth.)

  6. Is the GeV-TeV emission of PKS 0447-439 from the proton synchrotron radiation?

    Science.gov (United States)

    Gao, Quan-Gui; Lu, Fang-Wu; Ma, Ju; Ren, Ji-Yang; Li, Huai-Zhen

    2018-06-01

    We study the multi-wavelength emission features of PKS 0447-439 in the frame of the one-zone homogeneous lepto-hadronic model. In this model, we assumed that the steady power-laws with exponential cut-offs distributions of protons and electrons are injected into the source. The non-linear time-dependent kinematic equations, describing the evolution of protons, electrons and photons, are defined; these equations self-consistently involve synchrotron radiation of protons, photon-photon interaction, synchrotron radiation of electron/positron pairs, inverse Compton scattering and synchrotron self-absorption. The model is applied to reproduce the multi-wavelength spectrum of PKS 0447-439. Our results indicate that the spectral energy distribution (SED) of PKS 0447-439 can be reproduced well by the model. In particular, the GeV-TeV emission is produced by the synchrotron radiation of relativistic protons. The physically plausible solutions require the magnetic strength 10 G≲ B ≲ 100 G. We found that the observed spectrum of PKS 0447-439 can be reproduced well by the model whether z = 0.16 or z = 0.2, and the acceptable upper limit of redshift is z=0.343.

  7. Variability of Spectral Energy Distribution of Blazar S5 0716+714 B ...

    Indian Academy of Sciences (India)

    one-zone BPL model is over-simplified in accounting for the radio-optical blazar emission. ... a number of authors (e.g., Vittorini et al. 2009; Raiteri et ... contribution from starlight to the optical bands, which will modify the calculated synchrotron ...

  8. UPPER LIMITS FROM FIVE YEARS OF BLAZAR OBSERVATIONS WITH THE VERITAS CHERENKOV TELESCOPES

    Energy Technology Data Exchange (ETDEWEB)

    Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Fleischhack, H., E-mail: wystan.benbow@cfa.harvard.edu, E-mail: matteo.cerruti@lpnhe.in2p3.fr, E-mail: caajohns@ucsc.edu [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Collaboration: VERITAS collaboration; and others

    2016-06-01

    Between the beginning of its full-scale scientific operations in 2007 and 2012, the VERITAS Cherenkov telescope array observed more than 130 blazars; of these, 26 were detected as very-high-energy (VHE; E > 100 GeV) γ -ray sources. In this work, we present the analysis results of a sample of 114 undetected objects. The observations constitute a total live-time of ∼570 hr. The sample includes several unidentified Fermi -Large Area Telescope (LAT) sources (located at high Galactic latitude) as well as all the sources from the second Fermi -LAT catalog that are contained within the field of view of the VERITAS observations. We have also performed optical spectroscopy measurements in order to estimate the redshift of some of these blazars that do not have spectroscopic distance estimates. We present new optical spectra from the Kast instrument on the Shane telescope at the Lick observatory for 18 blazars included in this work, which allowed for the successful measurement or constraint on the redshift of four of them. For each of the blazars included in our sample, we provide the flux upper limit in the VERITAS energy band. We also study the properties of the significance distributions and we present the result of a stacked analysis of the data set, which shows a 4 σ excess.

  9. On the origin of gamma rays in Fermi blazars: beyond the broad line region.

    Science.gov (United States)

    Costamante, L.; Cutini, S.; Tosti, G.; Antolini, E.; Tramacere, A.

    2018-05-01

    The gamma-ray emission in broad-line blazars is generally explained as inverse Compton (IC) radiation of relativistic electrons in the jet scattering optical-UV photons from the Broad Line Region (BLR), the so-called BLR External Compton scenario. We test this scenario on the Fermi gamma-ray spectra of 106 broad-line blazars detected with the highest significance or largest BLR, by looking for cut-off signatures at high energies compatible with γ-γ interactions with BLR photons. We do not find evidence for the expected BLR absorption. For 2/3 of the sources, we can exclude any significant absorption (τmax 5). We conclude that for 9 out of 10 objects, the jet does not interact with BLR photons. Gamma-rays seem either produced outside the BLR most of the time, or the BLR is ˜100 × larger than given by reverberation mapping. This means that i) External Compton on BLR photons is disfavoured as the main gamma-ray mechanism, vs IC on IR photons from the torus or synchrotron self-Compton; ii) the Fermi gamma-ray spectrum is mostly intrinsic, determined by the interaction of the particle distribution with the seed-photons spectrum; iii) without suppression by the BLR, broad-line blazars can become copious emitters above 100 GeV, as demonstrated by 3C 454.3. We expect the CTA sky to be much richer of broad-line blazars than previously thought.

  10. γ-Ray Emission from the Extreme Blazar 1ES 0229+200 J. Li, T ...

    Indian Academy of Sciences (India)

    Abstract. Based on the traditional Synchrotron Self-Compton (SSC) model, we consider a secondary γ-ray emission component to an extreme blazar 1ES 0229 + 200 for the multiwavelength radiation. By assuming a suitable electron spectra and Inter-Galactic Magnetic Field (IGMF), we obtained excellent fits to observed ...

  11. Methods for the Quasi-Periodic Variability Analysis in Blazars Y. Liu ...

    Indian Academy of Sciences (India)

    the variability analysis in blazars in optical and radio bands, to search for possible quasi-periodic signals. 2. Power spectral density (PSD). In statistical signal processing and physics, the power spectral density (PSD) is a positive real function of a frequency variable associated with a stationary stochas- tic process. Intuitively ...

  12. Neutrinos and ultra-high-energy cosmic-ray nuclei from blazars

    International Nuclear Information System (INIS)

    Rodrigues, Xavier; Fedynitch, Anatoli; Gao, Shan; Boncioli, Denise; Winter, Walter

    2017-11-01

    We discuss the production of ultra-high-energy cosmic ray (UHECR) nuclei and neutrinos from blazars. We compute the nuclear cascade in the jet for both BL Lac objects and flat-spectrum radio quasars (FSRQs), and in the ambient radiation zones for FSRQs as well. By modeling representative spectral energy distributions along the blazar sequence, two distinct regimes are identified, which we call ''nuclear survival'' - typically found in low-luminosity BL Lacs, and ''nuclear cascade'' - typically found in high-luminosity FSRQs. We quantify how the neutrino and cosmic-ray (CR) emission efficiencies evolve over the blazar sequence, and demonstrate that neutrinos and CRs come from very different object classes. For example, high-frequency peaked BL Lacs (HBLs) tend to produce CRs, and HL-FSRQs are the more efficient neutrino emitters. This conclusion does not depend on the CR escape mechanism, for which we discuss two alternatives (diffusive and advective escape). Finally, the neutrino spectrum from blazars is shown to significantly depend on the injection composition into the jet, especially in the nuclear cascade case: Injection compositions heavier than protons lead to reduced neutrino production at the peak, which moves at the same time to lower energies. Thus, these sources will exhibit better compatibility with the observed IceCube and UHECR data.

  13. Observations Of Gamma-ray Loud Blazars With The VLBA At 5 GHz

    Science.gov (United States)

    Linford, Justin; Taylor, G. B.; Romani, R.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.; Helmboldt, J. F.

    2011-01-01

    The Fermi Gamma-ray Space Telescope has been scanning the sky for more than a year. About half of the sources detected by Fermi's Large Area Telesope (LAT) are active galactic nuclei (AGN). Nearly all of these gamma-ray loud AGN are blazars; strong, compact radio emitters that exhibit variability in their flux and apparent superluminal motion in their jets. Several groups are currently monitoring the radio properties of these gamma-ray loud blazars. We present results from both archival and contemporaneous observations of 200 LAT-detected blazars using the Very Long Baseline Array (VLBA) at a frequency of 5 GHz (wavelength of 6 cm). Our large, flux-limited sample provides unique insights into the mechanism that produces strong gamma-ray emissions. We explore the parsec-scale properties of the cores and jets of these highly energetic objects, including core polarization. We compare the gamma-ray loud blazars to their gamma-ray quiet counterparts in the VLBA Imaging and Polarimetry Survey (VIPS). We also investigate the differences between the BL Lacertae objects (BL Lacs) and flat-spectrum radio quasars (FSRQs).

  14. Yet another NIR flare of the Blazar BZBJ1454+5124

    Science.gov (United States)

    Carrasco, L.; Porras, A.; Recillas, E.; Escobedo, G.; Chavushyan, V.

    2018-05-01

    We call attention on our recent observation of the Gamma Ray source 3FGLJ1454.5+5124 related with the quasar SBS1452+516 (z=1.0831) On March 28th,2018,(JD24582015.0015), we found this blazar to be in a new outburst.

  15. UPPER LIMITS FROM FIVE YEARS OF BLAZAR OBSERVATIONS WITH THE VERITAS CHERENKOV TELESCOPES

    International Nuclear Information System (INIS)

    Archambault, S.; Archer, A.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Bird, R.; Biteau, J.; Buchovecky, M.; Byrum, K.; Chen, X.; Ciupik, L.; Connolly, M. P.; Cui, W.; Feng, Q.; Finley, J. P.; Eisch, J. D.; Errando, M.; Falcone, A.; Fleischhack, H.

    2016-01-01

    Between the beginning of its full-scale scientific operations in 2007 and 2012, the VERITAS Cherenkov telescope array observed more than 130 blazars; of these, 26 were detected as very-high-energy (VHE; E > 100 GeV) γ -ray sources. In this work, we present the analysis results of a sample of 114 undetected objects. The observations constitute a total live-time of ∼570 hr. The sample includes several unidentified Fermi -Large Area Telescope (LAT) sources (located at high Galactic latitude) as well as all the sources from the second Fermi -LAT catalog that are contained within the field of view of the VERITAS observations. We have also performed optical spectroscopy measurements in order to estimate the redshift of some of these blazars that do not have spectroscopic distance estimates. We present new optical spectra from the Kast instrument on the Shane telescope at the Lick observatory for 18 blazars included in this work, which allowed for the successful measurement or constraint on the redshift of four of them. For each of the blazars included in our sample, we provide the flux upper limit in the VERITAS energy band. We also study the properties of the significance distributions and we present the result of a stacked analysis of the data set, which shows a 4 σ excess.

  16. Position Angle Changes of Inner-Jets in a Sample of Blazars Ligong ...

    Indian Academy of Sciences (India)

    Position Angle Changes of Inner-Jets in a Sample of Blazars. Ligong Mi1,3,∗ & Xiang Liu1,2. 1Xinjiang Astronomical Observatory, CAS, 150 Science 1-Street, Urumqi 830011,. People's Republic of China. 2Key Laboratory of Radio Astronomy, CAS, Nanjing 210008, People's Republic of China. 3University of Chinese ...

  17. Models for High-Energy Radiation from Blazars G. E. Romero1 ...

    Indian Academy of Sciences (India)

    Abstract. We discuss on the modelling of blazar jets as emitters of multiwavelength radiation with the implementation of a lepto-hadronic treatment. Assuming that injection of non-thermal electrons and protons can take place at the base of the jet, the stationary particle distributions can be found using an inhomogeneous ...

  18. Multi-Frequency Observations of Gamma-Ray Blazar 1633+382 SG ...

    Indian Academy of Sciences (India)

    Gamma-rays—quasars: 1633+382(4C+38.41)—radio jets— polarization. 1. Introduction. Blazars are the most numerous objects in the γ-ray sky (Abdo et al. 2010). They show dramatic variability across the electromagnetic spectrum (e.g., Jorstad et al. 2010; Marscher et al. 2010). Both these properties (strong γ-ray emission.

  19. NUSTAR, SWIFT, and GROND Observations of the Flaring MEV Blazar PMN J0641-0320

    DEFF Research Database (Denmark)

    Ajello, M.; Ghisellini, G.; Paliya, V. S.

    2016-01-01

    Area Telescope and subsequent follow-up observations with NuSTAR, Swift, and GROND of a new member of the MeV blazar family: PMN J0641-0320. Our optical spectroscopy provides confirmation that this is a flat-spectrum radio quasar located at a redshift of z = 1.196. Its very hard NuSTAR spectrum (power...

  20. Spectral Index Changes with Brightness for γ-Ray Loud Blazars J. H. ...

    Indian Academy of Sciences (India)

    spectral index changes depending on γ-ray brightness is obtained. ... the γ-ray band. Key words. Active galactic nuclei (AGN): blazars: γ-ray emission: spectral index. 1. Introduction. Generally, the spectrum of one source changes with its .... Pearl River Scholar Funded Scheme (GDUPS) (2009), Yangcheng Scholar Funded.

  1. Neutrinos and ultra-high-energy cosmic-ray nuclei from blazars

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Xavier; Fedynitch, Anatoli; Gao, Shan; Boncioli, Denise; Winter, Walter

    2017-11-15

    We discuss the production of ultra-high-energy cosmic ray (UHECR) nuclei and neutrinos from blazars. We compute the nuclear cascade in the jet for both BL Lac objects and flat-spectrum radio quasars (FSRQs), and in the ambient radiation zones for FSRQs as well. By modeling representative spectral energy distributions along the blazar sequence, two distinct regimes are identified, which we call ''nuclear survival'' - typically found in low-luminosity BL Lacs, and ''nuclear cascade'' - typically found in high-luminosity FSRQs. We quantify how the neutrino and cosmic-ray (CR) emission efficiencies evolve over the blazar sequence, and demonstrate that neutrinos and CRs come from very different object classes. For example, high-frequency peaked BL Lacs (HBLs) tend to produce CRs, and HL-FSRQs are the more efficient neutrino emitters. This conclusion does not depend on the CR escape mechanism, for which we discuss two alternatives (diffusive and advective escape). Finally, the neutrino spectrum from blazars is shown to significantly depend on the injection composition into the jet, especially in the nuclear cascade case: Injection compositions heavier than protons lead to reduced neutrino production at the peak, which moves at the same time to lower energies. Thus, these sources will exhibit better compatibility with the observed IceCube and UHECR data.

  2. Simultaneous Planck, Swift, and Fermi Observations of X-ray and Gamma-ray Selected Blazars

    Science.gov (United States)

    Giommi, P.; Polenta, G.; Laehteenmaeki, A.; Thompson, D. J.; Capalbi, M.; Cutini, S.; Gasparrini, D.; Gonzalez, Nuevo, J.; Leon-Tavares, J.; Lopez-Caniego, M.; hide

    2012-01-01

    We present simultaneous Planck, Swift, Fermi, and ground-based data for 105 blazars belonging to three samples with flux limits in the soft X-ray, hard X-ray, and gamma-ray bands, with additional 5 GHz flux-density limits to ensure a good probability of a Planck detection. We compare our results to those of a companion paper presenting simultaneous Planck and multi-frequency observations of 104 radio-loud northern active galactic nuclei selected at radio frequencies. While we confirm several previous results, our unique data set allows us to demonstrate that the selection method strongly influences the results, producing biases that cannot be ignored. Almost all the BL Lac objects have been detected by the Fermi Large Area Telescope (LAT), whereas 30% to 40% of the flat-spectrum radio quasars (FSRQs) in the radio, soft X-ray, and hard X-ray selected samples are still below the gamma-ray detection limit even after integrating 27 months of Fermi-LAT data. The radio to sub-millimetre spectral slope of blazars is quite flat, with (alpha) approx 0 up to about 70GHz, above which it steepens to (alpha) approx -0.65. The BL Lacs have significantly flatter spectra than FSRQs at higher frequencies. The distribution of the rest-frame synchrotron peak frequency (nu(sup s)(sub peak)) in the spectral energy distribution (SED) of FSRQs is the same in all the blazar samples with (nu(sup s)(sub peak)) = 10(exp 13.1 +/- 0.1) Hz, while the mean inverse Compton peak frequency, (nu(sup IC)(sub peak)), ranges from 10(exp 21) to 10(exp 22) Hz. The distributions of nu(sup s)(sub peak) and nu(sup IC)(sub peak) of BL Lacs are much broader and are shifted to higher energies than those of FSRQs; their shapes strongly depend on the selection method. The Compton dominance of blazars. defined as the ratio of the inverse Compton to synchrotron peak luminosities, ranges from less than 0.2 to nearly 100, with only FSRQs reaching values larger than about 3. Its distribution is broad and depends

  3. Simultaneous Planck, Swift, and Fermi observations of X-ray and γ-ray selected blazars

    International Nuclear Information System (INIS)

    Giommi, P.; Polenta, G.; Lähteenmäki, A.; Thompson, D. J.; Capalbi, M.

    2012-01-01

    We present simultaneous Planck, Swift, Fermi, and ground-based data for 105 blazars belonging to three samples with flux limits in the soft X-ray, hard X-ray, and γ-ray bands, with additional 5GHz flux-density limits to ensure a good probability of a Planck detection. We compare our results to those of a companion paper presenting simultaneous Planck and multi-frequency observations of 104 radio-loud northern active galactic nuclei selected at radio frequencies. While we confirm several previous results, our unique data set allows us to demonstrate that the selection method strongly influences the results, producing biases that cannot be ignored. Almost all the BL Lac objects have been detected by the Fermi Large AreaTelescope (LAT), whereas 30% to 40% of the flat-spectrum radio quasars (FSRQs) in the radio, soft X-ray, and hard X-ray selected samples are still below the γ-ray detection limit even after integrating 27 months of Fermi-LAT data. The radio to sub-millimetre spectral slope of blazars is quite flat, with >α> ~ 0 up to about 70GHz, above which it steepens to ~ -0.65. The BL Lacs have significantly flatter spectra than FSRQs at higher frequencies. The distribution of the rest-frame synchrotron peak frequency (ν_p_e_a_k"S) in the spectral energy distribution (SED) of FSRQs is the same in all the blazar samples with ν_p_e_a_k"I"C>, ranges from 1021 to 1022 Hz. The distributions of ν_p_e_a_k"S and ν_p_e_a_k"I"C of BL Lacs are much broader and are shifted to higher energies than those of FSRQs; their shapes strongly depend on the selection method. The Compton dominance of blazars, defined as the ratio of the inverse Compton to synchrotron peak luminosities, ranges from less than 0.2 to nearly 100, with only FSRQs reaching values larger than about 3. Its distribution is broad and depends strongly on the selection method, with γ-ray selected blazars peaking at ~7 or more, and radio-selected blazars at values close to 1, thus implying that the common

  4. Identification of PaPKS1, a polyketide synthase involved in melanin formation and its use as a genetic tool in Podospora anserina.

    Science.gov (United States)

    Coppin, Evelyne; Silar, Philippe

    2007-08-01

    In the filamentous fungus Podospora anserina, many pigmentation mutations map to the median region of the complex locus '14', called segment '29'. The data presented in this paper show that segment 29 corresponds to a gene encoding a polyketide synthase, designated PaPKS1, and identifies two mutations that completely or partially abolish the activity of the PaPKS1 polypeptide. We present evidence that the P. anserina green pigment is a (DHN)-melanin. Using the powerful genetic system of PaPKS1 cloning, we demonstrate that in P. anserina trans-duplicated sequences are subject to the RIP process as previously demonstrated for the cis-duplicated regions.

  5. PATCHY BLAZAR HEATING: DIVERSIFYING THE THERMAL HISTORY OF THE INTERGALACTIC MEDIUM

    International Nuclear Information System (INIS)

    Lamberts, Astrid; Chang, Philip; Pfrommer, Christoph; Puchwein, Ewald; Broderick, Avery E.; Shalaby, Mohamad

    2015-01-01

    TeV-blazars potentially heat the intergalactic medium (IGM) as their gamma rays interact with photons of the extragalactic background light to produce electron–positron pairs, which lose their kinetic energy to the surrounding medium through plasma instabilities. This results in a heating mechanism that is only weakly sensitive to the local density, and therefore approximately spatially uniform, naturally producing an inverted temperature–density relation in underdense regions. In this paper we go beyond the approximation of uniform heating and quantify the heating rate fluctuations due to the clustered distribution of blazars and how this impacts the thermal history of the IGM. We analytically compute a filtering function that relates the heating rate fluctuations to the underlying dark matter density field. We implement it in the cosmological code GADGET-3 and perform large-scale simulations to determine the impact of inhomogeneous heating. We show that because of blazar clustering, blazar heating is inhomogeneous for z ≳ 2. At high redshift, the temperature–density relation shows an important scatter and presents a low temperature envelope of unheated regions, in particular at low densities and within voids. However, the median temperature of the IGM is close to that in the uniform case, albeit slightly lower at low redshift. We find that blazar heating is more complex than initially assumed and that the temperature–density relation is not unique. Our analytic model for the heating rate fluctuations couples well with large-scale simulations and provides a cost-effective alternative to subgrid models

  6. Comparisons of Jet Properties between GeV Radio Galaxies and Blazars

    Science.gov (United States)

    Xue, Zi-Wei; Zhang, Jin; Cui, Wei; Liang, En-Wei; Zhang, Shuang-Nan

    2017-09-01

    We compile a sample of spectral energy distributions (SEDs) of 12 GeV radio galaxies (RGs), including eight FR I RGs and four FR II RGs. These SEDs can be represented with the one-zone leptonic model. No significant unification, as expected in the unification model, is found for the derived jet parameters between FR I RGs and BL Lacertae objects (BL Lacs) and between FR II RGs and flat spectrum radio quasars (FSRQs). However, on average FR I RGs have a larger {γ }{{b}} (break Lorentz factor of electrons) and lower B (magnetic field strength) than FR II RGs, analogous to the differences between BL Lacs and FSRQs. The derived Doppler factors (δ) of RGs are on average smaller than those of blazars, which is consistent with the unification model such that RGs are the misaligned parent populations of blazars with smaller δ. On the basis of jet parameters from SED fits, we calculate their jet powers and the powers carried by each component, and compare their jet compositions and radiation efficiencies with blazars. Most of the RG jets may be dominated by particles, like BL Lacs, not FSRQs. However, the jets of RGs with higher radiation efficiencies tend to have higher jet magnetization. A strong anticorrelation between synchrotron peak frequency and jet power is observed for GeV RGs and blazars in both the observer and co-moving frames, indicating that the “sequence” behavior among blazars, together with the GeV RGs, may be intrinsically dominated by jet power.

  7. Biocombinatorial Engineering of Fungal PKS-NRPS Hybrids for Production of Novel Synthetic Natural Products

    DEFF Research Database (Denmark)

    Nielsen, Maria Lund

    encoding a PKS-NRPS hybrid responsible for the production of a medically relevant compound in Talaromyces atroroseus. To the best of my knowledge, this study represents the first example of reverse engineering of a Talaromyces species. In the fourth study (chapter 5), I used the CRISPR-Cas9 system...... structure optimization. Within the last decade, an alternative approach for expanding natural product chemodiversity has been applied. This strategy, known as combinatorial biosynthesis, involves the re-engineering of biosynthetic pathways and ultimately the rational engineering of new natural product...... analogs. This field, however, has proved very challenging and many engineering efforts have resulted in enzymatic loss-of-function or reduced yields. Thus, the future success in combinatorial biosynthetic studies requires a thorough understanding of the structure and function of biosynthetic enzymes...

  8. Diverse Bacterial PKS Sequences Derived From Okadaic Acid-Producing Dinoflagellates

    Directory of Open Access Journals (Sweden)

    Kathleen S. Rein

    2008-05-01

    Full Text Available Okadaic acid (OA and the related dinophysistoxins are isolated from dinoflagellates of the genus Prorocentrum and Dinophysis. Bacteria of the Roseobacter group have been associated with okadaic acid producing dinoflagellates and have been previously implicated in OA production. Analysis of 16S rRNA libraries reveals that Roseobacter are the most abundant bacteria associated with OA producing dinoflagellates of the genus Prorocentrum and are not found in association with non-toxic dinoflagellates. While some polyketide synthase (PKS genes form a highly supported Prorocentrum clade, most appear to be bacterial, but unrelated to Roseobacter or Alpha-Proteobacterial PKSs or those derived from other Alveolates Karenia brevis or Crytosporidium parvum.

  9. The UV spectrum of the BL Lac object PKS 0521-36

    International Nuclear Information System (INIS)

    Danziger, I.J.; Bergeron, J.; Maraschi, L.; Treves, A.; Milan Univ.; Tanzi, E.G.

    1983-01-01

    Ultraviolet observations (1200 to 3000 A) with the IUE satellite of the BL Lac object PKS 0521-36 are presented. The only emission line which appears clearly in the spectrum is Lyα, which is asymmetric with a component displaced approx. 3000 km s - 1 to the red. The intensity of the line and the upper limits on other lines are compared with the model calculations on QSOs and Seyfert nuclei by Kwan and Krolik. The continuous energy distribution is discussed, combining non-simultaneous observations from the ultraviolet to the infrared. The spectral range of the non-thermal source from far IR to far UV can be described by a single power law of index -1.5. (author)

  10. UV spectrum of the BL Lac object PKS 0521-36

    Energy Technology Data Exchange (ETDEWEB)

    Danziger, I.J. (European Southern Observatory, Garching (Germany, F.R.)); Bergeron, J. (Centre National de la Recherche Scientifique, 75 - Paris (France). Inst. d' Astrophysique); Fosbury, R.A.E. (Royal Greenwich Observatory, Hailsham (UK)); Maraschi, L.; Treves, A. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica; Milan Univ. (Italy). Ist. di Fisica); Tanzi, E.G. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica)

    1983-05-01

    Ultraviolet observations (1200 to 3000 A) with the IUE satellite of the BL Lac object PKS 0521-36 are presented. The only emission line which appears clearly in the spectrum is Ly..cap alpha.., which is asymmetric with a component displaced approx. 3000 km s/sup -1/ to the red. The intensity of the line and the upper limits on other lines are compared with the model calculations on QSOs and Seyfert nuclei by Kwan and Krolik. The continuous energy distribution is discussed, combining non-simultaneous observations from the ultraviolet to the infrared. The spectral range of the non-thermal source from far IR to far UV can be described by a single power law of index -1.5.

  11. A MULTIWAVELENGTH STUDY OF THE HIGH SURFACE BRIGHTNESS HOT SPOT IN PKS 1421-490

    International Nuclear Information System (INIS)

    Godfrey, L. E. H.; Bicknell, G. V.; Lovell, J. E. J.; Jauncey, D. L.; Gelbord, J.; Schwartz, D. A.; Birkinshaw, M.; Worrall, D. M.; Marshall, H. L.; Georganopoulos, M.; Perlman, E. S.; Murphy, D. W.

    2009-01-01

    Long Baseline Array imaging of the z = 0.663 broadline radio galaxy PKS 1421-490 reveals a 400 pc diameter high surface brightness hot spot at a projected distance of ∼40 kpc from the active galactic nucleus. The isotropic X-ray luminosity of the hot spot, L 2-10keV = 3 x 10 44 ergs s -1 , is comparable to the isotropic X-ray luminosity of the entire X-ray jet of PKS 0637-752, and the peak radio surface brightness is hundreds of times greater than that of the brightest hot spot in Cygnus A. We model the radio to X-ray spectral energy distribution using a one-zone synchrotron self-Compton model with a near equipartition magnetic field strength of 3 mG. There is a strong brightness asymmetry between the approaching and receding hotspots and the hot spot spectrum remains flat (α ∼ 0.5) well beyond the predicted cooling break for a 3 mG magnetic field, indicating that the hotspot emission may be Doppler beamed. A high plasma velocity beyond the terminal jet shock could be the result of a dynamically important magnetic field in the jet. There is a change in the slope of the hotspot radio spectrum at GHz frequencies, which we model by incorporating a cutoff in the electron energy distribution at γ min ∼ 650, with higher values implied if the hotspot emission is Doppler beamed. We show that a sharp decrease in the electron number density below a Lorentz factor of 650 would arise from the dissipation of bulk kinetic energy in an electron/proton jet with a Lorentz factor Γ jet ∼> 5.

  12. Investigating the emission mechanisms of the jet in the quasar PKS 1127-145

    Science.gov (United States)

    Duffy, Ryan T.; Siemiginowska, A.; Kashyap, V.; Stein, N.; Migliori, G.

    2014-01-01

    There is currently uncertainty surrounding the emission mechanism for X-ray photons in quasar jets, with both Inverse Compton Scattering from the Cosmic Microwave Background (IC/CMB) and synchrotron models considered possibilities. We use a 100 ks observation (Siemiginowska et al 2007) of the redshift z=1.18, radio-loud quasar PKS 1127-145 taken by the Chandra X-ray Observatory, with the hope of accurately measuring the offsets between radio and X-ray radiation peaks in order to establish the emission process for this jet. PKS 1127-145 is a bright quasar with a long jet which has several bright knots and complex morphology, making it a perfect source for this investigation. We use a Bayesian statistical method called Low-Count Image Restoration and Analysis (LIRA, Connors & van Dyk 2007, Esch et al 2004) to investigate the quasar jet. This fits the parameters of a multiscale model to the data by employing a Markov Chain Monte Carlo process. LIRA has shown the location of some jet X-ray components, although further simulations must be undertaken to determine whether these are statistically significant. We also study these jet X-ray components in both hard and soft X-ray bands in order to gain more information on the energy of the emitted photons. References: Connors, A., & van Dyk, D. A. 2007, Statistical Challenges in Modern Astronomy IV, 371, 101 Esch, D.N., Connors, A., Karovska, M., & van Dyk, D.A. 2004, ApJ, 610, 1213 Siemiginowska, A., Stawarz, L., Cheung, C.C., et al. 2007, ApJ, 657, 145

  13. Designing and Implementing an Assay for the Detection of Rare and Divergent NRPS and PKS Clones in European, Antarctic and Cuban Soils.

    Directory of Open Access Journals (Sweden)

    Gregory C A Amos

    Full Text Available The ever increasing microbial resistome means there is an urgent need for new antibiotics. Metagenomics is an underexploited tool in the field of drug discovery. In this study we aimed to produce a new updated assay for the discovery of biosynthetic gene clusters encoding bioactive secondary metabolites. PCR assays targeting the polyketide synthases (PKS and non-ribosomal peptide synthetases (NRPS were developed. A range of European soils were tested for their biosynthetic potential using clone libraries developed from metagenomic DNA. Results revealed a surprising number of NRPS and PKS clones with similarity to rare Actinomycetes. Many of the clones tested were phylogenetically divergent suggesting they were fragments from novel NRPS and PKS gene clusters. Soils did not appear to cluster by location but did represent NRPS and PKS clones of diverse taxonomic origin. Fosmid libraries were constructed from Cuban and Antarctic soil samples; 17 fosmids were positive for NRPS domains suggesting a hit rate of less than 1 in 10 genomes. NRPS hits had low similarities to both rare Actinobacteria and Proteobacteria; they also clustered with known antibiotic producers suggesting they may encode for pathways producing novel bioactive compounds. In conclusion we designed an assay capable of detecting divergent NRPS and PKS gene clusters from the rare biosphere; when tested on soil samples results suggest the majority of NRPS and PKS pathways and hence bioactive metabolites are yet to be discovered.

  14. Identification of the OGLE Blazars behind the Large and Small Magellanic Clouds

    Directory of Open Access Journals (Sweden)

    Natalia Żywucka

    2017-11-01

    Full Text Available We report the selection of blazar candidates behind the Large and Small Magellanic Clouds. Both flat spectrum radio quasar and BL Lacreate objects were selected based on the long-term, multi-colour Optical Gravitational Lensing Experiment photometric data. We cross-correlated the Magellanic Quasar Survey catalogue of spectroscopically confirmed quasars and quasar candidates located behind the Magellanic Clouds with the radio data at six frequencies from 0.8 to 20 GHz. Among the 1654 objects visible in optical range, we identified a sample of 44 newly selected blazar candidates, including 27 flat spectrum radio quasars and 17 BL Lacs. We examined selected objects with respect to their radio, optical, and mid-infrared properties.

  15. A Diagnostic Test for Determining the Location of the GeV Emission in Powerful Blazars

    Science.gov (United States)

    Dotson, Amanda; Georganopoulos, Markos; Kazanas, Demosthenes; Perlman, Eric

    2011-01-01

    An issue currently under debate in the literature is how far from the black hole is the Fermi-observed GeV emission of powerful blazars emitted. Here we present a clear diagnostic tool for testing whether the Ge V emission site is located within the sub-pc broad emission line (BLR) region or further out in the few pc scale molecular torus (MT) environment. Within the BLR the scatteri takes place at the onset of the Klein-Nishina regime, causing the electron cooling time to become almost energy independent and as a result, the variation of high-energy emission is expected to be achromatic. Contrarily, if the emission site is located outside the BLR, the expected GeY variability is energy-dependent and with amplitude increasing with energy. We demonstrate this using time-dependent numerical simulations of blazar variability.

  16. 3 mm GMVA Observations of Total and Polarized Emission from Blazar and Radio Galaxy Core Regions

    Directory of Open Access Journals (Sweden)

    Carolina Casadio

    2017-10-01

    Full Text Available We present total and linearly polarized 3 mm Global mm-VLBI Array (GMVA; mm-VLBI: Very Long Baseline Interferometry observations at millimetre wavelengths images of a sample of blazars and radio galaxies from the VLBA-BU-BLAZAR 7 mm monitoring program designed to probe the innermost regions of active galactic nuclei (AGN jets and locate the sites of gamma-ray emission observed by the Fermi-LAT. The lower opacity at 3 mm and improved angular resolution—on the order of 50 microarcseconds—allow us to distinguish features in the jet not visible in the 7 mm VLBA data. We also compare two different methods used for the calibration of instrumental polarisation and we analyze the resulting images for some of the sources in the sample.

  17. Power-law to Power-law Mapping of Blazar Spectra from Intergalactic Absorption

    International Nuclear Information System (INIS)

    Stecker, F W; Scully, S T

    2007-01-01

    We have derived a useful analytic approximation for determining the effect of intergalactic absorption on the γ-ray spectra of TeV blazars the energy range 0.2 TeV γ γ ) is approximately logarithmic. The effect of this energy dependence is to steepen intrinsic source spectra such that a source with an approximate power-law spectral index Γ s is converted to one with an observed spectral index Γ o ≅ Γ s + ΔΓ(z) where ΔΓ(z) is a linear function of z in the redshift range 0.05-0.4. We apply this approximation to the spectra of 7 TeV blazars

  18. Variability of the BL Lacertae objects PKS 2155 - 304 and OJ 287 in the far-ultraviolet

    International Nuclear Information System (INIS)

    Maraschi, L.; Treves, A.; Tagliaferri, G.; Tanzi, E.G.; CNR, Istituto di Fisica Cosmica, Milan, Italy)

    1986-01-01

    All the ultraviolet spectra of the two bright BL Lacertae objects PKS 2155 - 304 and OJ 287 taken with the International Ultraviolet Explorer in the period 1978-1984 are examined. For each spectrum the best-fitting power law is determined and a correlation between spectral slope and intensity is searched for. The correlation, if present, is weak. This is discussed in terms of models of the continuum emission of active galactic nuclei. 31 references

  19. Variability of the BL Lacertae objects PKS 2155 - 304 and OJ 287 in the far-ultraviolet

    Energy Technology Data Exchange (ETDEWEB)

    Maraschi, L.; Treves, A.; Tagliaferri, G.; Tanzi, E.G.

    1986-05-01

    All the ultraviolet spectra of the two bright BL Lacertae objects PKS 2155 - 304 and OJ 287 taken with the International Ultraviolet Explorer in the period 1978-1984 are examined. For each spectrum the best-fitting power law is determined and a correlation between spectral slope and intensity is searched for. The correlation, if present, is weak. This is discussed in terms of models of the continuum emission of active galactic nuclei. 31 references.

  20. The Evolution of Swift/BAT blazars and the origin of the MeV background

    Energy Technology Data Exchange (ETDEWEB)

    Ajello, M.; /SLAC /KIPAC, Menlo Park; Costamante, L.; /Stanford U., HEPL /KIPAC, Menlo Park; Sambruna, R.M.; Gehrels, N.; /NASA, Goddard; Chiang, J.; /SLAC /KIPAC, Menlo Park; Rau, A.; /Caltech; Escala, A.; /SLAC /KIPAC, Menlo Park /Cerro Calan Observ.; Greiner, J.; /Garching, Max Planck Inst., MPE; Tueller, J.; /NASA, Goddard; Wall, J.V.; /British Columbia U.; Mushotzky, R.F.; /NASA, Goddard

    2009-10-17

    We use 3 years of data from the Swift/BAT survey to select a complete sample of X-ray blazars above 15 keV. This sample comprises 26 Flat-Spectrum Radio Quasars (FSRQs) and 12 BL Lac objects detected over a redshift range of 0.03 < z < 4.0. We use this sample to determine, for the first time in the 15-55 keV band, the evolution of blazars. We find that, contrary to the Seyfert-like AGNs detected by BAT, the population of blazars shows strong positive evolution. This evolution is comparable to the evolution of luminous optical QSOs and luminous X-ray selected AGNs. We also find evidence for an epoch-dependence of the evolution as determined previously for radio-quiet AGNs. We interpret both these findings as a strong link between accretion and jet activity. In our sample, the FSRQs evolve strongly, while our best-fit shows that BL Lacs might not evolve at all. The blazar population accounts for 10-20% (depending on the evolution of the BL Lacs) of the Cosmic X-ray background (CXB) in the 15-55 keV band. We find that FSRQs can explain the entire CXB emission for energies above 500 keV solving the mystery of the generation of the MeV background. The evolution of luminous FSRQs shows a peak in redshift (z{sub c} = 4.3 {+-} 0.5) which is larger than the one observed in QSOs and X-ray selected AGNs. We argue that FSRQs can be used as tracers of massive elliptical galaxies in the early Universe.

  1. The Electrostatic Instability for Realistic Pair Distributions in Blazar/EBL Cascades

    Science.gov (United States)

    Vafin, S.; Rafighi, I.; Pohl, M.; Niemiec, J.

    2018-04-01

    This work revisits the electrostatic instability for blazar-induced pair beams propagating through the intergalactic medium (IGM) using linear analysis and PIC simulations. We study the impact of the realistic distribution function of pairs resulting from the interaction of high-energy gamma-rays with the extragalactic background light. We present analytical and numerical calculations of the linear growth rate of the instability for the arbitrary orientation of wave vectors. Our results explicitly demonstrate that the finite angular spread of the beam dramatically affects the growth rate of the waves, leading to the fastest growth for wave vectors quasi-parallel to the beam direction and a growth rate at oblique directions that is only a factor of 2–4 smaller compared to the maximum. To study the nonlinear beam relaxation, we performed PIC simulations that take into account a realistic wide-energy distribution of beam particles. The parameters of the simulated beam-plasma system provide an adequate physical picture that can be extrapolated to realistic blazar-induced pairs. In our simulations, the beam looses only 1% of its energy, and we analytically estimate that the beam would lose its total energy over about 100 simulation times. An analytical scaling is then used to extrapolate the parameters of realistic blazar-induced pair beams. We find that they can dissipate their energy slightly faster by the electrostatic instability than through inverse-Compton scattering. The uncertainties arising from, e.g., details of the primary gamma-ray spectrum are too large to make firm statements for individual blazars, and an analysis based on their specific properties is required.

  2. The WEBT Campaign on the Blazar 3C 279 in 2006

    Czech Academy of Sciences Publication Activity Database

    Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berdyugin, A.; Blažek, Martin; Buemi, C.S.; Castro-Tirado, A.J.; de Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V.A.; Henson, G.; Hovatta, T.; Hudec, René; Ibrahimov, M.A.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y.Y.; Kovalev, Yu.A.; Kubánek, Petr; Kurosaki, M.; Kurtanidze, O.M.; Lähteenmäki, A.; Lanteri, L.; Larionov, V.M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H.R.; Mingaliev, M.G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.G.; Nilsson, K.; Nishiyama, S.; Ohlert, J.M.; Osterman, M.A.; Pak, S.; Pasanen, M.; Peters, C.S.; Pursimo, T.; Raiteri, C.M.; Robertson, J.; Robertson, T.; Ryle, W.T.; Sadakane, K.; Sadun, A.C.; Sigua, L.A.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L.O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J.R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vítek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, S.-H.

    2007-01-01

    Roč. 670, č. 2 (2007), s. 968-977 ISSN 0004-637X Grant - others:EU(XE) ESA-PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Source of funding: V - iné verejné zdroje Keywords : blazars * active galactic nuclei Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.405, year: 2007

  3. Relation between X-Ray and γ-Ray Emissions for Fermi Blazars ...

    Indian Academy of Sciences (India)

    Abstract. Using γ-ray band data detected by Fermi Large Area Tele- scope (LAT) and X-ray band data for 78 blazars, we find a medium cor- relation between X-ray and γ-ray fluxes in the average state. A medium anticorrelation is also found between X-ray (1 KeV) mean spectral index αx and γ-ray mean spectral index αγ for ...

  4. Crystallization and preliminary X-ray diffraction studies of polyketide synthase-1 (PKS-1) from Cannabis sativa

    Energy Technology Data Exchange (ETDEWEB)

    Taguchi, Chiho [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Taura, Futoshi [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Tamada, Taro; Shoyama, Yoshinari [Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Shoyama, Yukihiro; Tanaka, Hiroyuki [Faculty of Pharmaceutical Sciences, Kyushu University (Japan); Kuroki, Ryota [Quantum Beam Science Directorate, Japan Atomic Energy Agency (Japan); Morimoto, Satoshi [Faculty of Pharmaceutical Sciences, Kyushu University (Japan)

    2008-03-01

    Polyketide synthase-1 from C. sativa has been crystallized. The crystal diffracted to 1.55 Å resolution with sufficient quality for further structure determination. Polyketide synthase-1 (PKS-1) is a novel type III polyketide synthase that catalyzes the biosynthesis of hexanoyl triacetic acid lactone in Cannabis sativa (Mexican strain). PKS-1 was overproduced in Escherichia coli, purified and finally crystallized in two different space groups. The crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M calcium acetate and 20%(w/v) polyethylene glycol 3350 diffracted to 1.65 Å resolution and belonged to space group P1, with unit-cell parameters a = 54.3, b = 59.3, c = 62.6 Å, α = 69, β = 81, γ = 80°. Another crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M sodium chloride and 20%(w/v) polyethylene glycol 3350 diffracted to 1.55 Å resolution and belonged to space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 54.3, b = 110, c = 130 Å. These data will enable us to determine the crystal structure of PKS-1.

  5. Crystallization and preliminary X-ray diffraction studies of polyketide synthase-1 (PKS-1) from Cannabis sativa

    International Nuclear Information System (INIS)

    Taguchi, Chiho; Taura, Futoshi; Tamada, Taro; Shoyama, Yoshinari; Shoyama, Yukihiro; Tanaka, Hiroyuki; Kuroki, Ryota; Morimoto, Satoshi

    2008-01-01

    Polyketide synthase-1 from C. sativa has been crystallized. The crystal diffracted to 1.55 Å resolution with sufficient quality for further structure determination. Polyketide synthase-1 (PKS-1) is a novel type III polyketide synthase that catalyzes the biosynthesis of hexanoyl triacetic acid lactone in Cannabis sativa (Mexican strain). PKS-1 was overproduced in Escherichia coli, purified and finally crystallized in two different space groups. The crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M calcium acetate and 20%(w/v) polyethylene glycol 3350 diffracted to 1.65 Å resolution and belonged to space group P1, with unit-cell parameters a = 54.3, b = 59.3, c = 62.6 Å, α = 69, β = 81, γ = 80°. Another crystal obtained in 0.1 M HEPES buffer pH 7.5 containing 0.2 M sodium chloride and 20%(w/v) polyethylene glycol 3350 diffracted to 1.55 Å resolution and belonged to space group P2 1 2 1 2 1 , with unit-cell parameters a = 54.3, b = 110, c = 130 Å. These data will enable us to determine the crystal structure of PKS-1

  6. EVIDENCE FOR SECONDARY EMISSION AS THE ORIGIN OF HARD SPECTRA IN TeV BLAZARS

    International Nuclear Information System (INIS)

    Zheng, Y. G.; Kang, T.

    2013-01-01

    We develop a model for the possible origin of hard, very high energy (VHE) spectra from a distant blazar. In the model, both the primary photons produced in the source and secondary photons produced outside it contribute to the observed high-energy γ-ray emission. That is, the primary photons are produced through the synchrotron self-Compton process, and the secondary photons are produced through high-energy proton interactions with background photons along the line of sight. We apply the model to a characteristic case of VHE γ-ray emission in the distant blazar 1ES 1101-232. Assuming suitable electron and proton spectra, we obtain excellent fits to the observed spectra of this blazar. This indicated that the surprisingly low attenuation of the high-energy γ-rays, especially the shape of the VHE γ-ray tail of the observed spectra, can be explained by secondary γ-rays produced in interactions of cosmic-ray protons with background photons in intergalactic space.

  7. CONTEMPORANEOUS VLBA 5 GHz OBSERVATIONS OF LARGE AREA TELESCOPE DETECTED BLAZARS

    Energy Technology Data Exchange (ETDEWEB)

    Linford, J. D.; Taylor, G. B. [Department of Physics and Astronomy, University of New Mexico, MSC07 4220, Albuquerque, NM 87131-0001 (United States); Romani, R. W. [Department of Physics, Stanford University, Stanford, CA 94305 (United States); Helmboldt, J. F. [Naval Research Laboratory, Code 7213, 4555 Overlook Avenue SW, Washington, DC 20375 (United States); Readhead, A. C. S.; Reeves, R.; Richards, J. L. [Astronomy Department, California Institute of Technology, Mail Code 247-17, 1200 East California Boulevard, Pasadena, CA 91125 (United States)

    2012-01-10

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong {gamma}-ray emission. In particular, we see that {gamma}-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with {gamma}-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.

  8. CONTEMPORANEOUS VLBA 5 GHz OBSERVATIONS OF LARGE AREA TELESCOPE DETECTED BLAZARS

    International Nuclear Information System (INIS)

    Linford, J. D.; Taylor, G. B.; Romani, R. W.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.

    2012-01-01

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. In particular, we see that γ-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with γ-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.

  9. Contemporaneous VLBA 5 GHz Observations of Large Area Telescope Detected Blazars

    Science.gov (United States)

    Linford, J. D.; Taylor, G. B.; Romani, R. W.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.

    2012-01-01

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. In particular, we see that γ-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with γ-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.

  10. Polarization Signatures of Kink Instabilities in the Blazar Emission Region from Relativistic Magnetohydrodynamic Simulations

    International Nuclear Information System (INIS)

    Zhang, Haocheng; Taylor, Greg; Li, Hui; Guo, Fan

    2017-01-01

    Kink instabilities are likely to occur in the current-carrying magnetized plasma jets. Recent observations of the blazar radiation and polarization signatures suggest that the blazar emission region may be considerably magnetized. While the kink instability has been studied with first-principle magnetohydrodynamic (MHD) simulations, the corresponding time-dependent radiation and polarization signatures have not been investigated. In this paper, we perform comprehensive polarization-dependent radiation modeling of the kink instability in the blazar emission region based on relativistic MHD (RMHD) simulations. We find that the kink instability may give rise to strong flares with polarization angle (PA) swings or weak flares with polarization fluctuations, depending on the initial magnetic topology and magnetization. These findings are consistent with observations. Compared with the shock model, the kink model generates polarization signatures that are in better agreement with the general polarization observations. Therefore, we suggest that kink instabilities may widely exist in the jet environment and provide an efficient way to convert the magnetic energy and produce multiwavelength flares and polarization variations.

  11. Polarization Signatures of Kink Instabilities in the Blazar Emission Region from Relativistic Magnetohydrodynamic Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Haocheng; Taylor, Greg [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Li, Hui; Guo, Fan [Theoretical Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2017-02-01

    Kink instabilities are likely to occur in the current-carrying magnetized plasma jets. Recent observations of the blazar radiation and polarization signatures suggest that the blazar emission region may be considerably magnetized. While the kink instability has been studied with first-principle magnetohydrodynamic (MHD) simulations, the corresponding time-dependent radiation and polarization signatures have not been investigated. In this paper, we perform comprehensive polarization-dependent radiation modeling of the kink instability in the blazar emission region based on relativistic MHD (RMHD) simulations. We find that the kink instability may give rise to strong flares with polarization angle (PA) swings or weak flares with polarization fluctuations, depending on the initial magnetic topology and magnetization. These findings are consistent with observations. Compared with the shock model, the kink model generates polarization signatures that are in better agreement with the general polarization observations. Therefore, we suggest that kink instabilities may widely exist in the jet environment and provide an efficient way to convert the magnetic energy and produce multiwavelength flares and polarization variations.

  12. Revisiting the incidence of Mg II absorbers along the blazar sightlines

    Science.gov (United States)

    Mishra, Sapna; Chand, Hum; Gopal-Krishna; Joshi, Ravi

    2018-04-01

    It is believed that the cool gas clouds traced by Mg II absorption, within a velocity offset of 5000 km/s from the background quasar, are associated with the quasar itself, whereas the absorbers seen at larger velocity offsets towards us are intervening systems and hence their existence is completely independent of the background quasar. Recent evidence by Bergeron et al. 2011 (hereafter BBM), however, seriously questions this canonical view, by showing that the number density of intervening Mg II absorbers along the sightlines towards 45 blazars is, on average, 2 times the expectation based on the Mg II absorption systems seen on the sightlines to normal QSOs. Given the serious implications of this finding, it becomes important to revisit this issue by enlarging the source sample and subjecting it to an independent analysis. Here, we first report our results based on a re-analysis of the spectroscopic data for the BBM sample; this has reproduced their factor 2 excess in dN/dz along blazar sightlines, vis-a-vis the normal QSOs. Next, we assemble a 6 times larger sample of blazar sightlines, albeit with lower SNR. Using this enlarged sample together with the BBM sample, our analysis shows that the dN/dz of Mg II absorbers statistically matches that known for normal QSO sightlines.

  13. Multi-TeV flaring from blazars: Markarian 421 as a case study

    Energy Technology Data Exchange (ETDEWEB)

    Sahu, Sarira; Miranda, Luis Salvador [Universidad Nacional Autonoma de Mexico, Instituto de Ciencias Nucleares, Mexico, DF (Mexico); Rajpoot, Subhash [California State University, Department of Physics and Astronomy, Long Beach, CA (United States)

    2016-03-15

    The TeV blazar Markarian 421 underwent multi-TeV flaring during April 2004 and simultaneously observations in the X-ray and TeV energies were made. It was observed that the TeV outbursts had no counterparts in the lower energy range. One implication of this is that it might be an orphan flare. We show that Fermi-accelerated protons of energy ≤ 168 TeV can interact with the low energy tail of the background synchrotron self-Compton photons in the inner region of the blazar to produce the multi-TeV flare and our results fit very well with the observed spectrum. Based on our study, we predict that the blazars with a deep valley in between the end of the synchrotron spectrum and the beginning of the SSC spectrum are possible candidates for orphan flaring. Future possible candidates for this scenario are the HBLs Mrk 501 and PG 1553 + 113 objects. (orig.)

  14. SPECTRAL PROPERTIES OF BRIGHT FERMI-DETECTED BLAZARS IN THE GAMMA-RAY BAND

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.

    2010-01-01

    The gamma-ray energy spectra of bright blazars of the LAT Bright AGN Sample (LBAS) are investigated using Fermi-LAT data. Spectral properties (hardness, curvature, and variability) established using a data set accumulated over 6 months of operation are presented and discussed for different blazar classes and subclasses: flat spectrum radio quasars (FSRQs), low-synchrotron peaked BLLacs (LSP-BLLacs), intermediate-synchrotron peaked BLLacs (ISP-BLLacs), and high-synchrotron peaked BLLacs (HSP-BLLacs). The distribution of photon index (Γ, obtained from a power-law fit above 100 MeV) is found to correlate strongly with blazar subclass. The change in spectral index from that averaged over the 6 months observing period is < 0.2-0.3 when the flux varies by about an order of magnitude, with a tendency toward harder spectra when the flux is brighter for FSRQs and LSP-BLLacs. A strong departure from a single power-law spectrum appears to be a common feature for FSRQs. This feature is also present for some high-luminosity LSP-BLLacs, and a small number of ISP-BLLacs. It is absent in all LBAS HSP-BLLacs. For 3C 454.3 and AO 0235+164, the two brightest FSRQ source and LSP-BLLac source, respectively, a broken power law (BPL) gives the most acceptable of power law, BPL, and curved forms. The consequences of these findings are discussed.

  15. VizieR Online Data Catalog: Sample of Fermi Blazars (Chen+, 2016)

    Science.gov (United States)

    Chen, Y.-Y.; Zhang, X.; Xiong, D.-R.; Wang, S.-J.; Yu, X.-L.

    2016-04-01

    We tried to select a large number of blazars with reliable redshift, radio core and extended radio luminosity at 1.4GHz. Firstly, we considered the following samples of blazars to get the radio core luminosity and extended luminosity at 1.4GHz: Kharb et al. (2010, J/ApJ/710/764), Antonucci & Ulvestad (1985ApJ...294..158A), Cassaro et al. (1999A&AS..139..601C), Murphy et al. (1993MNRAS.264..298M), Landt & Bignall (2008MNRAS.391..967L), Caccianiga & Marcha (2004, Cat. J/MNRAS/348/973), Giroletti et al. (2004). We cross-correlated these samples with the Fermi LAT Third Source Catalog (3FGL), and we acquired the 3FGL spectral index and energy flux at 0.1-100GeV from clean sources in 3FGL (Fermi-LAT Collaboration 2015, J/ApJS/218/23) Using these catalogs, we compiled 201 Fermi blazars. (1 data file).

  16. OPTICAL SPECTROSCOPIC OBSERVATIONS OF GAMMA-RAY BLAZAR CANDIDATES. IV. RESULTS OF THE 2014 FOLLOW-UP CAMPAIGN

    International Nuclear Information System (INIS)

    Ricci, F.; Massaro, F.; Landoni, M.; D’Abrusco, R.; Milisavljevic, D.; Paggi, A.; Smith, Howard A.; Stern, D.; Masetti, N.; Tosti, G.

    2015-01-01

    The extragalactic γ-ray sky is dominated by the emission arising from blazars, one of the most peculiar classes of radio-loud active galaxies. Since the launch of Fermi several methods were developed to search for blazars as potential counterparts of unidentified γ-ray sources (UGSs). To confirm the nature of the selected candidates, optical spectroscopic observations are necessary. In 2013 we started a spectroscopic campaign to investigate γ-ray blazar candidates selected according to different procedures. The main goals of our campaign are: (1) to confirm the nature of these candidates, and (2) whenever possible, determine their redshifts. Optical spectroscopic observations will also permit us to verify the robustness of the proposed associations and check for the presence of possible source class contaminants to our counterpart selection. This paper reports the results of observations carried out in 2014 in the northern hemisphere with Kitt Peak National Observatory and in the southern hemisphere with the Southern Astrophysical Research telescopes. We also report three sources observed with the Magellan and Palomar telescopes. Our selection of blazar-like sources that could be potential counterparts of UGSs is based on their peculiar infrared colors and on their combination with radio observations both at high and low frequencies (i.e., above and below ∼1 GHz) in publicly available large radio surveys. We present the optical spectra of 27 objects. We confirm the blazar-like nature of nine sources that appear to be potential low-energy counterparts of UGSs. Then we present new spectroscopic observations of 10 active galaxies of uncertain type associated with Fermi sources, classifying all of them as blazars. In addition, we present the spectra for five known γ-ray blazars with uncertain redshift estimates and three BL Lac candidates that were observed during our campaign. We also report the case for WISE J173052.85−035247.2, candidate counterpart of the

  17. OPTICAL SPECTROSCOPIC OBSERVATIONS OF GAMMA-RAY BLAZAR CANDIDATES. IV. RESULTS OF THE 2014 FOLLOW-UP CAMPAIGN

    Energy Technology Data Exchange (ETDEWEB)

    Ricci, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); D’Abrusco, R.; Milisavljevic, D.; Paggi, A.; Smith, Howard A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Mail Stop 169-221, Pasadena, CA 91109 (United States); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Tosti, G., E-mail: riccif@fis.uniroma3.it [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)

    2015-05-15

    The extragalactic γ-ray sky is dominated by the emission arising from blazars, one of the most peculiar classes of radio-loud active galaxies. Since the launch of Fermi several methods were developed to search for blazars as potential counterparts of unidentified γ-ray sources (UGSs). To confirm the nature of the selected candidates, optical spectroscopic observations are necessary. In 2013 we started a spectroscopic campaign to investigate γ-ray blazar candidates selected according to different procedures. The main goals of our campaign are: (1) to confirm the nature of these candidates, and (2) whenever possible, determine their redshifts. Optical spectroscopic observations will also permit us to verify the robustness of the proposed associations and check for the presence of possible source class contaminants to our counterpart selection. This paper reports the results of observations carried out in 2014 in the northern hemisphere with Kitt Peak National Observatory and in the southern hemisphere with the Southern Astrophysical Research telescopes. We also report three sources observed with the Magellan and Palomar telescopes. Our selection of blazar-like sources that could be potential counterparts of UGSs is based on their peculiar infrared colors and on their combination with radio observations both at high and low frequencies (i.e., above and below ∼1 GHz) in publicly available large radio surveys. We present the optical spectra of 27 objects. We confirm the blazar-like nature of nine sources that appear to be potential low-energy counterparts of UGSs. Then we present new spectroscopic observations of 10 active galaxies of uncertain type associated with Fermi sources, classifying all of them as blazars. In addition, we present the spectra for five known γ-ray blazars with uncertain redshift estimates and three BL Lac candidates that were observed during our campaign. We also report the case for WISE J173052.85−035247.2, candidate counterpart of the

  18. Probing the Diffuse Optical-IR Background with TeV Blazars Detected with the MAGIC Telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Prandini, Elisa [Dipartimento di Fisica e Astronomia “G. Galilei”, University of Padova, Padua (Italy); Domínguez, Alberto [Departamento de Física Atómica, Universidad Complutense, Madrid (Spain); Fallah Ramazani, Vandad [Tuorla observatory, University of Turku, Turku (Finland); Hassan, Tarek [IFAE, The Barcelona Institute of Science and Technology, Bellaterra (Spain); Mazin, Daniel [Max Planck Institute for Physics, Munich (Germany); Institute for Cosmic Ray Research, University of Tokyo, Tokyo (Japan); Moralejo, Abelardo [IFAE, The Barcelona Institute of Science and Technology, Bellaterra (Spain); Nievas Rosillo, Mireia [Departamento de Física Atómica, Universidad Complutense, Madrid (Spain); Vanzo, Gaia; Vazquez Acosta, Monica, E-mail: prandini@pd.infn.it [Instituto de Astrofísica de Canarias, Tenerife (Spain); Departamento de Astrofisica, Universidad de La Laguna, Tenerife (Spain)

    2017-11-22

    Blazars are radio loud quasars whose jet points toward the observer. The observed emission is mostly non-thermal, dominated by the jet emission, and in some cases extends up to the very high energy gamma rays (VHE; E > 100 GeV). To date, more than 60 blazars have been detected at VHE mainly with ground-based imaging atmospheric Cherenkov telescopes (IACTs) such as MAGIC, H.E.S.S., and VERITAS. Energetic photons from a blazar may interact with the diffuse optical and IR background (the extragalactic background light, EBL) leaving an imprint on the blazar energy spectrum. This effect can be used to constrain the EBL, with basic assumptions on the intrinsic energy spectrum. Current generation of IACTs is providing valuable measurements of the EBL density and energy spectrum from optical to infrared frequencies. In this contribution, we present the latest results obtained with the data taken with the MAGIC telescopes: using 32 spectra from 12 blazars, the scale factor of the optical density predicted by the EBL model from Domínguez et al. (2011) is constrained to be 0.95 (+0.11, −0.12){sub stat} (+0.16, −0.07){sub sys}, where a value of 1 means the perfect match with the model.

  19. Probing the Diffuse Optical-IR Background with TeV Blazars Detected with the MAGIC Telescopes

    Directory of Open Access Journals (Sweden)

    Elisa Prandini

    2017-11-01

    Full Text Available Blazars are radio loud quasars whose jet points toward the observer. The observed emission is mostly non-thermal, dominated by the jet emission, and in some cases extends up to the very high energy gamma rays (VHE; E > 100 GeV. To date, more than 60 blazars have been detected at VHE mainly with ground-based imaging atmospheric Cherenkov telescopes (IACTs such as MAGIC, H.E.S.S., and VERITAS. Energetic photons from a blazar may interact with the diffuse optical and IR background (the extragalactic background light, EBL leaving an imprint on the blazar energy spectrum. This effect can be used to constrain the EBL, with basic assumptions on the intrinsic energy spectrum. Current generation of IACTs is providing valuable measurements of the EBL density and energy spectrum from optical to infrared frequencies. In this contribution, we present the latest results obtained with the data taken with the MAGIC telescopes: using 32 spectra from 12 blazars, the scale factor of the optical density predicted by the EBL model from Domínguez et al. (2011 is constrained to be 0.95 (+0.11, −0.12stat (+0.16, −0.07sys, where a value of 1 means the perfect match with the model.

  20. The z = 1.6748 C I Absorber Toward the QSO PKS 1756+237

    Science.gov (United States)

    Roth, Katherine C.; Bauer, James M.; Jim, Kevin T. C.

    We have detected C I ground-state absorption at zabs = 1.6748 toward the QSO PKS 1756+237 (zem = 1.725), making this only the fourth known C I QSO absorber. The absence of excited-state fine-structure C I lines is compatible with the redshifted Cosmic Microwave Background Radiation at an expected temperature of TCMBR (1+z) = 7.291 K (Mather et al. 1994, ApJ, 354, L37). We find a 2 σ upper-limit on the C I excitation temperature of Tex <= 7.73(+0.53, -0.46) K (Roth & Bauer 1999, ApJ, submitted). Our Keck HIRES spectra (8.3 km s-1 FWHM) obtained in May 1997 also reveal the existence of Ni II and Fe II lines with a sub-solar Ni/Fe abundance ratio, presumably indicative of dust. We have obtained deep, high resolution (0.3'' FWHM) images in H+K' with the UH 2.2m Tip-Tilt system of the QSO field in order to identify the system responsible for the zabs = 1.6748 absorption. We detect two faint candidate systems within 1.5'' and 3'' (≅ 15 and 30 kpc, Hcirc = 65) of the QSO.

  1. VizieR Online Data Catalog: Jet kinematics of blazars at 43GHz with the VLBA (Jorstad+, 2017)

    Science.gov (United States)

    Jorstad, S. G.; Marscher, A. P.; Morozova, D. A.; Troitsky, I. S.; Agudo, I.; Casadio, C.; Foord, A.; Gomez, J. L.; MacDonald, N. R.; Molina, S. N.; Lahteenmaki, A.; Tammi, J.; Tornikoski, M.

    2018-04-01

    The VLBA-BU-BLAZAR monitoring program consists of approximately monthly observations with the VLBA at 43GHz of a sample of AGNs detected as γ-ray sources. In this paper, we present the results of observations from 2007 June to 2013 January. The sample consists of 21 FSRQs, 12 BLLacs, and 3 radio galaxies (RGs). It includes the blazars and radio galaxies detected at γ-ray energies by EGRET with average flux density at 43GHz exceeding 0.5Jy, declination north of -30°, and optical magnitude in the R band brighter than 18.5. (5 data files).

  2. Research and characterisation of blazar candidates among the Fermi/LAT 3FGL catalogue using multivariate classifications

    Science.gov (United States)

    Lefaucheur, Julien; Pita, Santiago

    2017-06-01

    Context. In the recently published 3FGL catalogue, the Fermi/LAT collaboration reports the detection of γ-ray emission from 3034 sources obtained after four years of observations. The nature of 1010 of those sources is unknown, whereas 2023 have well-identified counterparts in other wavelengths. Most of the associated sources are labelled as blazars (1717/2023), but the BL Lac or FSRQ nature of 573 of these blazars is still undetermined. Aims: The aim of this study was two-fold. First, to significantly increase the number of blazar candidates from a search among the large number of Fermi/LAT 3FGL unassociated sources (case A). Second, to determine the BL Lac or FSRQ nature of the blazar candidates, including those determined as such in this work and the blazar candidates of uncertain type (BCU) that are already present in the 3FGL catalogue (case B). Methods: For this purpose, multivariate classifiers - boosted decision trees and multilayer perceptron neural networks - were trained using samples of labelled sources with no caution flag from the 3FGL catalogue and carefully chosen discriminant parameters. The decisions of the classifiers were combined in order to obtain a high level of source identification along with well controlled numbers of expected false associations. Specifically for case A, dedicated classifications were generated for high (| b | >10◦) and low (| b | ≤10◦) galactic latitude sources; in addition, the application of classifiers to samples of sources with caution flag was considered separately, and specific performance metrics were estimated. Results: We obtained a sample of 595 blazar candidates (high and low galactic latitude) among the unassociated sources of the 3FGL catalogue. We also obtained a sample of 509 BL Lacs and 295 FSRQs from the blazar candidates cited above and the BCUs of the 3FGL catalogue. The number of expected false associations is given for different samples of candidates. It is, in particular, notably low ( 9

  3. THE NATURE OF A GALAXY ALONG THE SIGHT LINE TO PKS 0454+039

    Energy Technology Data Exchange (ETDEWEB)

    Takamiya, Marianne [Physics and Astronomy Department, University of Hawaii Hilo, Hilo, HI 96720 (United States); Chun, Mark [Institute for Astronomy, University of Hawaii Manoa, HI 96822 (United States); Kulkarni, Varsha P.; Gharanfoli, Soheila, E-mail: takamiya@hawaii.edu [Department of Physics and Astronomy, University of South Carolina, SC 29208 (United States)

    2012-10-01

    We report on the properties of a faint blue galaxy (G1) along the line of sight to the QSO PKS 0454+039 from spectroscopic and imaging data. We measured emission lines of H{alpha}, [S II] {lambda}{lambda}6716, 6732, and [N II] {lambda}6584 in the spectrum of G1 obtained with the Gemini/GMOS instrument. The spectroscopic redshift of G1 is z = 0.0715 {+-} 0.0002. From the extinction-corrected H{alpha} flux, we determine a modest star formation rate of SFR = 0.07 M{sub Sun} yr{sup -1} and a specific SFR of log (sSFR) -8.4. Using three different abundance indicators, we determine a nebular abundance 12 + log (O/H) ranging from 7.6 to 8.2. Based on the velocity dispersion inferred from the emission line widths and the observed surface brightness profile, we estimate the virial mass of G1 to be M{sub vir} {approx} 6.7 Multiplication-Sign 10{sup 9} M{sub Sun} with an effective radius of 2.0 kpc. We estimate the stellar mass of G1 using spectral energy distribution fitting to be M{sub *} Almost-Equal-To 1.2 Multiplication-Sign 10{sup 7} M{sub Sun} and an r'-luminosity of L{sub r'} = 1.5x10{sup 8} L{sub Sun }. Overall, G1 is a faint, low-mass, low-metallicity Im/H II galaxy. We also report on the line flux limits of another source (G3) which is the most likely candidate for the absorber system at z = 0.8596. From the spectrum of the QSO itself, we report a previously undetected Mg II {lambda}{lambda}2796, 2803 absorption line system at z = 1.245.

  4. THE NATURE OF A GALAXY ALONG THE SIGHT LINE TO PKS 0454+039

    International Nuclear Information System (INIS)

    Takamiya, Marianne; Chun, Mark; Kulkarni, Varsha P.; Gharanfoli, Soheila

    2012-01-01

    We report on the properties of a faint blue galaxy (G1) along the line of sight to the QSO PKS 0454+039 from spectroscopic and imaging data. We measured emission lines of Hα, [S II] λλ6716, 6732, and [N II] λ6584 in the spectrum of G1 obtained with the Gemini/GMOS instrument. The spectroscopic redshift of G1 is z = 0.0715 ± 0.0002. From the extinction-corrected Hα flux, we determine a modest star formation rate of SFR = 0.07 M ☉ yr –1 and a specific SFR of log (sSFR) –8.4. Using three different abundance indicators, we determine a nebular abundance 12 + log (O/H) ranging from 7.6 to 8.2. Based on the velocity dispersion inferred from the emission line widths and the observed surface brightness profile, we estimate the virial mass of G1 to be M vir ∼ 6.7 × 10 9 M ☉ with an effective radius of 2.0 kpc. We estimate the stellar mass of G1 using spectral energy distribution fitting to be M * ≈ 1.2 × 10 7 M ☉ and an r'-luminosity of L r' = 1.5x10 8 L ☉ . Overall, G1 is a faint, low-mass, low-metallicity Im/H II galaxy. We also report on the line flux limits of another source (G3) which is the most likely candidate for the absorber system at z = 0.8596. From the spectrum of the QSO itself, we report a previously undetected Mg II λλ2796, 2803 absorption line system at z = 1.245.

  5. Tentative detection of warm intervening gas towards PKS 0548-322 with XMM-Newton

    Energy Technology Data Exchange (ETDEWEB)

    Barcons, X.

    2005-03-17

    We present the results of a long ({approx} 93 ksec) XMM-Newton observation of the bright BL-Lac object PKS 0548-322 (z = 0.069). Our Reflection Grating Spectrometer (RGS) spectrum shows a single absorption feature at an observed wavelength {lambda} = 23.33 {+-} 0.01 {angstrom} which we interpret as OVI K{alpha} absorption at z = 0.058, i.e., {approx} 3000 km s{sup -1} from the background object. The observed equivalent width of the absorption line {approx} 30m {angstrom}, coupled with the lack of the corresponding absorption edge in the EPIC pn data, implies a column density N{sub OVI} {approx} 2 x 10{sup 16} cm{sup -2} and turbulence with a Doppler velocity parameter b > 100 km s{sup -1}. Within the limitations of our RGS spectrum, no OVII or OV K{alpha} absorption are detected. Under the assumption of ionization equilibrium by both collisions and the extragalactic background, this is only marginally consistent if the gas temperature is {approx} 2.5 x 10{sup 5} K, with significantly lower or higher values being excluded by our limits on OV or OVII. If confirmed, this would be the first X-ray detection of a large amount of intervening warm absorbing gas through OVI absorption. The existence of such a high column density absorber, much stronger than any previously detected one in OVI, would place stringent constraints on the large-scale distribution of baryonic gas in the Universe.

  6. The z = 0.8596 damped Ly-alpha absorbing galaxy toward PKS 0454+039

    Science.gov (United States)

    Steidel, Charles C.; Bowen, David V.; Blades, J. Chris; Dickenson, Mark

    1995-01-01

    We present Hubble Space Telescope (HST) and ground-based data on the Z(sub abs) = 0.8596 metal-line absorption system along the line of sight to PKS 0454+0356. The system is a moderate-redshift damped Ly-alpha system, with N(H I) = (5.7 +/- 0.3) x 10(exp 20)/sq cm as measured from the Faint Object Spectrograph (FOS) spectrum. We also present ground-based images which we use to identify the galaxy which most probably gives rise to the damped system; the most likely candidate is relatively underluminous by QSO absorber standards M(sub B) approximately -19.0 for A(sub 0) = 0.5 and H(sub 0) = 50 km/s/Mpc) and lies approximately 8.5/h kpc in projection from the QSO sight line. Ground-based measurements of Zn II, Cr II, and Fe II absorption lines from this system allow us to infer abundances of (Zn/H) = -1.1, (Cr/H) = -1.2, and (Fe/H) = -1.2 indicating overall metallicity similar to damped systems at z is greater than 2, and that the depletion of Cr and Fe onto dust grains may be even less important than in many of the high-redshift systems of comparable metallicity. Limits previously placed on the 21 cm optical depth in the z = 0.8596 system, together with our new N(H I) measurement, suggest a very high spin temperature for the H I, T(sub s) is greater than 580 K.

  7. Measurement of the blazar Mrk421 flux above 60 GeV with the CELESTE experiment

    International Nuclear Information System (INIS)

    Le Gallou, R.

    2001-11-01

    The CELESTE experiment is based on an ancient solar plant that has been turned into a detector able to detect the particle showers triggered by the interactions of high energy cosmic photons with the earth atmosphere nuclei. The purpose of the CELESTE experiment is to study the emissions of photons by cosmic objects like supernovae remnants, pulsars or active cores of galaxies such as blazars. Blazars are very interesting objects to study because they allow us to investigate matter that is in extreme conditions and to probe a very far past. The aim of this work has been to develop methods for the analysis of the data collected by CELESTE and to validate them. A specific effort has been achieved for the selection of efficient hadronic rejection criteria in order to optimize the sensitivity of the detector. The physics of the detector is detailed from the particle showers to the data analysis. The detector acceptance has been assessed through Monte-Carlo simulations that have been shown that the detection threshold is 30 GeV at the triggering point and 60 GeV after the analysis cuts. The validation tests have been performed on the Crab nebula that is a standard in gamma astronomy for its stability and intensity. CELESTE has been operating since November 1999 in a satisfactory way and has accumulated data on 4 blazars among them Mrk421. Several bursts have been detected on Mrk421 and an average photon flux has been determined. A correlation has been deduced from the activity detected by CELESTE and the activities in the TeV and X ranges which agrees with the simulations

  8. Parsec-Scale Radio Properties of Gamma-ray Bright Blazars

    Science.gov (United States)

    Linford, Justin

    2012-01-01

    The parsec-scale radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been investigated using observations with the Very Long Baseline Array (VLBA). Comparisons between LAT and non-LAT detected samples were made using both archival and contemporaneous data. In total, 244 sources were used in the LAT-detected sample. This very large, radio flux-limited sample of active galactic nuclei (AGN) provides insights into the mechanism that produces strong gamma-ray emission. It has been found that LAT-detected BL Lac objects are very similar to the non-LAT BL Lac objects in most properties, although LAT BL Lac objects may have longer jets. The LAT flat spectrum radio quasars (FSRQs) are significantly different from non-LAT FSRQs and are likely extreme members of the FSRQ population. Archival radio data indicated that there was no significant correlation between radio flux density and gamma-ray flux, especially at lower flux levels. However, contemporaneous observations showed a strong correlation. Most of the differences between the LAT and non-LAT populations are related to the cores of the sources, indicating that the gamma-ray emission may originate near the base of the jets (i.e., within a few pc of the central engine). There is some indication that LAT-detected sources may have larger jet opening angles than the non-LAT sources. Strong core polarization is significantly more common among the LAT sources, suggesting that gamma-ray emission is related to strong, uniform magnetic fields at the base of the jets of the blazars. Observations of sources in two epochs indicate that core fractional polarization was higher when the objects were detected by the LAT. Included in our sample are several non-blazar AGN such as 3C84, M82, and NGC 6251.

  9. The ultraviolet to infrared energy distribution of the BL Lacertae object PKS 0422+00 at two different brightness levels

    Energy Technology Data Exchange (ETDEWEB)

    Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G. (Padova, Osservatorio Astronomico, Padua (Italy) European Southern Observatory, La Silla (Chile) Milano Universita, Milan (Italy) CNR, Istituto di Fisica Cosmica, Milan (Italy))

    1989-10-01

    The BL Lacertae object PKS 0422+00 was observed with IUE (International Ultraviolet Explorer) on August 31-September 1, 1987, when the visual magnitude of the object was V = 16.2, and again about 4 months later (January 10, 1988) during an active state (V = 15.6). Quasi-simultaneous optical to infrared observations allow deriving a detailed spectral flux distribution from 8 x 10 to the 13th to 2.5 x 10 the 15th Hz, for each epoch. Fits in terms of broken power laws and logarithmic parabolas are discussed. 32 refs.

  10. Quasi-simultaneous ultraviolet, optical, and infrared observations of the BL Lacertae object PKS 0048-09

    International Nuclear Information System (INIS)

    Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

    1988-01-01

    This paper reports on quasi-simultaneous UV, optical, and IR observations of the BL Lac object PKS 0048-09, carried out on January 7-9, 1987, when the object was in a moderately high optical state. The data were used to derive a detailed energy distribution from about 10 to the 14th to about 2.5 x 10 to the 15th Hz. A comparison of observations obtained on January 7-9, 1987, with observations on September 12, 1986, pertaining to a lower state of the source, indicates spectral hardening with increasing intensity on time scales of months. 26 references

  11. The ultraviolet to infrared energy distribution of the BL Lacertae object PKS 0422+00 at two different brightness levels

    International Nuclear Information System (INIS)

    Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

    1989-01-01

    The BL Lacertae object PKS 0422+00 was observed with IUE (International Ultraviolet Explorer) on August 31-September 1, 1987, when the visual magnitude of the object was V = 16.2, and again about 4 months later (January 10, 1988) during an active state (V = 15.6). Quasi-simultaneous optical to infrared observations allow deriving a detailed spectral flux distribution from 8 x 10 to the 13th to 2.5 x 10 the 15th Hz, for each epoch. Fits in terms of broken power laws and logarithmic parabolas are discussed. 32 refs

  12. Quasi-simultaneous ultraviolet, optical, and infrared observations of the BL Lacertae object PKS 0048-09

    Energy Technology Data Exchange (ETDEWEB)

    Falomo, R.; Bouchet, P.; Maraschi, L.; Treves, A.; Tanzi, E.G.

    1988-12-01

    This paper reports on quasi-simultaneous UV, optical, and IR observations of the BL Lac object PKS 0048-09, carried out on January 7-9, 1987, when the object was in a moderately high optical state. The data were used to derive a detailed energy distribution from about 10 to the 14th to about 2.5 x 10 to the 15th Hz. A comparison of observations obtained on January 7-9, 1987, with observations on September 12, 1986, pertaining to a lower state of the source, indicates spectral hardening with increasing intensity on time scales of months. 26 references.

  13. Penentuan Kadar Air Dan Kadar Kotoran Minyak Inti Sawit Di PTPN III PKS Kebun Rambutan – Tebing Tinggi

    OpenAIRE

    Nadapdap, Nova Dana Isabela

    2010-01-01

    PTPN III PKS Kebun Rambutan – tebing tinggi is factory which manufactures CPO starting from fresh fruit bunch to be crude oil.And the second product produced by PTPN III is Palm kernel.The proses of palm kernel oil within several steps are separation,solution,drying and storage.In other to be distributed,palm kernel must the following the quality specification free fatty acid 0,5 %,water content 7,0 %,pollutant content 6,0 %,ang these are the standart for obtaining high quality palm kernel.An...

  14. BeppoSAX Observations of the TeV Blazar Mkn 421

    Energy Technology Data Exchange (ETDEWEB)

    Fossati, G.; Chiappetti, L.; Celotti, A.; Ghisellini, G.; Maraschi, L.; Tagliaferri, G.; Tanzi, E.G.; Treves, A.; Bassani, L.; Cappi, M.; Comastri, A.; Frontera, F.; Giarrusso, S.; Grandi, P.; Molendi, S.; Palumbo, G.; Perola, C.; Pian, E.; Salvati, M.; Raiteri, C.; Villata, M.; Urry, C.M

    1999-01-01

    The blazar Mkn 421 has been observed, as part of the AO1 Core Program, five times from 2 to 7 May 1997. In the LECS+MECS energy band the spectrum shows convex curvature, well represented by a broken power-law. Flux variability (more than a factor 2) has been detected over the entire 0.1-10 keV range, accompanying which the spectrum steepens with the decrease in intensity. Mkn 421 has been also detected with the PDS instrument. Our preliminary analysis indicates that the PDS spectrum lies significantly above the extrapolation from the MECS, suggesting a contribution from a flatter high energy component.

  15. BeppoSAX Observations of the TeV Blazar Mkn 421

    International Nuclear Information System (INIS)

    Fossati, G.; Chiappetti, L.; Celotti, A.; Ghisellini, G.; Maraschi, L.; Tagliaferri, G.; Tanzi, E.G.; Treves, A.; Bassani, L.; Cappi, M.; Comastri, A.; Frontera, F.; Giarrusso, S.; Grandi, P.; Molendi, S.; Palumbo, G.; Perola, C.; Pian, E.; Salvati, M.; Raiteri, C.; Villata, M.; Urry, C.M.

    1999-01-01

    The blazar Mkn 421 has been observed, as part of the AO1 Core Program, five times from 2 to 7 May 1997. In the LECS+MECS energy band the spectrum shows convex curvature, well represented by a broken power-law. Flux variability (more than a factor 2) has been detected over the entire 0.1-10 keV range, accompanying which the spectrum steepens with the decrease in intensity. Mkn 421 has been also detected with the PDS instrument. Our preliminary analysis indicates that the PDS spectrum lies significantly above the extrapolation from the MECS, suggesting a contribution from a flatter high energy component

  16. On the origin of X-ray spectra in luminous blazars

    International Nuclear Information System (INIS)

    Sikora, Marek; Janiak, Mateusz; Moderski, Rafał; Nalewajko, Krzysztof; Madejski, Greg M.

    2013-01-01

    Gamma-ray luminosities of some quasar-associated blazars imply jet powers reaching values comparable to the accretion power even if assuming very strong Doppler boosting and very high efficiency of gamma-ray production. With much lower radiative efficiencies of protons than of electrons, and the recent reports of very strong coupling of electrons with shock-heated protons indicated by particle-in-cell simulations, the leptonic models seem to be strongly favored over the hadronic ones. However, the electron-proton coupling combined with the external-radiation-Compton (ERC) models of gamma-ray production in leptonic models predict extremely hard X-ray spectra, with energy indices α x ∼ 0. This is inconsistent with the observed 2-10 keV slopes of blazars, which cluster around α x ∼ 0.6. This problem can be resolved by assuming that electrons can be efficiently cooled down radiatively to non-relativistic energies, or that blazar spectra are entirely dominated by the synchrotron self-Compton (SSC) component up to at least 10 keV. Here, we show that the required cooling can be sufficiently efficient only at distances r < 0.03 pc. SSC spectra, on the other hand, can be produced roughly co-spatially with the observed synchrotron and ERC components, which are most likely located roughly at a parsec scale. We show that the dominant SSC component can also be produced much further than the dominant synchrotron and ERC components, at distances of ≳ 10 pc. Hence, depending on the spatial distribution of the energy dissipation along the jet, one may expect to see γ-ray/optical events with either correlated or uncorrelated X-rays. In all cases the number of e + e – pairs per proton is predicted to be very low. The direct verification of the proposed SSC scenario, and particularly the question of the co-spatiality of the SSC component with other spectral components, requires sensitive observations in the hard X-ray band. This is now possible with the deployment of the Nu

  17. Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst

    Directory of Open Access Journals (Sweden)

    Julian Sitarek

    2016-09-01

    Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.

  18. VizieR Online Data Catalog: The CLASS blazar survey. I. (Marcha+, 2001)

    Science.gov (United States)

    Marcha, M. J.; Caccianiga, A.; Browne, I. W. A.; Jackson, N.

    2002-04-01

    This paper presents a new complete and well-defined sample of flat-spectrum radio sources (FSRS) selected from the Cosmic Lens All-Sky Survey (CLASS), with the further constraint of a bright (mag<=17.5) optical counterpart. The sample has been designed to produce a large number of low-luminosity blazars in order to test the current unifying models in the low-luminosity regime. In this first paper the new sample is presented and the radio properties of the 325 sources contained therein are discussed. (1 data file).

  19. Phylogeny and expression analyses reveal important roles for plant PKS III family during the conquest of land by plants and angiosperm diversification

    Directory of Open Access Journals (Sweden)

    Lulu Xie

    2016-08-01

    Full Text Available AbstractPolyketide synthases (PKSs utilize the products of primary metabolism to synthesize a wide array of secondary metabolites in both prokaryotic and eukaryotic organisms. PKSs can be grouped into three distinct classes, type I, II, and III, based on enzyme structure, substrate specificity, and catalytic mechanisms. The type III PKS enzymes function as homodimers, and are the only class of PKS that do not require acyl carrier protein. Plant type III PKS enzymes, also known as chalcone synthase (CHS-like enzymes, are of particular interest due to their functional diversity. In this study, we mined type III PKS gene sequences from the genomes of six aquatic algae and twenty-five land plants (one bryophyte, one lycophyte, two basal angiosperms, sixteen core eudicots, and five monocots. PKS III sequences were found relatively conserved in all embryophytes, but not exist in algae. We also examined gene expression patterns by analyzing available transcriptome data, and identified potential cis regulatory elements in upstream sequences. Phylogenetic trees of dicots angiosperms showed that plant type III PKS proteins fall into three clades. Clade A contains CHS/STS-type enzymes coding genes with diverse transcriptional expression patterns and enzymatic functions, while clade B is further divided into subclades b1 and b2, which consist of anther-specific CHS-like enzymes. Differentiation regions, such as amino acids 196-207 between clades A and B, and predicted positive selected sites within α-helixes in late appeared branches of clade A, account for the major diversification in substrate choice and catalytic reaction. The integrity and location of conserved cis-elements containing MYB and bHLH binding sites can affect transcription levels. Potential binding sites for transcription factors such as WRKY, SPL or AP2/EREBP may contribute to tissue- or taxon-specific differences in gene expression. Our data shows that gene duplications and functional

  20. Spectral properties of blazars. I. Objects observed in the far-ultraviolet. II. An X-ray observed sample

    International Nuclear Information System (INIS)

    Ghisellini, G.; Maraschi, L.; Treves, A.; Tanzi, E. G.; Milano Universita, Italy; CNR, Istituto di Fisica Cosmica, Milan, Italy)

    1986-01-01

    All blazars observed with the IUE are studied and shown to form a well-defined subgroup according to their spectral properties. These properties are discussed with respect to theoretical models and are compared with those of quasars. Radio, ultraviolet, and X-ray fluxes are used to construct composite spectral indices, and systematic differences between X-ray selected and otherwise selected objects are discussed. It is confirmed that X-ray selected objects have flatter overall spectra, and are therefore weaker radio emitters relative to their X-ray emission than objects selected otherwise. It is found that X-ray selected blazars have the same average X-ray luminosity as blazars selected otherwise and are underluminous at UV and radio frequencies. This finding is used to argue that the radio-weak, X-ray selected BL Lac objects are, in terms of space density, the dominant members of the blazar population. The results are interpreted in the framework of synchrotron emission models involving relativistic plasma jets. 134 references

  1. Spectral properties of blazars. I. Objects observed in the far-ultraviolet. II. An X-ray observed sample

    Energy Technology Data Exchange (ETDEWEB)

    Ghisellini, G.; Maraschi, L.; Treves, A.; Tanzi, E. G.

    1986-11-01

    All blazars observed with the IUE are studied and shown to form a well-defined subgroup according to their spectral properties. These properties are discussed with respect to theoretical models and are compared with those of quasars. Radio, ultraviolet, and X-ray fluxes are used to construct composite spectral indices, and systematic differences between X-ray selected and otherwise selected objects are discussed. It is confirmed that X-ray selected objects have flatter overall spectra, and are therefore weaker radio emitters relative to their X-ray emission than objects selected otherwise. It is found that X-ray selected blazars have the same average X-ray luminosity as blazars selected otherwise and are underluminous at UV and radio frequencies. This finding is used to argue that the radio-weak, X-ray selected BL Lac objects are, in terms of space density, the dominant members of the blazar population. The results are interpreted in the framework of synchrotron emission models involving relativistic plasma jets. 134 references.

  2. Extremes of the jet-accretion power relation of blazars, as explored by NuSTAR

    DEFF Research Database (Denmark)

    Sbarrato, T.; Ghisellini, G.; Tagliaferri, G.

    2016-01-01

    .366) and B0222+185 (at z = 2.690) have been observed twice by the Nuclear Spectroscopic Telescope Array (NuSTAR) simultaneously with Swift/X-ray Telescope, showing different variability behaviours. We found that NuSTAR is instrumental to explore the variability of powerful high-redshift blazars, even when...

  3. Intra-night Optical Variability Monitoring of Fermi Blazars: First Results from 1.3 m J. C. Bhattacharya Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S.; Ajello, M.; Kaur, A. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Stalin, C. S., E-mail: vpaliya@g.clemson.edu [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)

    2017-07-20

    We report the first results obtained from our campaign to characterize the intra-night-optical variability (INOV) properties of Fermi detected blazars, using the observations from the recently commissioned 1.3 m J. C. Bhattacharya telescope (JCBT). During the first run, we were able to observe 17 blazars in the Bessel R filter for ∼137 hr. Using C- and scaled F -statistics, we quantify the extent of INOV and derive the duty cycle (DC), which is the fraction of time during which a source exhibits a substantial flux variability. We find a high DC of 40% for BL Lac objects and the flat spectrum radio quasars are relatively less variable (DC ∼ 15%). However, when estimated for blazars sub-classes, a high DC of ∼59% is found in low synchrotron peaked (LSP) blazars, whereas, intermediate and high synchrotron peaked objects have a low DC of ∼11% and 13%, respectively. We find evidence of the association of the high amplitude INOV with the γ -ray flaring state. We also notice a high polarization during the elevated INOV states (for the sources that have polarimetric data available), thus supporting the jet based origin of the observed variability. We plan to enlarge the sample and utilize the time availability from the small telescopes, such as 1.3 m JCBT, to strengthen/verify the results obtained in this work and those existing in the literature.

  4. Galaxy at a redshift of 3.215 - further studies of the PKS 1614+051 system

    International Nuclear Information System (INIS)

    Djorgovski, S.; Strauss, M.A.; Spinrad, H.; Mccarthy, P.; Perley, R.A.; California Univ., Berkeley; National Radio Astronomy Observatory, Charlottesville, VA)

    1987-01-01

    A narrow-emission-line companion of the quasar PKS 1614+051 was reported earlier as a probable galaxy at a redshift of 3.218, which would have made it by far the most distant galaxy known at the time. New radio and optical imaging, and optical and near-IR spectroscopy of the PKS 1614+051 system is reported here. It is argued that the data support and reinforce the original interpretation of the companion object as a mildly active galaxy, possibly a marginal Seyfert 2. The object has a detectable and marginally resolved optical continuum, but was not detected at radio wavelengths. The ionization state is low, and the emission lines are fairly narrow. The improved redshift for the companion, based on the Ly-alpha line alone, is 3.215 + or - 0.002. New Ly-alpha images show interesting morphology of extended emission-line gas, suggestive of a possible tidal interaction with the neighboring QSO. 24 references

  5. Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..

    2012-04-05

    We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  6. DISCOVERY OF VERY HIGH ENERGY GAMMA RAYS FROM PKS 1424+240 AND MULTIWAVELENGTH CONSTRAINTS ON ITS REDSHIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.

    2010-01-01

    We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  7. THE SEARCH FOR BLAZARS AMONG THE UNIDENTIFIED EGRET gamma-RAY SOURCES

    Directory of Open Access Journals (Sweden)

    Pieter J. Meintjes

    2013-12-01

    Full Text Available In this paper we report the results of a multi-wavelength follow-up study of selected flat spectrum extragalactic radio-optical counterparts within the error boxes of 13 unidentified EGRET sources. Two of these previously unidentified counterparts have been selected for optical photometric and spectroscopic follow-up studies. Spectroscopic observations made with the 4.1m SOAR telescope at Cerro Pachón, Chile, showed that the spectra of the optical counterparts of 3EG J0821−5814 (PKS J0820−5705 and 3EG J0706−3837 (PMN J0710−3835 correspond to a flat spectrum radio quasar (FSRQ and LINER-Seyfert I galaxy respectively. Optical photometry of these sources, performed with the 1.0m telescope at Sutherland (South-Africa shows noticeable intranight variability for PKS J0820−5705, as well as a 5 sigma variation of the mean brightness in the R-filter over a timescale of three nights. Significant variability has been detected in the B-band for PMN J0710−3835 as well. The gamma-ray spectral indices of all 13 candidates range between 2–3, correlating well with the BL Lacs and FSRQs detected with Fermi-LAT in the first 11 months of operation.

  8. The role of plasma instabilities in the propagation of gamma-rays from distant Blazars

    Energy Technology Data Exchange (ETDEWEB)

    Saveliev, A.; Evoli, C.; Sigl, G. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

    2013-11-15

    The observation in the GeV band of distant blazars has been recently used to put constraints on the Extragalactic Background Light (EBL) and Extragalactic Magnetic Fields (EGMF). To support such claims one has to assume that the leptonic component of the electromagnetic cascade initiated by blazar gamma-rays is deflected away by strong enough EGMF, suppressing the signal in the Fermi window. Apart from magnetic fields, the development of such a cascade might be affected by plasma instabilities due to interactions with the ionized component of the Intergalactic Medium (IGM). In this paper we model the electromagnetic cascade through a Monte Carlo simulation in which both effects are taken into account separately, and we derive constraints on these scenarios from the combined Fermi-HESS data set. In the specific case of 1ES 0229+200 observations, we show that both explanations of the GeV flux suppression are compatible with the available data, specifically by assuming a magnetic field of B >or similar 10{sup -16} G or an IGM temperature of T

  9. Blazar Variability from Turbulence in Jets Launched by Magnetically Arrested Accretion Flows

    Energy Technology Data Exchange (ETDEWEB)

    Riordan, Michael O’; Pe’er, Asaf [Physics Department, University College Cork, Cork (Ireland); McKinney, Jonathan C., E-mail: michael_oriordan@umail.ucc.ie [Department of Physics and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States)

    2017-07-10

    Blazars show variability on timescales ranging from minutes to years, the former being comparable to and in some cases even shorter than the light-crossing time of the central black hole. The observed γ -ray light curves can be described by a power-law power density spectrum (PDS), with a similar index for both BL Lacs and flat-spectrum radio quasars. We show that this variability can be produced by turbulence in relativistic jets launched by magnetically arrested accretion flows (MADs). We perform radiative transport calculations on the turbulent, highly magnetized jet launching region of a MAD with a rapidly rotating supermassive black hole. The resulting synchrotron and synchrotron self-Compton emission, originating from close to the black hole horizon, is highly variable. This variability is characterized by PDS, which is remarkably similar to the observed power-law spectrum at frequencies less than a few per day. Furthermore, turbulence in the jet launching region naturally produces fluctuations in the plasma on scales much smaller than the horizon radius. We speculate that similar turbulent processes, operating in the jet at large radii (and therefore a high bulk Lorentz factor), are responsible for blazar variability over many decades in frequency, including on minute timescales.

  10. TIME-DEPENDENT ELECTRON ACCELERATION IN BLAZAR TRANSIENTS: X-RAY TIME LAGS AND SPECTRAL FORMATION

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Tiffany R.; Becker, Peter A. [Department of Physics and Astronomy, George Mason University, Fairfax, VA 22030-4444 (United States); Finke, Justin D., E-mail: pbecker@gmu.edu, E-mail: tlewis13@gmu.edu, E-mail: justin.finke@nrl.navy.mil [U.S. Naval Research Laboratory, Code 7653, 4555 Overlook Avenue SW, Washington, DC 20375-5352 (United States)

    2016-06-20

    Electromagnetic radiation from blazar jets often displays strong variability, extending from radio to γ -ray frequencies. In a few cases, this variability has been characterized using Fourier time lags, such as those detected in the X-rays from Mrk 421 using Beppo SAX. The lack of a theoretical framework to interpret the data has motivated us to develop a new model for the formation of the X-ray spectrum and the time lags in blazar jets based on a transport equation including terms describing stochastic Fermi acceleration, synchrotron losses, shock acceleration, adiabatic expansion, and spatial diffusion. We derive the exact solution for the Fourier transform of the electron distribution and use it to compute the Fourier transform of the synchrotron radiation spectrum and the associated X-ray time lags. The same theoretical framework is also used to compute the peak flare X-ray spectrum, assuming that a steady-state electron distribution is achieved during the peak of the flare. The model parameters are constrained by comparing the theoretical predictions with the observational data for Mrk 421. The resulting integrated model yields, for the first time, a complete first-principles physical explanation for both the formation of the observed time lags and the shape of the peak flare X-ray spectrum. It also yields direct estimates of the strength of the shock and the stochastic magnetohydrodynamical wave acceleration components in the Mrk 421 jet.

  11. Detection of the cosmic γ-ray horizon from multiwavelength observations of blazars

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez, A. [Univ. of California, Riverside, CA (United States); Finke, J. D. [U.S. Naval Research Lab., Washington, DC (United States); Prada, F. [Campus of International Excellence UAM_CSIC, Madrid (Spain); Universidad Autonoma de Madrid (Spain); Instituto de Astrofisica de Andalucia, Granada (Spain); Primack, J. R. [Univ. of California, Santa Cruz, CA (United States); Kitaura, F. S. [Leibniz-Institut fuer Astrophysik, Potsdam (Germany); Siana, B. [Univ. Of California, Riverside, CA (United States); Paneque, D. [Stanford Univ., Stanford, CA (United States). Kavli Inst. sor Particle Astrophysics and Cosmology; Max-Planck-Institut fuer Physik, Munich (Germany)

    2013-05-24

    The first statistically significant detection of the cosmic γ-ray horizon (CGRH) that is independent of any extragalactic background light (EBL) model is presented. The CGRH is a fundamental quantity in cosmology. It gives an estimate of the opacity of the Universe to very high energy (VHE) γ-ray photons due to photon-photon pair production with the EBL. The only estimations of the CGRH to date are predictions from EBL models and lower limits from γ-ray observations of cosmological blazars and γ-ray bursts. Here, we present homogeneous synchrotron/synchrotron self-Compton (SSC) models of the spectral energy distributions of 15 blazars based on (almost) simultaneous observations from radio up to the highest energy γ-rays taken with the Fermi satellite. These synchrotron/SSC models predict the unattenuated VHE fluxes, which are compared with the observations by imaging atmospheric Cherenkov telescopes. The comparison provides an estimate of the optical depth of the EBL, which allows a derivation of the CGRH through a maximum likelihood analysis that is EBL-model independent. We find that the observed CGRH is compatible with the current knowledge of the EBL.

  12. Blazar Variability from Turbulence in Jets Launched by Magnetically Arrested Accretion Flows

    International Nuclear Information System (INIS)

    Riordan, Michael O’; Pe’er, Asaf; McKinney, Jonathan C.

    2017-01-01

    Blazars show variability on timescales ranging from minutes to years, the former being comparable to and in some cases even shorter than the light-crossing time of the central black hole. The observed γ -ray light curves can be described by a power-law power density spectrum (PDS), with a similar index for both BL Lacs and flat-spectrum radio quasars. We show that this variability can be produced by turbulence in relativistic jets launched by magnetically arrested accretion flows (MADs). We perform radiative transport calculations on the turbulent, highly magnetized jet launching region of a MAD with a rapidly rotating supermassive black hole. The resulting synchrotron and synchrotron self-Compton emission, originating from close to the black hole horizon, is highly variable. This variability is characterized by PDS, which is remarkably similar to the observed power-law spectrum at frequencies less than a few per day. Furthermore, turbulence in the jet launching region naturally produces fluctuations in the plasma on scales much smaller than the horizon radius. We speculate that similar turbulent processes, operating in the jet at large radii (and therefore a high bulk Lorentz factor), are responsible for blazar variability over many decades in frequency, including on minute timescales.

  13. The Ringo2 Optical Polarisation Catalogue of 13 High-Energy Blazars

    Science.gov (United States)

    Barres de Almeida, Ulisses; Jermak, Helen; Mundell, Carole; Lindfors, Elina; Nilsson, Kari; Steele, Iain

    2015-08-01

    We present the findings of the Ringo2 3-year survey of 13 blazars (3 FSRQs and 10 BL Lacs) with regular coverage and reasonably fast cadence of one to three observations a week. Ringo2 was installed on the Liverpool Robotic Telescope (LT) on the Canary Island of La Palma between 2009 and 2012 and monitored thirteen high-energy-emitting blazars in the northern sky. The objects selected as well as the observational strategy were tuned to maximise the synergies with high-energy X- to gamma-ray observations. Therefore this sample stands out as a well-sampled, long-term view of high-energy AGN jets in polarised optical light. Over half of the sources exhibited an increase in optical flux during this period and almost a quarter were observed in outburst. We compare the optical data to gamma (Fermi/LAT) and X-ray data during these periods of outburst. In this talk we present the data obtained for all sources over the lifetime of Ringo2 with additional optical data from the KVA telescope and the SkyCamZ wide-field camera (on the LT), we explore the relationship between the change in polarisation angle as a function of time (dEVPA/dMJD), flux and polarisation degree along with cross correlation comparisons of optical and high-energy flux.

  14. Discovery of a GeV Blazar Shining Through the Galactic Plane

    Energy Technology Data Exchange (ETDEWEB)

    Vandenbroucke, J.; Buehler, R.; Ajello, M.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Bellini, A.; /Padua U., Astron. Dept. /Baltimore, Space Telescope Sci.; Bolte, M.; /UC, Santa Cruz; Cheung, C.C.; /Naval Research Lab, Wash., D.C. /NAS, Washington, D.C.; Civano, F.; /Smithsonian Astrophys. Observ.; Donato, D.; /NASA, Goddard; Fuhrmann, L.; /Bonn, Max Planck Inst., Radioastron.; Funk, S.; Healey, S.E.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Hill, A.B.; /Joseph Fourier U.; Knigge, C.; /Southampton U.; Madejski, G.M.; Romani, R.W.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Santander-Garcia, M.; /IAC, La Laguna /Isaac Newton Group /Laguna U., Tenerife; Shaw, M.S.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Steeghs, D.; /Warwick U.; Torres, M.A.P.; /Smithsonian Astrophys. Observ.; Van Etten, A.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC /Texas U., Astron. Dept.

    2011-08-11

    The Fermi Large Area Telescope (LAT) discovered a new gamma-ray source near the Galactic plane, Fermi J0109+6134, when it flared brightly in 2010 February. The low Galactic latitude (b = -1.2{sup o}) indicated that the source could be located within the Galaxy, which motivated rapid multi-wavelength follow-up including radio, optical, and X-ray observations. We report the results of analyzing all 19 months of LAT data for the source, and of X-ray observations with both Swift and the Chandra X-ray Observatory. We determined the source redshift, z = 0.783, using a Keck LRIS observation. Finally, we compiled a broadband spectral energy distribution (SED) from both historical and new observations contemporaneous with the 2010 February flare. The redshift, SED, optical line width, X-ray obsorption, and multi-band variability indicate that this new Gev source is a blazar seen through the Galactic plane. Because several of the optical emission lines have equivalent width > 5 {angstrom}, this blazar belongs in the flat-spectrum radio quasar category.

  15. OPTICAL SPECTROSCOPIC OBSERVATIONS OF GAMMA-RAY BLAZAR CANDIDATES. VI. FURTHER OBSERVATIONS FROM TNG, WHT, OAN, SOAR, AND MAGELLAN TELESCOPES

    Energy Technology Data Exchange (ETDEWEB)

    Álvarez Crespo, N.; Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Milisavljevic, D.; Paggi, A.; Smith, Howard A. [Harvard—Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Chavushyan, V.; Patiño-Álvarez, V. [Instituto Nacional de Astrofísica, Óptica y Electrónica, Apartado Postal 51-216, 72000 Puebla, México (Mexico); Masetti, N. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Jiménez-Bailón, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 877, Ensenada, 22800 Baja California, México (Mexico); Strader, J.; Chomiuk, L. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Katagiri, H.; Kagaya, M. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Cheung, C. C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States); D’Abrusco, R. [Department of Physical Sciences, University of Napoli Federico II, via Cinthia 9, I-80126 Napoli (Italy); Ricci, F.; La Franca, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); and others

    2016-04-15

    Blazars, one of the most extreme classes of active galaxies, constitute so far the largest known population of γ-ray sources, and their number is continuously growing in the Fermi catalogs. However, in the latest release of the Fermi catalog there is still a large fraction of sources that are classified as blazar candidates of uncertain type (BCUs) for which optical spectroscopic observations are necessary to confirm their nature and their associations. In addition, about one-third of the γ-ray point sources listed in the Third Fermi-LAT Source Catalog (3FGL) are still unassociated and lacking an assigned lower-energy counterpart. Since 2012 we have been carrying out an optical spectroscopic campaign to observe blazar candidates to confirm their nature. In this paper, the sixth of the series, we present optical spectroscopic observations for 30 γ-ray blazar candidates from different observing programs we carried out with the Telescopio Nazionale Galileo, William Herschel Telescope, Observatorio Astronómico Nacional, Southern Astrophysical Research Telescope, and Magellan Telescopes. We found that 21 out of 30 sources investigated are BL Lac objects, while the remaining targets are classified as flat-spectrum radio quasars showing the typical broad emission lines of normal quasi-stellar objects. We conclude that our selection of γ-ray blazar candidates based on their multifrequency properties continues to be a successful way to discover potential low-energy counterparts of the Fermi unidentified gamma-ray sources and to confirm the nature of BCUs.

  16. GAMMA-RAY EMISSION FROM TWO BLAZARS BEHIND THE GALACTIC PLANE: B2013+370 AND B2023+336

    International Nuclear Information System (INIS)

    Kara, E.; Errando, M.; Aliu, E.; Mukherjee, R.; Max-Moerbeck, W.; Readhead, A. C. S.; Richards, J. L.; Böttcher, M.; Fortin, P.; Halpern, J. P.

    2012-01-01

    B2013+370 and B2023+336 are two blazars at low-galactic latitude that were previously proposed to be the counterparts for the EGRET unidentified sources 3EG J2016+3657 and 3EG J2027+3429. Gamma-ray emission associated with the EGRET sources has been detected by the Fermi Gamma-ray Space Telescope, and the two sources, 1FGL J2015.7+3708 and 1FGL J2027.6+3335, have been classified as unidentified in the 1 year catalog. This analysis of the Fermi Large Area Telescope (LAT) data collected during 31 months reveals that the 1FGL sources are spatially compatible with the blazars and are significantly variable, supporting the hypothesis of extragalactic origin for the gamma-ray emission. The gamma-ray light curves are compared with 15 GHz radio light curves from the 40 m telescope at the Owens Valley Radio Observatory. Simultaneous variability is seen in both bands for the two blazar candidates. The study is completed with the X-ray analysis of 1FGL J2015.7+3708 using Swift observations that were triggered in 2010 August by a Fermi-detected flare. The resulting spectral energy distribution shows a two-component structure typical of blazars. We also identify a second source in the field of view of 1FGL J2027.6+3335 with similar characteristics to the known LAT pulsars. This study gives solid evidence favoring blazar counterparts for these two unidentified EGRET and Fermi sources, supporting the hypothesis that a number of unidentified gamma-ray sources at low-galactic latitudes are indeed of extragalactic origin.

  17. SDSS J14584479+3720215: A BENCHMARK JHK{sub S} BLAZAR LIGHT CURVE FROM THE 2MASS CALIBRATION SCANS

    Energy Technology Data Exchange (ETDEWEB)

    Davenport, James R. A.; Ruan, John J.; Becker, Andrew C. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Macleod, Chelsea L. [Physics Department, The United States Naval Academy, 572c Holloway Road, Annapolis, MD 21402 (United States); Cutri, Roc M., E-mail: jrad@astro.washington.edu [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States)

    2015-04-10

    Active galactic nuclei (AGNs) are well-known to exhibit flux variability across a wide range of wavelength regimes, but the precise origin of the variability at different wavelengths remains unclear. To investigate the relatively unexplored near-IR (NIR) variability of the most luminous AGNs, we conduct a search for variability using well sampled JHK{sub s}-band light curves from the Two Micron All Sky Survey (2MASS) calibration fields. Our sample includes 27 known quasars with an average of 924 epochs of observation over three years, as well as one spectroscopically confirmed blazar (SDSS J14584479+3720215) with 1972 epochs of data. This is the best-sampled NIR photometric blazar light curve to date, and it exhibits correlated, stochastic variability that we characterize with continuous auto-regressive moving average (CARMA) models. None of the other 26 known quasars had detectable variability in the 2MASS bands above the photometric uncertainty. A blind search of the 2MASS calibration field light curves for active galactic nucleus (AGN) candidates based on fitting CARMA(1,0) models (damped-random walk) uncovered only seven candidates. All seven were young stellar objects within the ρ Ophiuchus star forming region, five with previous X-ray detections. A significant γ-ray detection (5σ) for the known blazar using 4.5 yr of Fermi photon data is also found. We suggest that strong NIR variability of blazars, such as seen for SDSS J14584479+3720215, can be used as an efficient method of identifying previously unidentified γ-ray blazars, with low contamination from other AGNs.

  18. Impact of seeing and host galaxy into the analysis of photo-polarimetric microvariability in blazars. Case study of the nearby blazars 1ES 1959+650 and HB89 2201+044

    Science.gov (United States)

    Sosa, M. S.; von Essen, C.; Andruchow, I.; Cellone, S. A.

    2017-11-01

    Blazars, a type of Active Galactic Nuclei, present a particular orientation of their jets close to the line of sight. Their radiation is thus relativistically beamed, giving rise to extreme behaviors, specially strong variability on very short timescales (I.e., microvariability). Here we present simultaneous photometric and polarimetric observations of two relatively nearby blazars, 1ES 1959+650 and HB89 2201+044, that were obtained using the Calar Alto Faint Object Spectrograph mounted at the 2.2 m telescope in Calar Alto, Spain. An outstanding characteristic of these two blazars is the presence of well resolved host galaxies. This particular feature allows us to produce a study of their intrinsic polarization, a measurement of the polarization state of the galactic nucleus unaffected by the host galaxy. To carry out this work, we computed photometric fluxes from which we calculated the degree and orientation of the blazars polarization. Then, we analyzed the depolarizing effect introduced by the host galaxy with the main goal to recover the intrinsic polarization of the galactic nucleus, carefully taking into consideration the spurious polarimetric variability introduced by changes in seeing along the observing nights. We find that the two blazars do not present intra-night photo-polarimetric variability, although we do detect a significant inter-night variability. Comparing polarimetric values before and after accounting for the host galaxies, we observe a significant difference in the polarization degree of about 1% in the case of 1ES 1959+650, and 0.3% in the case of HB89 2201+044, thus evidencing the non-negligible impact introduced by the host galaxies. We note that this host galaxy effect depends on the waveband, and varies with changing seeing conditions, so it should be particularly considered when studying frequency-dependent polarization in blazars. Based on observations collected at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated

  19. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  20. Molecular hydrogen in the z = 2.811 absorbing material toward the quasar PKS 0528-250

    International Nuclear Information System (INIS)

    Levshakov, S.A.; Varshalovich, D.A.

    1985-01-01

    Among the previously unidentified absorbtion features in the spectrum of the quasar PKS 0528-250 obtained by previous authors tentative evidence has been found for H 2 lines at the same redshift (z = 2.811) as that of the well-known absorption-line system. The column density of molecules has been estimated from the curve of growth; the fraction of H 2 appears to be about 2 x 10 -5 . The ortho- to para-H 2 ratio corresponds to the excitation temperature of Tsub(ex)(H 2 ) = 300 +- 150 K, though the upper rotational levels J >= 3 turn out be overpopulated. The results obtained seem to provide substantial evidence for the existence of molecular hydrogen at the early cosmological epoch with z approx. 3. (author)

  1. On the intrinsic spectrum of PKS 2155-304 from H.E.S.S. 2003 data

    International Nuclear Information System (INIS)

    Costamante, L.; Benbow, W.; Horns, D.; Reimer, A.; Reimer, O.

    2005-01-01

    In 2003, PKS 2155-304 has been significantly detected by H.E.S.S. at Very High Energies (VHE), with an average spectrum of Γ = 3.3. Due to absorption by the Extragalactic Background Light (EBL), the intrinsic spectrum is heavily modified both in shape and intensity. To correct for this effect, and locate the Inverse Compton (IC) peak of the Spectral Energy Distribution (SED), we used three EBL models (representatives of three different flux levels for the stellar peak component). The resulting TeV spectrum has a peak around 1 TeV for stellar peak fluxes above the Primack (2001) calculation, while the spectrum is steeper than Γ = 2 (thus locating the IC peak 19 (for historical SED fluxes and 2 hours variability timescale)

  2. The Imprint of the Extragalactic Background Light in the Gamma-Ray Spectra of Blazars

    Science.gov (United States)

    Ackermann, M.; Ajello, M.; Allafort, A.; Schady, P.; Baldini, L.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bellazzini, R; Blandford, R. D.; hide

    2012-01-01

    The light emitted by stars and accreting compact objects through the history of the universe is encoded in the intensity of the extragalactic background light (EBL). Knowledge of the EBL isimportant to understand the nature of star formation and galaxy evolution, but direct measurements of the EBL are limited by galactic and other foreground emissions. Here, we report an absorption feature seen in the combined spectra of a sample of gamma-ray blazars out to a redshift of z approx. 1.6. This feature is caused by attenuation of gamma rays by the EBL at optical to ultraviolet frequencies and allowed us to measure the EBL flux density in this frequency band.

  3. Probing stochastic inter-galactic magnetic fields using blazar-induced gamma ray halo morphology

    Energy Technology Data Exchange (ETDEWEB)

    Duplessis, Francis [Physics Department, Arizona State University, Tempe, AZ 85287 (United States); Vachaspati, Tanmay, E-mail: fdupless@asu.edu, E-mail: tvachasp@asu.edu [Maryland Center for Fundamental Physics, University of Maryland, College Park, MD 20742 (United States)

    2017-05-01

    Inter-galactic magnetic fields can imprint their structure on the morphology of blazar-induced gamma ray halos. We show that the halo morphology arises through the interplay of the source's jet and a two-dimensional surface dictated by the magnetic field. Through extensive numerical simulations, we generate mock halos created by stochastic magnetic fields with and without helicity, and study the dependence of the halo features on the properties of the magnetic field. We propose a sharper version of the Q-statistics and demonstrate its sensitivity to the magnetic field strength, the coherence scale, and the handedness of the helicity. We also identify and explain a new feature of the Q-statistics that can further enhance its power.

  4. Fermi-LAT View of Bright Flaring Gamma-Ray Blazars

    Science.gov (United States)

    Bastieri, D.; Ciprini, S.; Gasparrini, D.

    2011-06-01

    The Fermi LAT provides a continuous and uniform monitoring of the Universe in the gamma-ray band. During the first year many gamma-ray blazar flares, some unidentified transients and emission by the Sun while in a quiet state were promptly detected. This is mainly due to the design of the mission, featuring a detector, the LAT with a wide field of view, and to the operation of the spacecraft itself, that can cover every region of the sky every 3 hours. Nevertheless, the scientific exploitation of this monitoring is more fruitful when early information about transients reaches a broader community. In this respect, the indefatigable activity of flare advocates, who worked on weekly shifts to validate the results and quickly broadcast information about flares and new detections, was the key to most scientific results.

  5. Variations of the Blazar AO 0235+164 in 2006-2015

    Science.gov (United States)

    Hagen-Thorn, V. A.; Larionov, V. M.; Morozova, D. A.; Arkharov, A. A.; Hagen-Thorn, E. I.; Shablovinskaya, E. S.; Prokop'eva, M. S.; Yakovleva, V. A.

    2018-02-01

    The results of optical, radio, and gamma-ray observations of the blazar AO 0235+16 are presented, including photometric ( BV RIJHK) and polarimetric ( R)monitoring carried out at St. Petersburg State University and the Central (Pulkovo) Astronomical Observatory in 2007-2015, 43 GHz Very Long Baseline Interferometry radio observations processed at Boston University, and a gamma-ray light curve based on observationswith the Fermi space observatory are presented. Two strong outbursts were detected. The relative spectral energy distributions of the variable components responsible for the outbursts are determined; these follow power laws, but with different spectral indices. The degree of polarization was high in both outbursts; only an average relationship between the brightness and polarization can be found. There was no time lag between the variations in the optical and gamma-ray, suggesting that the sources of the radiation in the optical and gamma-ray are located in the same region of the jet.

  6. Implication of the detection of very hard spectra from the TeV blazar Mrk 501

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, Amit; Hughes, Gareth; Biland, Adrian [ETH Zurich, Institute for Particle Physics (Switzerland); Mannheim, Karl; Dorner, Daniela [Institute for Theoretical Physics and Astrophysics, Universitaet Wuerzburg (Germany); Chitnis, Varsha R. [Department of High Energy Physics, Tata Institute of Fundamental Research, Mumbai (India); Roy, Jayashree; Acharya, Bannanje Sripathi [Center for Excellence in Basic Sciences, UM-DAE Mumbai (India)

    2016-07-01

    The emission from active galactic nuclei ranges from radio to TeV energies and shows high variability. The origin of the high energy emission is highly debated. The observed emission could be due to a complex superposition of emission from multiple zones. New evidence of the detection of very hard intrinsic gamma-ray spectra obtained from Fermi-LAT observations have challenged the theories about origin of VHE gamma-rays. We have used the 7 years of Fermi-LAT data to search for time intervals with unusually hard spectra from the nearby TeV blazar Mrk 501. In the presentation, we discuss a few possible explanations for the origin of these hard spectra within a leptonic scenario.

  7. H.E.S.S. discovery of very high energy γ-ray emission from PKS 0625-354

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hadasch, D.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morâ, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-05-01

    PKS 0625-354 (z = 0.055) was observed with the four High Energy Stereoscopic System (H.E.S.S.) telescopes in 2012 during 5.5 h. The source was detected above an energy threshold of 200 GeV at a significance level of 6.1σ. No significant variability is found in these observations. The source is well described with a power-law spectrum with photon index Γ = 2.84 ± 0.50stat ± 0.10syst and normalization (at E0 = 1.0 TeV) N0(E0) = (0.58 ± 0.22stat ± 0.12syst) × 10-12 TeV-1 cm-2 s-1. Multiwavelength data collected with Fermi-LAT, Swift-XRT, Swift-UVOT, ATOM and WISE are also analysed. Significant variability is observed only in the Fermi-LAT γ-ray and Swift-XRT X-ray energy bands. Having a good multiwavelength coverage from radio to very high energy, we performed a broad-band modelling from two types of emission scenarios. The results from a one zone lepto-hadronic and a multizone leptonic models are compared and discussed. On the grounds of energetics, our analysis favours a leptonic multizone model. Models associated to the X-ray variability constraint support previous results, suggesting a BL Lac nature of PKS 0625-354 with, however, a large-scale jet structure typical of a radio galaxy.

  8. INVESTIGATING BROADBAND VARIABILITY OF THE TeV BLAZAR 1ES 1959+650

    International Nuclear Information System (INIS)

    Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Barnacka, A.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Berger, K.; Bird, R.; Collins-Hughes, E.; Bouvier, A.; Chen, X.; Ciupik, L.; Connolly, M. P.; Cui, W.; Dumm, J.; Eisch, J. D.

    2014-01-01

    We summarize broadband observations of the TeV-emitting blazar 1ES 1959+650, including optical R-band observations by the robotic telescopes Super-LOTIS and iTelescope, UV observations by Swift Ultraviolet and Optical Telescope, X-ray observations by the Swift X-ray Telescope, high-energy gamma-ray observations with the Fermi Large Area Telescope, and very-high-energy (VHE) gamma-ray observations by VERITAS above 315 GeV, all taken between 2012 April 17 and 2012 June 1 (MJD 56034 and 56079). The contemporaneous variability of the broadband spectral energy distribution is explored in the context of a simple synchrotron self Compton (SSC) model. In the SSC emission scenario, we find that the parameters required to represent the high state are significantly different than those in the low state. Motivated by possible evidence of gas in the vicinity of the blazar, we also investigate a reflected emission model to describe the observed variability pattern. This model assumes that the non-thermal emission from the jet is reflected by a nearby cloud of gas, allowing the reflected emission to re-enter the blob and produce an elevated gamma-ray state with no simultaneous elevated synchrotron flux. The model applied here, although not required to explain the observed variability pattern, represents one possible scenario which can describe the observations. As applied to an elevated VHE state of 66% of the Crab Nebula flux, observed on a single night during the observation period, the reflected emission scenario does not support a purely leptonic non-thermal emission mechanism. The reflected emission model does, however, predict a reflected photon field with sufficient energy to enable elevated gamma-ray emission via pion production with protons of energies between 10 and 100 TeV

  9. The extreme blazar AO 0235+164 as seen by extensive ground and space radio observations

    Science.gov (United States)

    Kutkin, A. M.; Pashchenko, I. N.; Lisakov, M. M.; Voytsik, P. A.; Sokolovsky, K. V.; Kovalev, Y. Y.; Lobanov, A. P.; Ipatov, A. V.; Aller, M. F.; Aller, H. D.; Lahteenmaki, A.; Tornikoski, M.; Gurvits, L. I.

    2018-04-01

    Clues to the physical conditions in radio cores of blazars come from measurements of brightness temperatures as well as effects produced by intrinsic opacity. We study the properties of the ultra-compact blazar AO 0235+164 with RadioAstron ground-space radio interferometer, multifrequency VLBA, EVN, and single-dish radio observations. We employ visibility modelling and image stacking for deriving structure and kinematics of the source, and use Gaussian process regression to find the relative multiband time delays of the flares. The multifrequency core size and time lags support prevailing synchrotron self-absorption. The intrinsic brightness temperature of the core derived from ground-based very long baseline interferometry (VLBI) is close to the equipartition regime value. In the same time, there is evidence for ultra-compact features of the size of less than 10 μas in the source, which might be responsible for the extreme apparent brightness temperatures of up to 1014 K as measured by RadioAstron. In 2007-2016 the VLBI components in the source at 43 GHz are found predominantly in two directions, suggesting a bend of the outflow from southern to northern direction. The apparent opening angle of the jet seen in the stacked image at 43 GHz is two times wider than that at 15 GHz, indicating a collimation of the flow within the central 1.5 mas. We estimate the Lorentz factor Γ = 14, the Doppler factor δ = 21, and the viewing angle θ = 1.7° of the apparent jet base, derive the gradients of magnetic field strength and electron density in the outflow, and the distance between jet apex and the core at each frequency.

  10. New Gener. High-Energy Spectra of the Blazar 3C 279 with XMM-Newton and GLAST

    Science.gov (United States)

    Collmar, Werner

    2007-10-01

    We propose two 20 ksec XMM-Newton observations of the X-ray bright gamma-ray blazar 3C~279 simultaneous with GLAST/LAT. The main goal is to measure its X-ray properties (spectrum, variability) in order to (1) improve our knowledge on the X-ray emission of the blazar, and (2) to supplement and correlate them to simultaneous GLAST/LAT Gamma-ray observations (30 MeV-300 GeV). Simultaneous GLAST observations of 3C 279 are guaranteed (assuming proper operation then). The high-energy data will be supplemented by ground-based measurements, adding finally up to multifrequency spectra which have unprecedented accuracy and will extend up to high-energy gamma-rays. Such high-quality SEDs will provide severe constraints on their modeling and have the potential to discriminate among models.

  11. Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279

    International Nuclear Information System (INIS)

    Dermer, Charles D.; Cerruti, Matteo; Lott, Benoit; Boisson, Catherine; Zech, Andreas

    2014-01-01

    Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ D or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ D , B', and the peak electron Lorentz factor γ pk ′ . The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ D ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10 –2 -10 –3 erg cm –3 , implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ 2 ct var ∼ 0.1(Γ/30) 2 (t var /10 4 s) pc from the black hole powering 3C 279's jets, where t var is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.

  12. Comparison of Optical and Multi-Waveband Variations of Selected Gamma-ray Bright Blazars in 2012

    Science.gov (United States)

    Schultz, Benjamin; Jorstad, S. G.; Marscher, A. P.; Williamson, K. E.; Walker, G. E.

    2013-01-01

    We present multi-wavelength observations of several gamma-ray bright blazars. We combine optical data obtained with the 17-inch CCD telescope of Maria Mitchell Observatory with space- and ground-based observations carried out with a variety of instruments. These include a number of other optical telescopes, the Fermi Gamma-Ray Space Telescope at photon energies of 0.1-200 GeV, and the Swift satellite at 0.3-10 keV plus optical and UV wavelengths. Three of the observed blazars proved to be particularly active - BL Lac, Mrk501, and CTA-102. BL Lac was of special interest, displaying remarkable activity in multiple wavelengths during this observation period, including the optical, in which it underwent its largest observed flare in a number of years. In addition, CTA-102 has recently undergone an unprecedented multi-wavelength outburst. We cross-correlate the variations in the different wavebands in an effort to guide theoretical interpretations of the optical and high-energy emission from blazars. This project was supported by NSF/REU grant AST-0851892 and the Nantucket Maria Mitchell Association. The research at Boston University was supported in part by NSF grant AST-0907893 and by NASA through Fermi grant NNX11AQ03G.

  13. DETECTION OF CA II ABSORPTION BY A HIGH-VELOCITY CLOUD IN THE DIRECTION OF THE QUASAR PKS 0837-120

    NARCIS (Netherlands)

    ROBERTSON, JG; SCHWARZ, UJ; VANWOERDEN, H; MURRAY, JD; MORTON, DC; HULSBOSCH, ANM

    1991-01-01

    We present optical absorption spectroscopy of the Ca II K and H lines along the sight line to the quasar PKS 0837-120, which lies in the direction of a high-velocity cloud (HVC) detected in H I 21-cm emission at V(LSR) = + 105 km s-1. Our data show Ca II absorption due to the HVC as well as a lower

  14. THE COSMOLOGICAL IMPACT OF LUMINOUS TeV BLAZARS. II. REWRITING THE THERMAL HISTORY OF THE INTERGALACTIC MEDIUM

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Philip; Broderick, Avery E; Pfrommer, Christoph [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada)

    2012-06-10

    The universe is opaque to extragalactic very high energy gamma rays (VHEGRs, E > 100 GeV) because they annihilate and pair produce on the extragalactic background light. The resulting ultrarelativistic pairs are commonly assumed to lose energy primarily through inverse Compton scattering of cosmic microwave background (CMB) photons, reprocessing the original emission from TeV to GeV energies. In Broderick et al., we argued that this is not the case; powerful plasma instabilities driven by the highly anisotropic nature of the ultrarelativistic pair distribution provide a plausible way to dissipate the kinetic energy of the TeV-generated pairs locally, heating the intergalactic medium (IGM). Here, we explore the effect of this heating on the thermal history of the IGM. We collate the observed extragalactic VHEGR sources to determine a local VHEGR heating rate. Given the pointed nature of VHEGR observations, we estimate the correction for the various selection effects using Fermi observations of high- and intermediate-peaked BL Lac objects. As the extragalactic component of the local VHEGR flux is dominated by TeV blazars, we then estimate the evolution of the TeV blazar luminosity density by tying it to the well-observed quasar luminosity density and producing a VHEGR heating rate as a function of redshift. This heating is relatively homogeneous for z {approx}< 4, but there is greater spatial variation at higher redshift (order unity at z {approx} 6) because of the reduced number of blazars that contribute to local heating. We show that this new heating process dominates photoheating in the low-redshift evolution of the IGM and calculate the effect of this heating in a one-zone model. As a consequence, the inclusion of TeV blazar heating qualitatively and quantitatively changes the structure and history of the IGM. Due to the homogeneous nature of the extragalactic background light, TeV blazars produce a uniform volumetric heating rate. This heating is sufficient to

  15. THE COSMOLOGICAL IMPACT OF LUMINOUS TeV BLAZARS. II. REWRITING THE THERMAL HISTORY OF THE INTERGALACTIC MEDIUM

    International Nuclear Information System (INIS)

    Chang, Philip; Broderick, Avery E.; Pfrommer, Christoph

    2012-01-01

    The universe is opaque to extragalactic very high energy gamma rays (VHEGRs, E > 100 GeV) because they annihilate and pair produce on the extragalactic background light. The resulting ultrarelativistic pairs are commonly assumed to lose energy primarily through inverse Compton scattering of cosmic microwave background (CMB) photons, reprocessing the original emission from TeV to GeV energies. In Broderick et al., we argued that this is not the case; powerful plasma instabilities driven by the highly anisotropic nature of the ultrarelativistic pair distribution provide a plausible way to dissipate the kinetic energy of the TeV-generated pairs locally, heating the intergalactic medium (IGM). Here, we explore the effect of this heating on the thermal history of the IGM. We collate the observed extragalactic VHEGR sources to determine a local VHEGR heating rate. Given the pointed nature of VHEGR observations, we estimate the correction for the various selection effects using Fermi observations of high- and intermediate-peaked BL Lac objects. As the extragalactic component of the local VHEGR flux is dominated by TeV blazars, we then estimate the evolution of the TeV blazar luminosity density by tying it to the well-observed quasar luminosity density and producing a VHEGR heating rate as a function of redshift. This heating is relatively homogeneous for z ∼< 4, but there is greater spatial variation at higher redshift (order unity at z ∼ 6) because of the reduced number of blazars that contribute to local heating. We show that this new heating process dominates photoheating in the low-redshift evolution of the IGM and calculate the effect of this heating in a one-zone model. As a consequence, the inclusion of TeV blazar heating qualitatively and quantitatively changes the structure and history of the IGM. Due to the homogeneous nature of the extragalactic background light, TeV blazars produce a uniform volumetric heating rate. This heating is sufficient to increase

  16. FERMI/LARGE AREA TELESCOPE DISCOVERY OF GAMMA-RAY EMISSION FROM THE FLAT-SPECTRUM RADIO QUASAR PKS 1454-354

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bogaert, G.; Bonamente, E.; Brigida, M.

    2009-01-01

    We report the discovery by the Large Area Telescope (LAT) onboard the Fermi Gamma-Ray Space Telescope of high-energy γ-ray (GeV) emission from the flat-spectrum radio quasar PKS 1454-354 (z = 1.424). On 2008 September 4, the source rose to a peak flux of (3.5 ± 0.7) x 10 -6 ph cm -2 s -1 (E > 100 MeV) on a timescale of hours and then slowly dropped over the following 2 days. No significant spectral changes occurred during the flare. Fermi/LAT observations also showed that PKS 1454-354 is the most probable counterpart of the unidentified EGRET source 3EG J1500-3509. Multiwavelength measurements performed during the following days (7 September with Swift; 6-7 September with the ground-based optical telescope Automated Telescope for Optical Monitoring; 13 September with the Australia Telescope Compact Array) resulted in radio, optical, UV, and X-ray fluxes greater than archival data, confirming the activity of PKS 1454-354.

  17. HUBUNGAN ANTARA PARTISIPASI BIDAN PRAKTIK MANDIRI (BPM, PERJANJIAN KERJASAMA (PKS DAN SOSIALISASI DENGAN PELAKSANAAN PROGRAM JAMPERSAL DI KOTA BOGOR

    Directory of Open Access Journals (Sweden)

    Nawati Nawati

    2016-04-01

    Full Text Available Hubungan antara Partisipasi BPM, Perjanjian Kerjasama dan Sosialiasi dengan Pelaksanaan Program Jampersal di kota Bogor. Kesehatan merupakan bagian integal yang penting dalam pembangunan dan peningkatan kesejahteraan bangsa serta human capital investment baik jangka pendek maupun jangka panjang oleh karena itu pemerintah dalam suatu negara bertanggung jawab pada masalah kesehatan rakyatnya. Pemerintah sendiri adalah regulator dari penyelenggaraan pelayanan kesehatan untuk seluruh masyarakat, agar masyarakat mampu membayar kesehatan yang dibebankan kepadanya atau institusi tempat kerjanya. Tujuan penelitian ini adalah untuk diketahuinya hubungan antara Partisipasi BPM, Perjanjian Kerjasama dan Sosialiasi dengan Pelaksanaan Program Jampersal. Metode yang digunakan dalam penelitian ini adalah metode penelitian  analitik dengan pendekatan Cross sectional. Data dikumpulkan melalui wawancara dengan kuesioner pada bidan. Analisis data menggunakan uji Chi Square dan Regresi Logistik. Hasil analisis data didapatkan responden dengan OR:9,74 (95% CI:5,33-17,81 dan p-value= 0,000. Pada pendidikan responden mendapatkan nilai OR:4,56 (95% CI:3,22-16,24 dengan p-value= 0,000. Pada masa kerja responden dengan nilai OR:9,46 (95% CI:4,88-19,98 dengan p-value= 0,000. Pada karakteristik lama responden dengan OR: 66,93 (95% CI:5,89-173,07 dengan p-value= 0,000. Nilai sikap responden dengan OR:10,98 (95% CI:5,14-23,43 dengan p-value= 0,006. PKS dengan pelaksanakan Program Jampersal di Kota Bogor mempunyai nilai OR:9,46 (95% CI:4,48-19,98 dengan p-value= 0,000. Analisis multivariat ternyata variabel yang berhubungan bermakna dengan pelaksanaan program Jampersal adalah variabel PKS dengan nilai expB 3.833 p-value 0,036 dan sikap responden dengan nilai expB 3.032 dengan p-value 0,006. Dapat disimpulkan bahwa sikap responden memiliki perilaku positif dalam pelaksanaan Program Jampersal, variabel yang berhubungan bermakna dengan pelaksanaan Program Jampersal adalah

  18. The WEBT Campaign on the Blazar 3C 279 in 2006

    Science.gov (United States)

    Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berduygin, A.; Blaek, M.; Buemi, C.; Castro-Tirado, A. J.; De Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V. A.; Henson, G.; Hovatta, T.; Hudec, R.; Ibrahimov, M.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y. Y.; Kovalev, Yu. A.; Kubánek, P.; Kurosaki, M.; Kurtanidze, O.; Lähteenmäki, A.; Lanteri, L.; Larionov, V. M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H. R.; Mingaliev, M. G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.; Nilsson, K.; Nishiyama, S.; Ohlert, J.; Osterman, M. A.; Pak, S.; Pasanen, M.; Peters, C. S.; Pursimo, T.; Raiteri, C. M.; Robertson, J.; Robertson, T.; Ryle, W. T.; Sadakane, K.; Sadun, A.; Sigua, L.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L. O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J. R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vitek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, H.-S.

    2007-12-01

    The quasar 3C 279 was the target of an extensive multiwavelength monitoring campaign from 2006 January through April. An optical-IR-radio monitoring campaign by the Whole Earth Blazar Telescope (WEBT) collaboration was organized around target-of-opportunity X-ray and soft γ-ray observations with Chandra and INTEGRAL in 2006 mid-January, with additional X-ray coverage by RXTE and Swift XRT. In this paper we focus on the results of the WEBT campaign. The source exhibited substantial variability of optical flux and spectral shape, with a characteristic timescale of a few days. The variability patterns throughout the optical BVRI bands were very closely correlated with each other, while there was no obvious correlation between the optical and radio variability. After the ToO trigger, the optical flux underwent a remarkably clean quasi-exponential decay by about 1 mag, with a decay timescale of τd~12.8 days. In intriguing contrast to other (in particular, BL Lac type) blazars, we find a lag of shorter wavelength behind longer wavelength variability throughout the RVB wavelength ranges, with a time delay increasing with increasing frequency. Spectral hardening during flares appears delayed with respect to a rising optical flux. This, in combination with the very steep IR-optical continuum spectral index of α0~1.5-2.0, may indicate a highly oblique magnetic field configuration near the base of the jet, leading to inefficient particle acceleration and a very steep electron injection spectrum. An alternative explanation through a slow (timescale of several days) acceleration mechanism would require an unusually low magnetic field of B<~0.2 G, about an order of magnitude lower than inferred from previous analyses of simultaneous SEDs of 3C 279 and other flat-spectrum radio quasars with similar properties. For questions regarding the availability of the data from the WEBT campaign presented in this paper, please contact the WEBT President Massimo Villata at villata@oato.inaf.it.

  19. Fine Structure of the Core of the Blazar OJ 287-I

    Science.gov (United States)

    Matveyenko, L. I.; Sivakon', S. S.

    2017-12-01

    The fine structure of the active region, the bulge, of the blazar OJ 287 has been investigated with a resolution of 20 μas (0.1 pc) at a wavelength of 7 mm, the epochs of 2007-2017. The structure and kinematics correspond to a vortex nature. The surrounding matter, the plasma, is transferred to the center along two arms from opposite directions. The emerging excess angular momentum is carried away along the rotation axis by bipolar outflows, rotating coaxial tubes, in a direction X ≈ -120° in the plane of the sky as it is accumulated. The central high-velocity bipolar outflow has a helical shape. The diameters of the low-velocity flows are ø1 ≈ 0.3 and ø2 ≈ 0.65 mas, or 1.4 and 3 pc, respectively. Ring currents whose tangential directions are observed as parallel chains of components are excited in the flow walls. The peak brightness temperature of the nozzle reaches Tb ≈ 1012-1013 K. A "disk" with a diameter ø ≈ 0.5 mas (≈2.2 pc) is observed by the absorption of synchrotron radiation. The disk is inclined to the plane of the sky at an angle of 60° in the jet direction. The fragments are seen from a distance of ˜0.2 mas outside the absorption zone. The jet sizes exceed considerably the counterjet ones. An enhanced supply of plasma from the northern arm gives rise to an independent vortex 0.2 mas away from the central one in the NW direction. As in the first case, the helical central bipolar outflow is surrounded by a low-velocity component ø ≈ 0.28 mas in diameter with built-in ring currents. The jet is ejected in the direction X = -50° in the plane of the sky. The jet orientation changes, X = -130° at a distance of 1 mas. A high activity of the central and two side nozzles spaced 0.22 mas apart in the direction X = -40° is occasionally observed simultaneously. The active region of the blazar is observed through an ionized medium, a screen, whose influence is significant even at a wavelength of 7 mm. The absorption and refraction of the

  20. Biosynthesis of t-Butyl in Apratoxin A: Functional Analysis and Architecture of a PKS Loading Module.

    Science.gov (United States)

    Skiba, Meredith A; Sikkema, Andrew P; Moss, Nathan A; Lowell, Andrew N; Su, Min; Sturgis, Rebecca M; Gerwick, Lena; Gerwick, William H; Sherman, David H; Smith, Janet L

    2018-04-27

    The unusual feature of a t-butyl group is found in several marine-derived natural products including apratoxin A, a Sec61 inhibitor produced by the cyanobacterium Moorea bouillonii PNG 5-198. Here we determine that the apratoxin A t-butyl group is formed as pivaloyl acyl carrier protein (ACP) by AprA, the polyketide synthase (PKS) loading module of the apratoxin A biosynthetic pathway. AprA contains an inactive "pseudo" GCN5-related N-acetyltransferase domain (ΨGNAT) flanked by two methyltransferase domains (MT1 and MT2) that differ distinctly in sequence. Structural, biochemical, and precursor incorporation studies reveal that MT2 catalyzes unusually coupled decarboxylation and methylation reactions to transform dimethylmalonyl-ACP, the product of MT1, to pivaloyl-ACP. Further, pivaloyl-ACP synthesis is primed by the fatty acid synthase malonyl acyltransferase (FabD), which compensates for the ΨGNAT and provides the initial acyl-transfer step to form AprA malonyl-ACP. Additionally, images of AprA from negative stain electron microscopy reveal multiple conformations that may facilitate the individual catalytic steps of the multienzyme module.

  1. Upper mantle dynamics of Bangladesh by splitting analysis of core-mantle refracted SKS, PKS, and SKKS phases

    Science.gov (United States)

    Tiwari, Ashwani Kant; Bhushan, Kirti; Eken, Tuna; Singh, Arun

    2018-06-01

    New shear wave splitting measurements are obtained from the Bengal Basin using core-mantle refracted SKS, PKS, and SKKS phases. The splitting parameters, namely time delays (δ t) and fast polarization directions (ϕ), were estimated through analysis of 54 high-quality waveforms (⩾ 2.5 signal to noise ratio) from 30 earthquakes with magnitude ⩾ 5.5 recorded at ten seismic stations deployed over Bangladesh. No evidence of splitting was found, which indicates azimuthal isotropy beneath the region. These null measurements can be explained by either vertically dipping anisotropic fast axes or by the presence of multiple horizontal anisotropic layers with different fast polarization directions, where the combined effect results in a null characterization. The anisotropic fabric preserved from rifting episodes of Antarctica and India, subduction-related dynamics of the Indo-Burmese convergence zone, and northward movement of the Indian plate creating shear at the base of the lithosphere can explain the observed null measurements. The combined effect of all these most likely results in a strong vertical anisotropic heterogeneity, creating the observed null results.

  2. Faraday rotation at low frequencies: magnetoionic material of the large FRII radio galaxy PKS J0636-2036

    Science.gov (United States)

    O'Sullivan, S. P.; Lenc, E.; Anderson, C. S.; Gaensler, B. M.; Murphy, T.

    2018-04-01

    We present a low-frequency, broad-band polarization study of the FRII radio galaxy PKS J0636-2036 (z = 0.0551), using the Murchison Widefield Array (MWA) from 70 to 230 MHz. The northern and southern hotspots (separated by ˜14.5 arcmin on the sky) are resolved by the MWA (3.3 arcmin resolution) and both are detected in linear polarization across the full frequency range. A combination of Faraday rotation measure (RM) synthesis and broad-band polarization model fitting is used to constrain the Faraday depolarization properties of the source. For the integrated southern hotspot emission, two-RM-component models are strongly favoured over a single RM component, and the best-fitting model requires Faraday dispersions of approximately 0.7 and 1.2 rad m-2 (with a mean RM of ˜50 rad m-2). High-resolution imaging at 5 arcsec with the Australia Telescope Compact Array shows significant sub-structure in the southern hotspot and highlights some of the limitations in the polarization modelling of the MWA data. Based on the observed depolarization, combined with extrapolations of gas density scaling relations for group environments, we estimate magnetic field strengths in the intergalactic medium between ˜0.04 and 0.5 μG. We also comment on future prospects of detecting more polarized sources at low frequencies.

  3. Simultaneous X-ray, ultraviolet, and optical observations of the BL Lacertae object PKS 2155-304

    International Nuclear Information System (INIS)

    Treves, A.; Morini, M.; Chiappetti, L.; Fabian, A.; Falomo, R.

    1989-01-01

    A series of observations at optical, UV, and X-ray frequencies of PKS 2155-304, one of the brightest BL Lac objects is reported. Spectral fits given for various epochs show that the medium energy data are well fitted by single power laws plus absorption, with energy index between 1.5 and 2. Marginal evidence for an absorption edge at about 7 keV is found, as is evidence for some spectral depression at about 1 keV. This may be modeled with an edge at 660 + or - 26 eV with optical depth tau = 1.8 + or - 0.2. Energy distributions on several occasions are reconstructed, and the optical, UV, and X-ray intensities are found to be correlated in all cases but one. The variability amplitudes decrease and the time scales increase with decreasing frequency. These results indicate a synchrotron origin for the X-rays and distinct but connected emission regions for the X-ray, UV, and optical bands. 46 refs

  4. Characteristics of Gamma-Ray Loud Blazars in the VLBA Imaging and Polarimetry Survey

    Science.gov (United States)

    Linford, J. D.; Taylor, G. B.; Romani, R. W.; Healey, S. E.; Helmboldt, J. F.; Readhead, A. C.; Reeves, R.; Richards, J. L.; Cotter, G.

    2010-01-01

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed as part of the VLBA Imaging and Polarimetry Survey. This large, flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong gamma-ray emission. At lower flux levels, radio flux density does not directly correlate with gamma-ray flux. We find that the LAT-detected BL Lac objects tend to be similar to the non-LAT BL Lac objects, but that the LAT-detected FSRQs are often significantly different from the non-LAT FSRQs. The differences between the gamma-ray loud and quiet FSRQS can be explained by Doppler boosting; these objects appear to require larger Doppler factors than those of the BL Lac objects. It is possible that the gamma-ray loud FSRQs are fundamentally different from the gamma-ray quiet FSRQs. Strong polarization at the base of the jet appears to be a signature for gamma-ray loud AGNs.

  5. A Search for Quasi-periodic Oscillations in the Blazar 1ES 1959+650

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiao-Pan; Luo, Yu-Hui; Yang, Hai-Yan; Cai, Yan; Yang, Hai-Tao [Department of Physics, Zhaotong University, Zhaotong, 657000 (China); Yang, Cheng, E-mail: lxpzrc@163.com [College of Photoelectron and Communication Engineering, Yunnan Open University, Kunming, 650223 (China)

    2017-09-20

    We have searched quasi-periodic oscillations (QPOs) in the 15 GHz light curve of the BL Lac object 1ES 1959+650 monitored by the Owens Valley Radio Observatory 40 m telescope during the period from 2008 January to 2016 February, using the Lomb–Scargle Periodogram, power spectral density (PSD), discrete autocorrelation function, and phase dispersion minimization (PDM) techniques. The red noise background has been established via the PSD method, and no QPO can be derived at the 3 σ confidence level accounting for the impact of the red noise variability. We conclude that the light curve of 1ES 1959+650 can be explained by a stochastic red noise process that contributes greatly to the total observed variability amplitude, dominates the power spectrum, causes spurious bumps and wiggles in the autocorrelation function and can result in the variance of the folded light curve decreasing toward lower temporal frequencies when few-cycle, sinusoid-like patterns are present. Moreover, many early supposed periodicity claims for blazar light curves need to be reevaluated assuming red noise.

  6. Bulk Comptonization: new hints from the luminous blazar 4C+25.05

    Science.gov (United States)

    Kammoun, E. S.; Nardini, E.; Risaliti, G.; Ghisellini, G.; Behar, E.; Celotti, A.

    2018-01-01

    Blazars are often characterized by a spectral break at soft X-rays, whose origin is still debated. While most sources show a flattening, some exhibit a blackbody-like soft excess with temperatures of the order of ∼0.1 keV, similar to low-luminosity, non-jetted Seyferts. Here, we present the analysis of the simultaneous XMM-Newton and NuSTAR observations of the luminous flat-spectrum radio quasar 4C+25.05 (z = 2.368). The observed 0.3-30 keV spectrum is best described by the sum of a hard X-ray power law (Γ = 1.38_{-0.03}^{+0.05}) and a soft component, approximated by a blackbody with kT_BB = 0.66_{-0.04}^{+0.05} keV (rest frame). If the spectrum of 4C+25.05 is interpreted in the context of bulk Comptonization by cold electrons of broad-line region photons emitted in the direction of the jet, such an unusual temperature implies a bulk Lorentz factor of the jet of Γbulk ∼ 11.7. Bulk Comptonization is expected to be ubiquitous on physical grounds, yet no clear signature of it has been found so far, possibly due to its transient nature and the lack of high-quality, broad-band X-ray spectra.

  7. VizieR Online Data Catalog: Five years of blazar observations with VERITAS (Archambault+, 2016)

    Science.gov (United States)

    Archambault, S.; Archer, A.; Benbow, W.; Bird, R.; Biteau, J.; Buchovecky, M.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cerruti, M.; Chen, X.; Ciupik, L.; Connolly, M. P.; Cui, W.; Eisch, J. D.; Errando, M.; Falcone, A.; Feng, Q.; Finley, J. P.; Fleischhack, H.; Fortin, P.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Griffin, S.; Grube, J.; Gyuk, G.; Hutten, M.; Hakansson, N.; Hanna, D.; Holder, J.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kelley-Hoskins, N.; Kertzman, M.; Kieda, D.; Krause, M.; Krennrich, F.; Kumar, S.; Lang, M. J.; Maier, G.; McArthur, S.; McCann, A.; Meagher, K.; Moriarty, P.; Mukherjee, R.; Nguyen, T.; Nieto, D.; O'Faolain de Bhroithe, A.; Ong, R. A.; Otte, A. N.; Park, N.; Perkins, J. S.; Pichel, A.; Pohl, M.; Popkow, A.; Pueschel, E.; Quinn, J.; Ragan, K.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Rovero, A. C.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Smith, A. W.; Staszak, D.; Telezhinsky, I.; Tucci, J. V.; Tyler, J.; Vincent, S.; Wakely, S. P.; Weiner, O. M.; Weinstein, A.; Williams, D. A.; Zitzer, B.

    2018-04-01

    In this paper, we present the results of the analysis of most of the non-detected blazars observed by VERITAS from 2007 (the beginning of full-scale scientific operations) to 2012 August (before the upgrade of the VERITAS array, see Kieda 2013arXiv1308.4849D). The VERITAS (Very Energetic Radiation Imaging Telescope Array System) telescope array is composed of four IACTs of 12 m diameter each, located at the Fred Lawrence Whipple Observatory, on the slopes of Mount Hopkins, in southern Arizona (31°40'N, 110°57'W). Each telescope has a segmented mirror that focuses light onto a camera composed of 499 photomultipliers located at the focal plane. The instrument FOV is 3.5°. For further details on the VERITAS instrument, see Holder et al. (2006APh....25..391H) and Holder (2011ICRC...12..137H). The VERITAS observations here have an average length of 20 minutes (referred to as a run), before switching targets or wobble directions. (7 data files).

  8. CHARACTERISTICS OF GAMMA-RAY LOUD BLAZARS IN THE VLBA IMAGING AND POLARIMETRY SURVEY

    International Nuclear Information System (INIS)

    Linford, J. D.; Taylor, G. B.; Romani, R. W.; Healey, S. E.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.; Cotter, G.

    2011-01-01

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed as part of the VLBA Imaging and Polarimetry Survey. This large, flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. At lower flux levels, radio flux density does not directly correlate with γ-ray flux. We find that the LAT-detected BL Lac objects tend to be similar to the non-LAT BL Lac objects, but that the LAT-detected FSRQs are often significantly different from the non-LAT FSRQs. The differences between the γ-ray loud and quiet FSRQs can be explained by Doppler boosting; these objects appear to require larger Doppler factors than those of the BL Lac objects. It is possible that the γ-ray loud FSRQs are fundamentally different from the γ-ray quiet FSRQs. Strong polarization at the base of the jet appears to be a signature for γ-ray loud AGNs.

  9. Characteristics of Gamma-ray Loud Blazars in the VLBA Imaging and Polarimetry Survey

    Science.gov (United States)

    Linford, J. D.; Taylor, G. B.; Romani, R. W.; Healey, S. E.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.; Cotter, G.

    2011-01-01

    The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed as part of the VLBA Imaging and Polarimetry Survey. This large, flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. At lower flux levels, radio flux density does not directly correlate with γ-ray flux. We find that the LAT-detected BL Lac objects tend to be similar to the non-LAT BL Lac objects, but that the LAT-detected FSRQs are often significantly different from the non-LAT FSRQs. The differences between the γ-ray loud and quiet FSRQs can be explained by Doppler boosting; these objects appear to require larger Doppler factors than those of the BL Lac objects. It is possible that the γ-ray loud FSRQs are fundamentally different from the γ-ray quiet FSRQs. Strong polarization at the base of the jet appears to be a signature for γ-ray loud AGNs.

  10. Multiwavelength Picture of the Blazar S5 0716+714 during Its Brightest Outburst

    Directory of Open Access Journals (Sweden)

    Marina Manganaro

    2016-11-01

    Full Text Available S5 0716+714 is a well known BL Lac object, and one of the brightest and most active blazars. The discovery in the Very High Energy band (VHE, E > 100 GeV by MAGIC happened in 2008. In January 2015, the source went through the brightest optical state ever observed, triggering MAGIC follow-up and a VHE detection with ∼ 13 σ significance (ATel ♯ 6999 . Rich multiwavelength coverage of the flare allowed us to construct the broad-band spectral energy distribution of S5 0716+714 during its brightest outburst. In this work, we will present the preliminary analysis of MAGIC and Fermi-LAT data of the flaring activity in January and February 2015 for the HE (0.1 < HE < 300 GeV and VHE band, together with radio (Metsähovi, OVRO, VLBA, Effelsberg, sub-millimeter (SMA, optical (Tuorla, Perkins, Steward, AZT-8+ST7, LX-200, Kanata, X-ray and UV (Swift-XRT and UVOT, in the same time-window and discuss the time variability of the multiwavelength light curves during this impressive outburst.

  11. Multi-Frequency Blazar Micro-Variability as a Tool to Investigate Relativistic Jets

    Directory of Open Access Journals (Sweden)

    James R. Webb

    2016-08-01

    Full Text Available For the past 12 years we have been studying optical micro-variability of a sample of 15 Blazars. We summarize the results of this study and draw some basic conclusions about the characteristics of micro-variability. The intermittency, the stochastic nature, and the similar profile shapes seen in micro-variations at different times and in different objects have led us to a possible model to explain the observed micro-variations. The model is based on a strong shock propagating down a relativistic jet and encountering turbulence which causes density or magnetic field enhancements. We use the theory of Kirk, Reiger, and Mastichiadis (1998 to describe the pulse of synchrotron emission emanating from individual density enhancements energized by the shock. By fitting these “pulses” to micro-variability observations, we obtain excellent fits to actual micro-variations. The model predicts that the spectral index changes as a function of pulse duration. This effect should be observable in multi-frequency micro-variability data. We present the theoretical model, model fits of our micro-variability light curves, and preliminary multi-frequency micro-variability observations that support this model. A further test that has yet to be carried out involves observing polarization changes in different pulses.

  12. A New Statistical Approach to the Optical Spectral Variability in Blazars

    Directory of Open Access Journals (Sweden)

    Jose A. Acosta-Pulido

    2016-12-01

    Full Text Available We present a spectral variability study of a sample of about 25 bright blazars, based on optical spectroscopy. Observations cover the period from the end of 2008 to mid 2015, with an approximately monthly cadence. Emission lines have been identified and measured in the spectra, which permits us to classify the sources into BL Lac-type or FSRQs, according to the commonly used EW limit. We have obtained synthetic photometry and produced colour-magnitude diagrams which show different trends associated with the object classes: generally, BL Lacs tend to become bluer when brighter and FSRQs become redder when brighter, although several objects exhibit both trends, depending on brightness. We have also applied a pattern recognition algorithm to obtain the minimum number of physical components which can explain the variability of the optical spectrum. We have used NMF (Non-Negative Matrix Factorization instead of PCA (Principal Component Analysis to avoid un-realistic negative components. For most targets we found that 2 or 3 meta-components are enough to explain the observed spectral variability.

  13. SUZAKU OBSERVATIONS OF THE EXTREME MeV BLAZAR SWIFT J0746.3+2548

    International Nuclear Information System (INIS)

    Watanabe, Shin; Sato, Rie; Takahashi, Tadayuki; Edwards, Philip G.; Kataoka, Jun; Madejski, Greg; Romani, Roger; Sikora, Marek; Tavecchio, Fabrizio; Sambruna, Rita; Pursimo, Tapio

    2009-01-01

    We report the Suzaku observations of the high luminosity blazar SWIFT J0746.3+2548 (J0746) conducted in 2005 November. This object, which, with z = 2.979, is the highest redshift source observed in the Suzaku Guaranteed Time Observer period, is likely to show high gamma-ray flux peaking in the MeV range. As a result of the good photon statistics and high signal-to-noise ratio spectrum, the Suzaku observation clearly confirms that J0746 has an extremely hard spectrum in the energy range of 0.3-24 keV, which is well represented by a single power-law with a photon index of Γ ph ≅ 1.17 and Galactic absorption. The multiwavelength spectral energy distribution of J0746 shows two continuum components, and is well modeled assuming that the high-energy spectral component results from Comptonization of the broad-line region photons. In this paper, we search for the bulk Compton spectral features predicted to be produced in the soft X-ray band by scattering external optical/UV photons by cold electrons in a relativistic jet. We discuss and provide constraints on the pair content resulting from the apparent absence of such features.

  14. Optical Spectroscopic Observations of γ-Ray Blazar Candidates. III. The 2013/2014 Campaign in the Southern Hemisphere

    Science.gov (United States)

    Landoni, M.; Massaro, F.; Paggi, A.; D'Abrusco, R.; Milisavljevic, D.; Masetti, N.; Smith, H. A.; Tosti, G.; Chomiuk, L.; Strader, J.; Cheung, C. C.

    2015-05-01

    We report the results of our exploratory program carried out with the southern Astrophysical Research telescope aimed at associating counterparts and establishing the nature of the Fermi Unidentified γ-ray Sources (UGSs). We selected the optical counterparts of six UGSs from the Fermi catalog on the basis of our recently discovered tight connection between infrared and γ-ray emission found for the γ-ray blazars detected by the Wide-Field Infrared Survey Explorer in its all-sky survey. We perform for the first time a spectroscopic study of the low-energy counterparts of the Fermi UGSs, in the optical band, confirming the blazar-like nature of the whole sample. We also present new spectroscopic observations of six active galaxies of uncertain type associated with Fermi sources which appear to be BL Lac objects. Finally, we report the spectra collected for six known γ-ray blazars belonging to the Roma BZCAT that were obtained to establish their nature or better estimate their redshifts. Two interesting cases of high redshift and extremely luminous BL Lac objects (z ≥ 1.18 and z ≥ 1.02, based on the detection of Mg ii intervening systems) are also discussed. Based on observations obtained at the southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the U.S. National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).

  15. Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279

    Energy Technology Data Exchange (ETDEWEB)

    Dermer, Charles D. [Code 7653, Space Science Division, U.S. Naval Research Laboratory, Washington, DC 20375 (United States); Cerruti, Matteo [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Lott, Benoit [Centre d' Études Nucléaires Bordeaux Gradignan, Université de Bordeaux, CNRS/IN2P3, UMR 5797, F-33175 Gradignan (France); Boisson, Catherine; Zech, Andreas, E-mail: charles.dermer@nrl.navy.mil, E-mail: matteo.cerruti@cfa.harvard.edu [Laboratoire Univers et THeories (LUTH), Observatoire de Paris-Meudon, 5 Place Jules Janssen, F-92195 Meudon Cedex (France)

    2014-02-20

    Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ{sub D} or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ{sub D}, B', and the peak electron Lorentz factor γ{sub pk}{sup ′}. The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ{sub D} ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10{sup –2}-10{sup –3} erg cm{sup –3}, implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ{sup 2} ct {sub var} ∼ 0.1(Γ/30){sup 2}(t {sub var}/10{sup 4} s) pc from the black hole powering 3C 279's jets, where t {sub var} is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.

  16. POLARIMETRY AND THE HIGH-ENERGY EMISSION MECHANISMS IN QUASAR JETS: THE CASE OF PKS 1136-135

    Energy Technology Data Exchange (ETDEWEB)

    Cara, Mihai; Perlman, Eric S. [Department of Physics and Space Sciences, Florida Institute of Technology, 150 W. University Blvd., Melbourne, FL 32901 (United States); Uchiyama, Yasunobu [SLAC/KIPAC, Stanford University, 2575 Sand Hill Road, M/S 209, Menlo Park, CA 94025 (United States); Cheung, Chi C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States); Coppi, Paolo S. [Yale University, Department of Astronomy, P.O. Box 208101, New Haven, CT 06520-8101 (United States); Georganopoulos, Markos [Department of Physics, University of Maryland, Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Worrall, Diana M.; Birkinshaw, Mark [Department of Physics, University of Bristol, Bristol, BS8 1TL (United Kingdom); Sparks, William B. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Marshall, Herman L. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Stawarz, Lukasz [Institute of Space Astronautical Science, JAXA, 3-1-1 Yoshinodai, Chuo-Ku, Sagamihara, Kanagawa 252-5210 (Japan); Begelman, Mitchell C. [Department of Astrophysical and Planetary Sciences, UCB 391, University of Colorado, Boulder, CO 80309-0391 (United States); O' Dea, Christopher P. [Laboratory for Multiwavelength Astrophysics, School of Physics and Astronomy, Rochester Institute of Technology, 84 Lomb Memorial Dr., Rochester, NY 14623-5603 (United States); Baum, Stefi A. [Chester F. Carlson Center for Imaging Science, Rochester Institute of Technology, 54 Lomb Memorial Dr., Rochester, NY 14623-5604 (United States)

    2013-08-20

    Since the discovery of kiloparsec-scale X-ray emission from quasar jets, the physical processes responsible for their high-energy emission have been poorly defined. A number of mechanisms are under active debate, including synchrotron radiation, inverse-Comptonized cosmic microwave background (IC/CMB) emission, and other Comptonization processes. In a number of cases, the optical and X-ray emission of jet regions are inked by a single spectral component, and in those, high-resolution multi-band imaging and polarimetry can be combined to yield a powerful diagnostic of jet emission processes. Here we report on deep imaging photometry of the jet of PKS 1136-135 obtained with the Hubble Space Telescope. We find that several knots are highly polarized in the optical, with fractional polarization {Pi} > 30%. When combined with the broadband spectral shape observed in these regions, this is very difficult to explain via IC/CMB models, unless the scattering particles are at the lowest-energy tip of the electron energy distribution, with Lorentz factor {gamma} {approx} 1, and the jet is also very highly beamed ({delta} {>=} 20) and viewed within a few degrees of the line of sight. We discuss both the IC/CMB and synchrotron interpretation of the X-ray emission in the light of this new evidence, presenting new models of the spectral energy distribution and also the matter content of this jet. The high polarizations do not completely rule out the possibility of IC/CMB optical-to-X-ray emission in this jet, but they do strongly disfavor the model. We discuss the implications of this finding, and also the prospects for future work.

  17. POLARIMETRY AND THE HIGH-ENERGY EMISSION MECHANISMS IN QUASAR JETS: THE CASE OF PKS 1136–135

    International Nuclear Information System (INIS)

    Cara, Mihai; Perlman, Eric S.; Uchiyama, Yasunobu; Cheung, Chi C.; Coppi, Paolo S.; Georganopoulos, Markos; Worrall, Diana M.; Birkinshaw, Mark; Sparks, William B.; Marshall, Herman L.; Stawarz, Lukasz; Begelman, Mitchell C.; O'Dea, Christopher P.; Baum, Stefi A.

    2013-01-01

    Since the discovery of kiloparsec-scale X-ray emission from quasar jets, the physical processes responsible for their high-energy emission have been poorly defined. A number of mechanisms are under active debate, including synchrotron radiation, inverse-Comptonized cosmic microwave background (IC/CMB) emission, and other Comptonization processes. In a number of cases, the optical and X-ray emission of jet regions are inked by a single spectral component, and in those, high-resolution multi-band imaging and polarimetry can be combined to yield a powerful diagnostic of jet emission processes. Here we report on deep imaging photometry of the jet of PKS 1136–135 obtained with the Hubble Space Telescope. We find that several knots are highly polarized in the optical, with fractional polarization Π > 30%. When combined with the broadband spectral shape observed in these regions, this is very difficult to explain via IC/CMB models, unless the scattering particles are at the lowest-energy tip of the electron energy distribution, with Lorentz factor γ ∼ 1, and the jet is also very highly beamed (δ ≥ 20) and viewed within a few degrees of the line of sight. We discuss both the IC/CMB and synchrotron interpretation of the X-ray emission in the light of this new evidence, presenting new models of the spectral energy distribution and also the matter content of this jet. The high polarizations do not completely rule out the possibility of IC/CMB optical-to-X-ray emission in this jet, but they do strongly disfavor the model. We discuss the implications of this finding, and also the prospects for future work

  18. Possible Accretion Disk Origin of the Emission Variability of a Blazar Jet

    Science.gov (United States)

    Chatterjee, Ritaban; Roychowdhury, Agniva; Chandra, Sunil; Sinha, Atreyee

    2018-06-01

    We analyze X-ray light curves of the blazar Mrk 421 obtained from the Soft X-ray Imaging Telescope (SXT) and the Large Area X-ray Proportional Counter (LAXPC) instrument on board the Indian space telescope AstroSat and archival observations from Swift. We show that the X-ray power spectral density (PSD) is a piece-wise power-law with a break; i.e., the index becomes more negative below a characteristic “break timescale.” Galactic black hole (BH) X-ray binaries and Seyfert galaxies exhibit a similar characteristic timescale in their X-ray variability that is proportional to their respective BH mass. X-rays in these objects are produced in the accretion disk or corona. Hence, such a timescale is believed to be linked to the properties of the accretion flow. Any relation observed between events in the accretion disk and those in the jet can be used to characterize the disk–jet connection. However, evidence of such a link has been scarce and indirect. Mrk 421 is a BL Lac object that has a prominent jet pointed toward us and a weak disk emission, and it is assumed that most of its X-rays are generated in the jet. Hence, the existence of the break in its X-ray PSD may indicate that changes in the accretion disk, which may be the source of the break timescale, are translating into the jet where the X-rays are produced.

  19. Science with the ASTRI mini-array for the Cherenkov Telescope Array: blazars and fundamental physics

    Science.gov (United States)

    Bonnoli, Giacomo; Tavecchio, Fabrizio; Giuliani, Andrea; Bigongiari, Ciro; Di Pierro, Federico; Stamerra, Antonio; Pareschi, Giovanni; Vercellone, Stefano; ASTRI Collaboration; CTA Consortium

    2016-05-01

    ASTRI (“Astronomia a Specchi con Tecnologia Replicante Italiana”) is a flagship project of the Italian Ministry of Research (MIUR), devoted to the realization, operation and scientific validation of an end-to-end prototype for the Small Size Telescope (SST) envisaged to become part of the Cherenkov Telescope Array (CTA). The ASTRI SST-2M telescope prototype is characterized by a dual mirror, Schwarzschild-Couder optical design and a compact camera based on silicon photo-multipliers. It will be sensitive to multi-TeV very high energy (VHE) gamma rays up to 100 TeV, with a PSF ~ 6’ and a wide (9.6°) unaberrated optical field of view. Right after validation of the design in single-dish observations at the Serra La Nave site (Sicily, Italy) during 2015, the ASTRI collaboration will be able to start deployment, at the final CTA southern site, of the ASTRI mini-array, proposed to constitute the very first CTA precursor. Counting 9 ASTRI SST-2M telescopes, the ASTRI mini-array will overtake current IACT systems in differential sensitivity above 5 TeV, thus allowing unprecedented observations of known and predicted bright TeV emitters in this band, including some extragalactic sources such as extreme high-peaked BL Lacs with hard spectra. We exploited the ASTRI scientific simulator ASTRIsim in order to understand the feasibility of observations tackling blazar and cosmic ray physics, including discrimination of hadronic and leptonic scenarios for the VHE emission from BL Lac relativistic jets and indirect measurements of the intergalactic magnetic field and of the extragalactic background light. We selected favorable targets, outlining observation modes, exposure times, multi-wavelength coverage needed and the results expected. Moreover, the perspectives for observation of effects due to the existence of axion-like particles or to Lorentz invariance violations have been investigated.

  20. EXTERNAL COMPTON SCATTERING IN BLAZAR JETS AND THE LOCATION OF THE GAMMA-RAY EMITTING REGION

    Energy Technology Data Exchange (ETDEWEB)

    Finke, Justin D., E-mail: justin.finke@nrl.navy.mil [U.S. Naval Research Laboratory, Code 7653, 4555 Overlook Ave. SW, Washington, DC, 20375-5352 (United States)

    2016-10-20

    I study the location of the γ -ray emission in blazar jets by creating a Compton-scattering approximation that is valid for all anisotropic radiation fields in the Thomson through Klein–Nishina regimes, is highly accurate, and can speed up numerical calculations by up to a factor of ∼10. I apply this approximation to synchrotron self-Compton, external Compton scattering of photons from the accretion disk, broad line region (BLR), and dust torus. I use a stratified BLR model and include detailed Compton-scattering calculations of a spherical and flattened BLR. I create two dust torus models, one where the torus is an annulus and one where it is an extended disk. I present detailed calculations of the photoabsorption optical depth using my detailed BLR and dust torus models, including the full angle dependence. I apply these calculations to the emission from a relativistically moving blob traveling through these radiation fields. The ratio of γ -ray to optical flux produces a predictable pattern that could help locate the γ -ray emission region. I show that the bright flare from 3C 454.3 in 2010 November detected by the Fermi Large Area Telescope is unlikely to originate from a single blob inside the BLR. This is because it moves outside the BLR in a time shorter than the flare duration, although emission by multiple blobs inside the BLR is possible. Also, γ -rays are unlikely to originate from outside of the BLR, due to the scattering of photons from an extended dust torus, since the cooling timescale would be too long to explain the observed short variability.

  1. MOJAVE. XII. ACCELERATION AND COLLIMATION OF BLAZAR JETS ON PARSEC SCALES

    Energy Technology Data Exchange (ETDEWEB)

    Homan, D. C. [Department of Physics, Denison University, Granville, OH 43023 (United States); Lister, M. L.; Richards, J. L. [Department of Physics, Purdue University, 525 Northwestern Avenue, West Lafayette, IN 47907 (United States); Kovalev, Y. Y. [Astro Space Center of Lebedev Physical Institute, Profsoyuznaya 84/32, 117997 Moscow (Russian Federation); Pushkarev, A. B.; Savolainen, T.; Ros, E. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Kellermann, K. I., E-mail: homand@denison.edu [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States)

    2015-01-10

    We report on the acceleration properties of 329 features in 95 blazar jets from the MOJAVE Very Long Baseline Array program. Nearly half the features and three-quarters of the jets show significant changes in speed and/or direction. In general, apparent speed changes are distinctly larger than changes in direction, indicating that changes in the Lorentz factors of jet features dominate the observed speed changes rather than bends along the line of sight. Observed accelerations tend to increase the speed of features near the jet base, ≲ 10-20 pc projected, and decrease their speed at longer distances. The range of apparent speeds at a fixed distance in an individual jet can span a factor of a few, indicating that shock properties and geometry may influence the apparent motions; however, we suggest that the broad trend of jet features increasing their speed near the origin is due to an overall acceleration of the jet flow out to deprojected distances of the order of 10{sup 2} pc, beyond which the flow begins to decelerate or remains nearly constant in speed. We estimate intrinsic rates of change of the Lorentz factors in the galaxy frame of the order of Γ-dot /Γ≃10{sup −3} to 10{sup –2} yr{sup –1}, which can lead to total Lorentz factor changes of a factor of a few on the length scales observed here. Finally, we also find evidence for jet collimation at projected distances of ≲ 10 pc in the form of the non-radial motion and bending accelerations that tend to better align features with the inner jet.

  2. Optical flare observed in the flaring gamma-ray blazar CGRaBS J0809+5341 (87GB 080551.6+535010)

    Science.gov (United States)

    Pursimo, Tapio; Galindo-Guil, F. J.; Serrano, Pere Blay; Ojha, Roopesh

    2017-11-01

    We report optical photometry of the blazar CGRaBS J0809+5341 (87GB 080551.6+535010), obtained with the 2.56m Nordic Optical Telescope in La Palma, to look for any enhanced optical activity associated with a recent flare in the daily averaged gamma-ray flux (ATel#10905).

  3. Analisa Kadar Silika Pada Air Umpan Ketel Dan Air Boiler Dengan Alat Lovibond Di Pks PT. Perkebunan Nusantara IV Dolok Ilir

    OpenAIRE

    Simamora, Evi Novita F.

    2016-01-01

    Analysis was performed on a silica content of boiler feed water and boiler water at the PKS PT. PTPN IV Dolok Ilir. Samples taken from the boiler feed water tank heated while the boiler water sample taken from the heating pipes in the boiler drum. Silica content in the sample is determined by comparison with a reagent Ammonium molybdat, HCL 1: 1, and oxalic acid. The determinations were performed over a period of 18 to 27 February 2015. The results showed that the silica content of boiler fee...

  4. Effects of disrupting the polyketide synthase gene WdPKS1 in Wangiella [Exophiala] dermatitidis on melanin production and resistance to killing by antifungal compounds, enzymatic degradation, and extremes in temperature

    Directory of Open Access Journals (Sweden)

    Mandal Piyali

    2006-06-01

    Full Text Available Abstract Background Wangiella dermatitidis is a human pathogenic fungus that is an etiologic agent of phaeohyphomycosis. W. dermatitidis produces a black pigment that has been identified as a dihydroxynaphthalene melanin and the production of this pigment is associated with its virulence. Cell wall pigmentation in W. dermatitidis depends on the WdPKS1 gene, which encodes a polyketide synthase required for generating the key precursor for dihydroxynaphthalene melanin biosynthesis. Results We analyzed the effects of disrupting WdPKS1 on dihydroxynaphthalene melanin production and resistance to antifungal compounds. Transmission electron microscopy revealed that wdpks1Δ-1 yeast had thinner cell walls that lacked an electron-opaque layer compared to wild-type cells. However, digestion of the wdpks1Δ-1 yeast revealed small black particles that were consistent with a melanin-like compound, because they were acid-resistant, reacted with melanin-binding antibody, and demonstrated a free radical signature by electron spin resonance analysis. Despite lacking the WdPKS1 gene, the mutant yeast were capable of catalyzing the formation of melanin from L-3,4-dihyroxyphenylalanine. The wdpks1Δ-1 cells were significantly more susceptible to killing by voriconazole, amphotericin B, NP-1 [a microbicidal peptide], heat and cold, and lysing enzymes than the heavily melanized parental or complemented strains. Conclusion In summary, W. dermatitidis makes WdPKS-dependent and -independent melanins, and the WdPKS1-dependent deposition of melanin in the cell wall confers protection against antifungal agents and environmental stresses. The biological role of the WdPKS-independent melanin remains unclear.

  5. Infrared and optical polarimetry of the radio elliptical IC 5063 (PKS2048-57): discovery of a highly polarized non-thermal nucleus

    Energy Technology Data Exchange (ETDEWEB)

    Hough, J H; Brindle, C; Axon, D J; Bailey, J; Sparks, W B

    1987-02-15

    Two-aperture optical and near-infrared polarization and flux measurements of the radio elliptical galaxy IC 5063 are presented. Analysis of the polarized flux shows that the large infrared excess in the nucleus most likely arises from a steep-spectrum non-thermal source with a polarization of 17 per cent and near-infrared luminosity 6x10/sup 41/ erg s/sup -1/. This result suggests that IC5063 is closely related to the more luminous blazars. The origin of the polarization in the optical is, however, not clear.

  6. Infrared and optical polarimetry of the radio elliptical IC 5063 (PKS2048-57): discovery of a highly polarized non-thermal nucleus

    International Nuclear Information System (INIS)

    Hough, J.H.; Brindle, C.; Axon, D.J.; Bailey, J.; Sparks, W.B.

    1987-01-01

    Two-aperture optical and near-infrared polarization and flux measurements of the radio elliptical galaxy IC 5063 are presented. Analysis of the polarized flux shows that the large infrared excess in the nucleus most likely arises from a steep-spectrum non-thermal source with a polarization of 17 per cent and near-infrared luminosity 6x10 41 erg s -1 . This result suggests that IC5063 is closely related to the more luminous blazars. The origin of the polarization in the optical is, however, not clear. (author)

  7. NuSTAR DETECTION OF THE BLAZAR B2 1023+25 AT REDSHIFT 5.3

    Energy Technology Data Exchange (ETDEWEB)

    Sbarrato, T. [Dipartimento di Scienza e Alta Tecnologia, Università dell' Insubria, Via Valleggio 11, I-22100 Como (Italy); Tagliaferri, G.; Ghisellini, G. [INAF-Osservatorio Astronomico di Brera, via E. Bianchi 46, I-23807 Merate (Italy); Perri, M.; Puccetti, S.; Giommi, P. [ASI-Science Data Center, via Galileo Galilei, I-00044 Frascati (Italy); Baloković, M.; Harrison, F. A.; Hovatta, T. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Nardini, M. [Dipartimento di Fisica G. Occhialini, Università di Milano Bicocca, Piazza della Scienza 3, I-20126 Milano (Italy); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Boggs, S. E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Brandt, W. N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greiner, J.; Rau, A.; Schady, P.; Sudilovsky, V. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Madejski, G. M., E-mail: tullia.sbarrato@brera.inaf.it [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); and others

    2013-11-10

    B2 1023+25 is an extremely radio-loud quasar at z = 5.3 that was first identified as a likely high-redshift blazar candidate in the SDSS+FIRST quasar catalog. Here, we use the Nuclear Spectroscopic Telescope Array (NuSTAR) to investigate its non-thermal jet emission, whose high-energy component we detected in the hard X-ray energy band. The X-ray flux is ∼ 5.5 x 10{sup -14} erg cm{sup -2} s{sup -1} (5-10 keV) and the photon spectral index is Γ{sub X} ≅ 1.3-1.6. Modeling the full spectral energy distribution, we find that the jet is oriented close to the line of sight, with a viewing angle of ∼3°, and has significant Doppler boosting, with a large bulk Lorentz factor ∼13, which confirms the identification of B2 1023+25 as a blazar. B2 1023+25 is the first object at redshift larger than 5 detected by NuSTAR, demonstrating the ability of NuSTAR to investigate the early X-ray universe and to study extremely active supermassive black holes located at very high redshift.

  8. On the interaction of the PKS B1358–113 radio galaxy with the A1836 cluster

    Energy Technology Data Exchange (ETDEWEB)

    Stawarz, Ł.; Simionescu, A.; Hagino, K. [Institute of Space and Astronautical Science, JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Szostek, A.; Kozieł-Wierzbowska, D.; Ostrowski, M. [Astronomical Observatory, Jagiellonian University, ulica Orla 171, 30-244 Kraków (Poland); Cheung, C. C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States); Siemiginowska, A.; Harris, D. E. [Harvard Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Werner, N. [KIPAC, Stanford University, 452 Lomita Mall, Stanford, CA 94305 (United States); Madejski, G. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Begelman, M. C., E-mail: stawarz@astro.isas.jaxa.jp [JILA, University of Colorado and National Institute of Standards and Technology, 440 UCB, Boulder, CO 80309-0440 (United States)

    2014-10-20

    Here we present the analysis of multifrequency data gathered for the Fanaroff-Riley type-II (FR II) radio galaxy PKS B1358-113, hosted in the brightest cluster galaxy in the center of A1836. The galaxy harbors one of the most massive black holes known to date, and our analysis of the acquired optical data reveals that this black hole is only weakly active, with a mass accretion rate M-dot {sub acc}∼2×10{sup −4} M-dot {sub Edd}∼0.02 M{sub ⊙} yr{sup –1}. Based on analysis of new Chandra and XMM-Newton X-ray observations and archival radio data, and assuming the well-established model for the evolution of FR II radio galaxies, we derive the preferred range for the jet kinetic luminosity L {sub j} ∼ (1-6) × 10{sup –3} L {sub Edd} ∼ (0.5-3) × 10{sup 45} erg s{sup –1}. This is above the values implied by various scaling relations proposed for radio sources in galaxy clusters, being instead very close to the maximum jet power allowed for the given accretion rate. We also constrain the radio source lifetime as τ{sub j} ∼ 40-70 Myr, meaning the total amount of deposited jet energy E {sub tot} ∼ (2-8) × 10{sup 60} erg. We argue that approximately half of this energy goes into shock heating of the surrounding thermal gas, and the remaining 50% is deposited into the internal energy of the jet cavity. The detailed analysis of the X-ray data provides indication for the presence of a bow shock driven by the expanding radio lobes into the A1836 cluster environment. We derive the corresponding shock Mach number in the range M{sub sh}∼2--4, which is one of the highest claimed for clusters or groups of galaxies. This, together with the recently growing evidence that powerful FR II radio galaxies may not be uncommon in the centers of clusters at higher redshifts, supports the idea that jet-induced shock heating may indeed play an important role in shaping the properties of clusters, galaxy groups, and galaxies in formation. In this context, we speculate on

  9. Multi-epoch VLBA Imaging of 20 New TeV Blazars: Apparent Jet Speeds

    Science.gov (United States)

    Piner, B. Glenn; Edwards, Philip G.

    2018-01-01

    We present 88 multi-epoch Very Long Baseline Array (VLBA) images (most at an observing frequency of 8 GHz) of 20 TeV blazars, all of the high-frequency-peaked BL Lac (HBL) class, that have not been previously studied at multiple epochs on the parsec scale. From these 20 sources, we analyze the apparent speeds of 43 jet components that are all detected at four or more epochs. As has been found for other TeV HBLs, the apparent speeds of these components are relatively slow. About two-thirds of the components have an apparent speed that is consistent (within 2σ) with no motion, and some of these components may be stationary patterns whose apparent speed does not relate to the underlying bulk flow speed. In addition, a superluminal tail to the apparent speed distribution of the TeV HBLs is detected for the first time, with eight components in seven sources having a 2σ lower limit on the apparent speed exceeding 1c. We combine the data from these 20 sources with an additional 18 sources from the literature to analyze the complete apparent speed distribution of all 38 TeV HBLs that have been studied with very long baseline interferometry at multiple epochs. The highest 2σ apparent speed lower limit considering all sources is 3.6c. This suggests that bulk Lorentz factors of up to about 4, but probably not much higher, exist in the parsec-scale radio-emitting regions of these sources, consistent with estimates obtained in the radio by other means such as brightness temperatures. This can be reconciled with the high Lorentz factors estimated from the high-energy data if the jet has velocity structures consisting of different emission regions with different Lorentz factors. In particular, we analyze the current apparent speed data for the TeV HBLs in the context of a model with a fast central spine and a slower outer layer.

  10. Heterologous Gene Expression of N-Terminally Truncated Variants of LipPks1 Suggests a Functionally Critical Structural Motif in the N-terminus of Modular Polyketide Synthase

    DEFF Research Database (Denmark)

    Yuzawa, Satoshi; Bailey, Constance B.; Fujii, Tatsu A.

    2017-01-01

    Streptomyces-derived, Well-characterized modular, polyketide synthase (PKS). Using this enzyme as a model, we experimentally investigated the effects of alternative TSSs using a heterologous host, Streptomyces venezuelae. One of the TSSs employed boosted the protein level by 59-fold and the product yield by 23...

  11. 18–22 cm VLBA Observational Evidence for Toroidal B-Field Components in Six AGN Jets

    Directory of Open Access Journals (Sweden)

    Juliana Cristina Motter

    2016-08-01

    Full Text Available The formation of relativistic jets in Active Galactic Nuclei (AGN is related to accretion onto their central supermassive black holes, and magnetic (B fields are believed to play a central role in launching, collimating, and accelerating the jet streams from very compact regions out to kiloparsec scales. We present results of Faraday rotation studies based on Very Long Baseline Array (VLBA data obtained at 18–22 cm for six well known AGN (OJ 287, 3C 279, PKS 1510-089, 3C 345, BL Lac, and 3C 454.3, which probe projected distances out to tens of parsecs from the observed cores. We have identified statistically significant, monotonic, transverse Faraday rotation gradients across the jets of all but one of these sources, indicating the presence of toroidal B fields, which may be one component of helical B fields associated with these AGN jets.

  12. MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.; Buehler, R. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Ajello, M. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d’Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D.; Buson, S. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Becerra Gonzalez, J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Bellazzini, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bissaldi, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, I-70126 Bari (Italy); Bonino, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Bregeon, J. [Laboratoire Univers et Particules de Montpellier, Université Montpellier, CNRS/IN2P3, Montpellier (France); Bruel, P., E-mail: David.J.Thompson@nasa.gov, E-mail: sara.cutini@asdc.asi.it, E-mail: stefano.ciprini@asdc.asi.it, E-mail: stefan@astro.su.se, E-mail: stamerra@oato.inaf.it [Laboratoire Leprince-Ringuet, École polytechnique, CNRS/IN2P3, Palaiseau (France); and others

    2015-11-10

    We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity.

  13. MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113

    International Nuclear Information System (INIS)

    Ackermann, M.; Buehler, R.; Ajello, M.; Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A.; Atwood, W. B.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Buson, S.; Becerra Gonzalez, J.; Bellazzini, R.; Bissaldi, E.; Bonino, R.; Bregeon, J.; Bruel, P.

    2015-01-01

    We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity

  14. A Search for QPOs in the Blazar OJ287: Preliminary Results from the 2015/2016 Observing Campaign

    Directory of Open Access Journals (Sweden)

    S. Zola

    2016-10-01

    Full Text Available We analyse the light curve in the R band of the blazar OJ287, gathered during the 2015/2016 observing season. We did a search for quasi-periodic oscillations (QPOs using several methods over a wide range of timescales. No statistically significant periods were found in the high-frequency domain both in the ground-based data and in Kepler observations. In the longer-period domain, the Lomb–Scargle periodogram revealed several peaks above the 99% significance level. The longest one—about 95 days—corresponds to the innermost stable circular orbit (ISCO period of the more massive black hole. The 43-day period could be an alias, or it can be attributed to accretion in the form of a two-armed spiral wave.

  15. The polarization dependence of γγ absorption—implications for γ-ray bursts and blazars

    International Nuclear Information System (INIS)

    Böttcher, M.

    2014-01-01

    This paper presents an analysis of the dependence of the opacity for high-energy γ-rays to γγ absorption by low-energy photons on the polarization of the γ-ray and target photons. This process has so far only been considered using the polarization-averaged γγ absorption cross section. It is demonstrated that in the case of polarized γ-ray emission, subject to source-intrinsic γγ absorption by polarized target photons, this may lead to a slight overestimation of the γγ opacity by up to ∼10% in the case of a perfectly ordered magnetic field. Thus, for realistic astrophysical scenarios with partially ordered magnetic fields, the use of the polarization-averaged γγ cross section is justified for practical purposes, such as estimates of minimum Doppler factors inferred for γ-ray bursts and blazars, based on γγ transparency arguments; this paper quantifies the small error incurred by the unpolarized-radiation approximation. Furthermore, it is shown that polarization-dependent γγ absorption of initially polarized γ-rays can lead to a slight increase in the polarization beyond the spectral break caused by γγ absorption. This amount is distinctly different from the change in polarization expected if the same spectral break were produced by a break in the underlying electron distribution. This may serve as a diagnostic of whether γγ absorption is relevant in sources such as γ-ray bursts and blazars where the γ-ray emission may be intrinsically highly polarized.

  16. MULTIWAVELENGTH VARIABILITY OF THE BLAZARS Mrk 421 AND 3C 454.3 IN THE HIGH STATE

    Energy Technology Data Exchange (ETDEWEB)

    Gaur, Haritma; Gupta, Alok C. [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263129 (India); Wiita, Paul J., E-mail: haritma@aries.res.in [Department of Physics, College of New Jersey, P.O. Box 7718, Ewing, NJ 08628 (United States)

    2012-01-15

    We report the results of photometric observations of the blazars Mrk 421 and 3C 454.3 designed to search for intraday variability (IDV) and short-term variability (STV). Optical photometric observations were spread over 18 nights for Mrk 421 and 7 nights for 3C 454.3 during our observing run in 2009-2010 at the 1.04 m telescope at Aryabhatta Research Institute of Observational Sciences, India. Genuine IDV is found for the source 3C 454.3 but not for Mrk 421. Genuine STV is found for both sources. Mrk 421 was revealed by the Monitor of All-sky X-ray Image (MAXI) X-ray detector on the International Space Station to be in an exceptionally high flux state in 2010 January-February. We performed a correlation between the X-ray and optical bands to search for time delays and found a weak correlation with higher frequencies leading the lower frequencies by about 10 days. The blazar 3C 454.3 was found to be in a high flux state in 2009 November-December. We performed correlations in optical observations made at three telescopes, along with X-ray data from the MAXI camera and public release {gamma}-ray data from the Fermi space telescope. We found strong correlations between the {gamma}-ray and optical bands at a time lag of about four days, but the X-ray flux is not correlated with either. We briefly discuss the possible reasons for the time delays between these bands within the framework of existing models for X-ray and {gamma}-ray emission mechanisms.

  17. Multiwavelength Observations of the Blazar BL Lacertae: A New Fast TeV Gamma-Ray Flare

    Science.gov (United States)

    Abeysekara, A. U.; Benbow, W.; Bird, R.; Brantseg, T.; Brose, R.; Buchovecky, M.; Buckley, J. H.; Bugaev, V.; Connolly, M. P.; Cui, W.; Daniel, M. K.; Falcone, A.; Feng, Q.; Finley, J. P.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Gunawardhana, I.; Hütten, M.; Hanna, D.; Hervet, O.; Holder, J.; Hughes, G.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kertzman, M.; Krennrich, F.; Lang, M. J.; Lin, T. T. Y.; McArthur, S.; Moriarty, P.; Mukherjee, R.; O’Brien, S.; Ong, R. A.; Otte, A. N.; Park, N.; Petrashyk, A.; Pohl, M.; Pueschel, E.; Quinn, J.; Ragan, K.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Rulten, C.; Sadeh, I.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Wakely, S. P.; Weinstein, A.; Wells, R. M.; Wilcox, P.; Williams, D. A.; Zitzer, B.; The VERITAS Collaboration; Jorstad, S. G.; Marscher, A. P.; Lister, M. L.; Kovalev, Y. Y.; Pushkarev, A. B.; Savolainen, T.; Agudo, I.; Molina, S. N.; Gómez, J. L.; Larionov, V. M.; Borman, G. A.; Mokrushina, A. A.; Tornikoski, M.; Lähteenmäki, A.; Chamani, W.; Enestam, S.; Kiehlmann, S.; Hovatta, T.; Smith, P. S.; Pontrelli, P.

    2018-04-01

    Combined with measurements made by very-long-baseline interferometry, the observations of fast TeV gamma-ray flares probe the structure and emission mechanism of blazar jets. However, only a handful of such flares have been detected to date, and only within the last few years have these flares been observed from lower-frequency-peaked BL Lac objects and flat-spectrum radio quasars. We report on a fast TeV gamma-ray flare from the blazar BL Lacertae observed by the Very Energetic Radiation Imaging Telescope Array System (VERITAS). with a rise time of ∼2.3 hr and a decay time of ∼36 min. The peak flux above 200 GeV is (4.2 ± 0.6) × 10‑6 photon m‑2 s‑1 measured with a 4-minute-binned light curve, corresponding to ∼180% of the flux that is observed from the Crab Nebula above the same energy threshold. Variability contemporaneous with the TeV gamma-ray flare was observed in GeV gamma-ray, X-ray, and optical flux, as well as in optical and radio polarization. Additionally, a possible moving emission feature with superluminal apparent velocity was identified in Very Long Baseline Array observations at 43 GHz, potentially passing the radio core of the jet around the time of the gamma-ray flare. We discuss the constraints on the size, Lorentz factor, and location of the emitting region of the flare, and the interpretations with several theoretical models that invoke relativistic plasma passing stationary shocks.

  18. Multiwaveband Variability of Blazars from Turbulent Plasma Passing through a Standing Shock: The Mother of Multi-zone Models

    Science.gov (United States)

    Marscher, Alan P.

    2011-09-01

    Multi-wavelength light curves of bright gamma-ray blazars (e.g., 3C 454.3) are compared with the model proposed by Marscher and Jorstad. In this scenario, much of the optical and high-energy radiation in a blazar is emitted near the 43 GHz core of the jet as seen in VLBA images, parsecs from the central engine. The main physical features are a turbulent ambient jet plasma that passes through a standing recollimation shock in the jet. The model allows for short time-scales of optical and gamma-ray variability by restricting the highest-energy electrons radiating at these frequencies to a small fraction of the turbulent cells, perhaps those with a particular orientation of the magnetic field relative to the shock front. Because of this, the volume filling factor at high frequencies is relatively low, while that of the electrons radiating below about 10 THz is near unity. Such a model is consistent with the (1) red-noise power spectra of flux variations, (2) shorter time-scales of variability at higher frequencies, (3) frequency dependence of polarization and its variability, and (4) breaks in the synchrotron spectrum by more than the radiative loss value of 0.5. Simulated light curves are generated by a numerical code that (as of May 2011) includes synchrotron radiation as well as inverse Compton scattering of seed photons from both a dust torus and a Mach disk at the jet axis. The latter source of seed photons produces more pronounced variability in gamma-ray than in optical light curves, as is often observed. More features are expected to be added to the code by the time of the presentation. This research is supported in part by NASA through Fermi grants NNX08AV65G and NNX10AO59G, and by NSF grant AST-0907893.

  19. Analysis of the correlation between γ-ray and radio emissions from γ-ray loud Blazar using the discrete correlation function

    International Nuclear Information System (INIS)

    Cheng Yong; Zhang Xiong; Wu Lin; Mao Weiming; You Lisha

    2006-01-01

    The authors collect 119 γ-ray-loud Blazar (97 flat spectrum radio quasars (FSRQs) and 22 BL Lacertae objects (BL Lac)), and investigate respectively the correlation between the γ-ray emission (maximum, minimum, and average data) at 1 GeV and the radio emission at 8.4 GHz by discrete correlation function (DCF) method. Our main results are as follows: there is good correlation between the γ-ray in high state and average state and radio emissions for the whole 119 Blazar and 97 FSRQs. And there are no correlation between γ-ray emission and radio emission in low state. Our result shows that the γ-rays are associated with the radio emission from the jet, and that the γ-ray emission is likely to have come from the synchrotron self-compton model (SSC) process in this case. (authors)

  20. THE COSMOLOGICAL IMPACT OF LUMINOUS TeV BLAZARS. I. IMPLICATIONS OF PLASMA INSTABILITIES FOR THE INTERGALACTIC MAGNETIC FIELD AND EXTRAGALACTIC GAMMA-RAY BACKGROUND

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Avery E; Chang, Philip; Pfrommer, Christoph [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada)

    2012-06-10

    Inverse Compton cascades (ICCs) initiated by energetic gamma rays (E {approx}> 100 GeV) enhance the GeV emission from bright, extragalactic TeV sources. The absence of this emission from bright TeV blazars has been used to constrain the intergalactic magnetic field (IGMF), and the stringent limits placed on the unresolved extragalactic gamma-ray background (EGRB) by Fermi have been used to argue against a large number of such objects at high redshifts. However, these are predicated on the assumption that inverse Compton scattering is the primary energy-loss mechanism for the ultrarelativistic pairs produced by the annihilation of the energetic gamma rays on extragalactic background light photons. Here, we show that for sufficiently bright TeV sources (isotropic-equivalent luminosities {approx}> 10{sup 42} erg s{sup -1}) plasma beam instabilities, specifically the 'oblique' instability, present a plausible mechanism by which the energy of these pairs can be dissipated locally, heating the intergalactic medium. Since these instabilities typically grow on timescales short in comparison to the inverse Compton cooling rate, they necessarily suppress the ICCs. As a consequence, this places a severe constraint on efforts to limit the IGMF from the lack of a discernible GeV bump in TeV sources. Similarly, it considerably weakens the Fermi limits on the evolution of blazar populations. Specifically, we construct a TeV-blazar luminosity function from those objects currently observed and find that it is very well described by the quasar luminosity function at z {approx} 0.1, shifted to lower luminosities and number densities, suggesting that both classes of sources are regulated by similar processes. Extending this relationship to higher redshifts, we show that the magnitude and shape of the EGRB above {approx}10 GeV are naturally reproduced with this particular example of a rapidly evolving TeV-blazar luminosity function.

  1. Search for muon-neutrino emission from GeV and TeV gamma-ray flaring blazars using five years of data of the ANTARES telescope

    OpenAIRE

    Adrián-Martínez, S.; Albert, A.; André, M.; Anton, G.; Ardid, M.; Aubert, J. -J.; Baret, B.; Barrios-Martí, J.; Basa, S.; Bertin, V.; Biagi, S.; Bogazzi, C.; Bormuth, R.; Bou-Cabo, M.; Bouwhuis, M. C.

    2015-01-01

    The ANTARES telescope is well-suited for detecting astrophysical transient neutrino sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. The background due to atmospheric particles can be drastically reduced, and the point-source sensitivity improved, by selecting a narrow time window around possible neutrino production periods. Blazars, being radio-loud active galactic nuclei with their jets pointing almost directly towards the observer, ...

  2. Search for a narrow baryonic state decaying to pKS0 and p‾KS0 in deep inelastic scattering at HERA

    Directory of Open Access Journals (Sweden)

    H. Abramowicz

    2016-08-01

    Full Text Available A search for a narrow baryonic state in the pKS0 and p‾KS0 system has been performed in ep collisions at HERA with the ZEUS detector using an integrated luminosity of 358pb−1 taken in 2003–2007. The search was performed with deep inelastic scattering events at an ep centre-of-mass energy of 318GeV for exchanged photon virtuality, Q2, between 20 and 100GeV2. Contrary to evidence presented for such a state around 1.52 GeV in a previous ZEUS analysis using a sample of 121 pb−1 taken in 1996–2000, no resonance peak was found in the p(p‾KS0 invariant-mass distribution in the range 1.45–1.7 GeV. Upper limits on the production cross section are set.

  3. Search for muon-neutrino emission from GeV and TeV gamma-ray flaring blazars using five years of data of the ANTARES telescope

    Energy Technology Data Exchange (ETDEWEB)

    Collaboration: ANTARES Collaboration

    2015-12-01

    The ANTARES telescope is well-suited for detecting astrophysical transient neutrino sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. The background due to atmospheric particles can be drastically reduced, and the point-source sensitivity improved, by selecting a narrow time window around possible neutrino production periods. Blazars, being radio-loud active galactic nuclei with their jets pointing almost directly towards the observer, are particularly attractive potential neutrino point sources, since they are among the most likely sources of the very high-energy cosmic rays. Neutrinos and gamma rays may be produced in hadronic interactions with the surrounding medium. Moreover, blazars generally show high time variability in their light curves at different wavelengths and on various time scales. This paper presents a time-dependent analysis applied to a selection of flaring gamma-ray blazars observed by the FERMI/LAT experiment and by TeV Cherenkov telescopes using five years of ANTARES data taken from 2008 to 2012. The results are compatible with fluctuations of the background. Upper limits on the neutrino fluence have been produced and compared to the measured gamma-ray spectral energy distribution.

  4. UNVEILING THE NATURE OF THE UNIDENTIFIED GAMMA-RAY SOURCES. III. GAMMA-RAY BLAZAR-LIKE COUNTERPARTS AT LOW RADIO FREQUENCIES

    Energy Technology Data Exchange (ETDEWEB)

    Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Tosti, G. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Nori, M. [Department of Physics and Astronomy, University of Bologna, viale Berti Pichat 6/2, I-40127 Bologna (Italy)

    2013-07-01

    About one-third of the {gamma}-ray sources listed in the second Fermi Large Area Telescope catalog (2FGL) have no firmly established counterpart at lower energies and so are classified as unidentified gamma-ray sources (UGSs). Here, we propose a new approach to find candidate counterparts for the UGSs based on the 325 MHz radio survey performed with the Westerbork Synthesis Radio Telescope in the northern hemisphere. First, we investigate the low-frequency radio properties of blazars, the largest known population of {gamma}-ray sources; then we search for sources with similar radio properties combining the information derived from the Westerbork Northern Sky Survey (WENSS) with those of the NRAO Very Large Array Sky Survey. We present a list of candidate counterparts for 32 UGSs with at least one counterpart in the WENSS. We also performed an extensive research in the literature to look for infrared and optical counterparts of the {gamma}-ray blazar candidates selected using the low-frequency radio observations to confirm their nature. On the basis of our multifrequency research, we identify 23 new {gamma}-ray blazar candidates out of the 32 UGSs investigated. Comparison with previous results on the UGSs is also presented. Finally, we speculate on the advantages of using low-frequency radio observations to associate UGSs and to search for {gamma}-ray pulsar candidates.

  5. Long-Term Multi-Band and Polarimetric View of Mkn 421: Motivations for an Integrated Open-Data Platform for Blazar Optical Polarimetry

    Directory of Open Access Journals (Sweden)

    Ulisses Barres de Almeida

    2017-11-01

    Full Text Available In this work, by making use of the large software and database resources made available through online facilities such as the ASI Science Data Center (ASDC, we present a novel approach to the modelling of blazar emission whereby the multi-epoch SED for Mkn 421 is modelled considering, in a self-consistent way, the temporal lags between bands (both in short and long-timescales. These are obtained via a detailed cross-correlation analysis, spanning data from radio to VHE gamma-rays from 2008 to 2015. In addition to that, long-term optical polarisation data is used to aid and complement our physical interpretation of the state and evolution of the source. Blazar studies constitute a clear example that astrophysics is becoming increasingly dominated by “big data”. Specific questions, such as the interpretation of polarimetric information—namely the evolution of the polarisation degree (PD and specially the polarisation angle (PA of a source—are very sensitive to the density of data coverage. Improving data accessibility and integration, in order to respond to these necessities, is thus extremely important and has a potentially large impact for blazar science. For this reason, we present also the project to create an open-access database for optical polarimetry, aiming to circumvent the issues raised above, by integrating long-term optical polarisation information on a number sources from several observatories and data providers in a consistent way. The platform, to be launched by the end of 2017 is built as part of the Brazilian Science Data Center (BSDC, a project hosted at CBPF, in Rio de Janeiro, and developed with the support of the Italian Space Agency (ASI and ICRANet. The BSDC is Virtual Observatory-compliant and is built in line with “Open Universe”, a global space science open-data initiative to be launched in November under the auspices of the United Nations.

  6. MULTIFREQUENCY PHOTO-POLARIMETRIC WEBT OBSERVATION CAMPAIGN ON THE BLAZAR S5 0716+714: SOURCE MICROVARIABILITY AND SEARCH FOR CHARACTERISTIC TIMESCALES

    Energy Technology Data Exchange (ETDEWEB)

    Bhatta, G.; Stawarz, Ł.; Ostrowski, M. [Astronomical Observatory of Jagiellonian University, ul. Orla 171, 30-244 Krakow (Poland); Markowitz, A. [Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0424 (United States); Akitaya, H. [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Arkharov, A. A. [Main (Pulkovo) Astronomical Observatory of RAS, Pulkovskoye shosse, 60, 196140 St. Petersburg (Russian Federation); Bachev, R. [Institute of Astronomy, Bulgarian Academy of Sciences, 72, Tsarigradsko Shosse Blvd., 1784 Sofia (Bulgaria); Benítez, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Mexico DF (Mexico); Borman, G. A. [Crimean Astrophysical Observatory, P/O Nauchny, Crimea, 298409 (Russian Federation); Carosati, D. [EPT Observatories, Tijarafe, La Palma (Spain); Cason, A. D. [Private address, 105 Glen Pine Trail, Dawnsonville, GA 30534 (United States); Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Damljanovic, G. [Astronomical Observatory, Volgina 7, 11060 Belgrade (Serbia); Dhalla, S. [Florida International University, Miami, FL 33199 (United States); Frasca, A. [INAF—Osservatorio Astrofisico di Catania (Italy); Hiriart, D. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ensenada (Mexico); Hu, S-M., E-mail: gopalbhatta716@gmail.com [Shandong Provincial Key Laboratory of Optical Astronomy and Solar-Terrestrial Environment, Institute of Space Sciences, Shandong University at Weihai, 264209 Weihai (China); and others

    2016-11-01

    Here we report on the results of the Whole Earth Blazar Telescope photo-polarimetric campaign targeting the blazar S5 0716+71, organized in 2014 March to monitor the source simultaneously in BVRI and near-IR filters. The campaign resulted in an unprecedented data set spanning ∼110 hr of nearly continuous, multiband observations, including two sets of densely sampled polarimetric data mainly in the R filter. During the campaign, the source displayed pronounced variability with peak-to-peak variations of about 30% and “bluer-when-brighter” spectral evolution, consisting of a day-timescale modulation with superimposed hour-long microflares characterized by ∼0.1 mag flux changes. We performed an in-depth search for quasi-periodicities in the source light curve; hints for the presence of oscillations on timescales of ∼3 and ∼5 hr do not represent highly significant departures from a pure red-noise power spectrum. We observed that, at a certain configuration of the optical polarization angle (PA) relative to the PA of the innermost radio jet in the source, changes in the polarization degree (PD) led the total flux variability by about 2 hr; meanwhile, when the relative configuration of the polarization and jet angles altered, no such lag could be noted. The microflaring events, when analyzed as separate pulse emission components, were found to be characterized by a very high PD (>30%) and PAs that differed substantially from the PA of the underlying background component, or from the radio jet positional angle. We discuss the results in the general context of blazar emission and energy dissipation models.

  7. MULTIFREQUENCY PHOTO-POLARIMETRIC WEBT OBSERVATION CAMPAIGN ON THE BLAZAR S5 0716+714: SOURCE MICROVARIABILITY AND SEARCH FOR CHARACTERISTIC TIMESCALES

    International Nuclear Information System (INIS)

    Bhatta, G.; Stawarz, Ł.; Ostrowski, M.; Markowitz, A.; Akitaya, H.; Arkharov, A. A.; Bachev, R.; Benítez, E.; Borman, G. A.; Carosati, D.; Cason, A. D.; Chanishvili, R.; Damljanovic, G.; Dhalla, S.; Frasca, A.; Hiriart, D.; Hu, S-M.

    2016-01-01

    Here we report on the results of the Whole Earth Blazar Telescope photo-polarimetric campaign targeting the blazar S5 0716+71, organized in 2014 March to monitor the source simultaneously in BVRI and near-IR filters. The campaign resulted in an unprecedented data set spanning ∼110 hr of nearly continuous, multiband observations, including two sets of densely sampled polarimetric data mainly in the R filter. During the campaign, the source displayed pronounced variability with peak-to-peak variations of about 30% and “bluer-when-brighter” spectral evolution, consisting of a day-timescale modulation with superimposed hour-long microflares characterized by ∼0.1 mag flux changes. We performed an in-depth search for quasi-periodicities in the source light curve; hints for the presence of oscillations on timescales of ∼3 and ∼5 hr do not represent highly significant departures from a pure red-noise power spectrum. We observed that, at a certain configuration of the optical polarization angle (PA) relative to the PA of the innermost radio jet in the source, changes in the polarization degree (PD) led the total flux variability by about 2 hr; meanwhile, when the relative configuration of the polarization and jet angles altered, no such lag could be noted. The microflaring events, when analyzed as separate pulse emission components, were found to be characterized by a very high PD (>30%) and PAs that differed substantially from the PA of the underlying background component, or from the radio jet positional angle. We discuss the results in the general context of blazar emission and energy dissipation models.

  8. New ALMA and Fermi /LAT Observations of the Large-scale Jet of PKS 0637−752 Strengthen the Case Against the IC/CMB Model

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Eileen T.; Breiding, Peter; Georganopoulos, Markos [University of Maryland, Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Oteo, Iván; Ivison, R. J. [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Zwaan, Martin A.; Laing, Robert [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching-bei-München (Germany); Godfrey, Leith, E-mail: meyer@umbc.edu [ASTRON, the Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA Dwingeloo (Netherlands)

    2017-02-01

    The Chandra X-ray observatory has discovered several dozen anomalously X-ray-bright jets associated with powerful quasars. A popular explanation for the X-ray flux from the knots in these jets is that relativistic synchrotron-emitting electrons inverse-Compton scatter cosmic microwave background (CMB) photons to X-ray energies (the IC/CMB model). This model predicts a high gamma-ray flux that should be detectable by the Fermi /Large Area Telescope (LAT) for many sources. GeV-band upper limits from Fermi /LAT for the well-known anomalous X-ray jet in PKS 0637−752 were previously shown in Meyer et al. to violate the predictions of the IC/CMB model. Previously, measurements of the jet synchrotron spectrum, important for accurately predicting the gamma-ray flux level, were lacking between radio and infrared wavelengths. Here, we present new Atacama Large Millimeter/submillimeter Array (ALMA) observations of the large-scale jet at 100, 233, and 319 GHz, which further constrain the synchrotron spectrum, supporting the previously published empirical model. We also present updated limits from the Fermi /LAT using the new “Pass 8” calibration and approximately 30% more time on source. With these deeper limits, we rule out the IC/CMB model at the 8.7 σ level. Finally, we demonstrate that complete knowledge of the synchrotron SED is critical in evaluating the IC/CMB model.

  9. X-ray variability of the BL Lacertae object PKS 2155 - 304 in the 0.1-6 keV range

    International Nuclear Information System (INIS)

    Morini, M.; Chiappetti, L.; Maccagni, D.; Maraschi, L.; Molteni, D.; CNR, Istituto di Fisica Cosmica, Milan, Italy; CNR, Istituto di Fisica Cosmica; Milano Universita, Italy; Palermo Universita, Italy)

    1986-01-01

    Observations of the bright BL Lac object PKS 2155 - 304 obtained at 1-6 keV using the ME argon counters and channel-multiplier array at the focus of the Exosat LE telescope, in conjunction with the 0.05-2-keV-bandpass 3000-A Lexan filter, during a total of 30 h in October-November 1983 and November 1984 are reported. The data are presented in tables and graphs and characterized. Findings discussed include an overall variation of a factor of 10, one factor-of-four increase over 4 h, and maximum luminosity variation dL/dt = 2 x 10 to the 42nd erg/s sq for H = 100 km/s Mpc (corresponding to a lower limit of mass of 10 to the 8th solar mass and a gravitational radius of 3 x 10 to the 13th cm). The implications of these results for theoretical models of the X-ray emission source are considered. 17 references

  10. THE COSMOLOGICAL IMPACT OF LUMINOUS TeV BLAZARS. III. IMPLICATIONS FOR GALAXY CLUSTERS AND THE FORMATION OF DWARF GALAXIES

    International Nuclear Information System (INIS)

    Pfrommer, Christoph; Chang, Philip; Broderick, Avery E.

    2012-01-01

    A subset of blazars are powerful TeV emitters, dominating the extragalactic component of the very high energy gamma-ray universe (E ∼> 100 GeV). These TeV gamma rays generate ultrarelativistic electron-positron pairs via pair production with the extragalactic background light. While it has generally been assumed that the kinetic energy of these pairs cascades to GeV gamma rays via inverse Compton scattering, we have argued in Broderick et al. (Paper I in this series) that plasma beam instabilities are capable of dissipating the pairs' energy locally on timescales short in comparison to the inverse Compton cooling time, heating the intergalactic medium (IGM) with a rate that is independent of density. This dramatically increases the entropy of the IGM after redshift z ∼ 2, with a number of important implications for structure formation: (1) this suggests a scenario for the origin of the cool core (CC)/non-cool core (NCC) bimodality in galaxy clusters and groups. Early-forming galaxy groups are unaffected because they can efficiently radiate the additional entropy, developing a CC. However, late-forming groups do not have sufficient time to cool before the entropy is gravitationally reprocessed through successive mergers—counteracting cooling and potentially raising the core entropy further. This may result in a population of X-ray dim groups/clusters, consistent with X-ray stacking analyses of optically selected samples. Hence, blazar heating works differently than feedback by active galactic nuclei, which we show can balance radiative cooling but is unable to transform CC into NCC clusters on the buoyancy timescale due to the weak coupling between the mechanical energy to the cluster gas. (2) We predict a suppression of the Sunyaev-Zel'dovich (SZ) power spectrum template on angular scales smaller than 5' due to the globally reduced central pressure of groups and clusters forming after z ∼ 1. This allows for a larger rms amplitude of the density power

  11. Rapid variability of blazar 3C 279 during flaring states in 2013-2014 with joint FERMI-LAT, NuSTAR, swift, and ground-based multi-wavelength observations

    DEFF Research Database (Denmark)

    Hayashida, M.; Nalewajko, K.; Madejski, G. M.

    2015-01-01

    We report the results of a multiband observing campaign on the famous blazar 3C 279 conducted during a phase of increased activity from 2013 December to 2014 April, including first observations of it with NuSTAR. The γ-ray emission of the source measured by Fermi-LAT showed multiple distinct flar...

  12. VERY HIGH ENERGY γ-RAYS FROM THE UNIVERSE’S MIDDLE AGE: DETECTION OF THE z = 0.940 BLAZAR PKS 1441+25 WITH MAGIC

    Energy Technology Data Exchange (ETDEWEB)

    Ahnen, M. L.; Biland, A. [ETH Zurich, CH-8093 Zurich (Switzerland); Ansoldi, S.; Biasuzzi, B. [Università di Udine, and INFN Trieste, I-33100 Udine (Italy); Antonelli, L. A.; Bonnoli, G.; Carosi, A. [INAF National Institute for Astrophysics, I-00136 Rome (Italy); Antoranz, P. [Università di Siena, and INFN Pisa, I-53100 Siena (Italy); Babic, A. [Croatian MAGIC Consortium, Rudjer Boskovic Institute, University of Rijeka, University of Split and University of Zagreb (Croatia); Banerjee, B. [Saha Institute of Nuclear Physics, 1\\AF Bidhannagar, Salt Lake, Sector-1, Kolkata 700064 (India); Bangale, P.; Almeida, U. Barres de; Borracci, F. [Max-Planck-Institut für Physik, D-80805 München (Germany); Barrio, J. A.; Bonnefoy, S. [Universidad Complutense, E-28040 Madrid (Spain); Bednarek, W. [University of Łódź, PL-90236 Lodz (Poland); Bernardini, E. [Deutsches Elektronen-Synchrotron (DESY), D-15738 Zeuthen (Germany); Blanch, O. [IFAE, Campus UAB, E-08193 Bellaterra (Spain); Bretz, T. [Universität Würzburg, D-97074 Würzburg (Germany); Carmona, E., E-mail: fabrizio.tavecchio@brera.inaf.it, E-mail: miguelnievas@ucm.es, E-mail: manganaro@iac.es, E-mail: josefa.becerra@nasa.gov [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Collaboration: MAGIC Collaboration; Fermi-LAT Collaboration; and others

    2015-12-20

    The flat-spectrum radio quasar PKS 1441+25 at a redshift of z = 0.940 is detected between 40 and 250 GeV with a significance of 25.5σ using the MAGIC telescopes. Together with the gravitationally lensed blazar QSO B0218+357 (z = 0.944), PKS 1441+25 is the most distant very high energy (VHE) blazar detected to date. The observations were triggered by an outburst in 2015 April seen at GeV energies with the Large Area Telescope on board Fermi. Multi-wavelength observations suggest a subdivision of the high state into two distinct flux states. In the band covered by MAGIC, the variability timescale is estimated to be 6.4 ± 1.9 days. Modeling the broadband spectral energy distribution with an external Compton model, the location of the emitting region is understood as originating in the jet outside the broad-line region (BLR) during the period of high activity, while being partially within the BLR during the period of low (typical) activity. The observed VHE spectrum during the highest activity is used to probe the extragalactic background light at an unprecedented distance scale for ground-based gamma-ray astronomy.

  13. ROLE OF LINE-OF-SIGHT COSMIC-RAY INTERACTIONS IN FORMING THE SPECTRA OF DISTANT BLAZARS IN TeV GAMMA RAYS AND HIGH-ENERGY NEUTRINOS

    International Nuclear Information System (INIS)

    Essey, Warren; Kusenko, Alexander; Kalashev, Oleg; Beacom, John F.

    2011-01-01

    Active galactic nuclei (AGNs) can produce both gamma rays and cosmic rays. The observed high-energy gamma-ray signals from distant blazars may be dominated by secondary gamma rays produced along the line of sight by the interactions of cosmic-ray protons with background photons. This explains the surprisingly low attenuation observed for distant blazars, because the production of secondary gamma rays occurs, on average, much closer to Earth than the distance to the source. Thus, the observed spectrum in the TeV range does not depend on the intrinsic gamma-ray spectrum, while it depends on the output of the source in cosmic rays. We apply this hypothesis to a number of sources and, in every case, we obtain an excellent fit, strengthening the interpretation of the observed spectra as being due to secondary gamma rays. We explore the ramifications of this interpretation for limits on the extragalactic background light and for the production of cosmic rays in AGNs. We also make predictions for the neutrino signals, which can help probe the acceleration of cosmic rays in AGNs.

  14. The Connection between the Radio Jet and the γ-ray Emission in the Radio Galaxy 3C 120 and the Blazar CTA 102

    Directory of Open Access Journals (Sweden)

    Carolina Casadio

    2016-09-01

    Full Text Available We present multi-wavelength studies of the radio galaxy 3C 120 and the blazar CTA 102 during unprecedented γ-ray flares for both sources. In both studies the analysis of γ-ray data has been compared with a series of 43 GHz VLBA images from the VLBA-BU-BLAZAR program, providing the necessary spatial resolution to probe the parsec scale jet evolution during the high energy events. To extend the radio dataset for 3C 120 we also used 15 GHz VLBA data from the MOJAVE sample. These two objects which represent very different classes of AGN, have similar properties during the γ-ray events. The γ-ray flares are associated with the passage of a new superluminal component through the mm VLBI core, but not all ejections of new components lead to γ-ray events. In both sources γ-ray events occurred only when the new components are moving in a direction closer to our line of sight. We locate the γ-ray dissipation zone a short distance from the radio core but outside of the broad line region, suggesting synchrotron self-Compton scattering as the probable mechanism for the γ-ray production.

  15. Suzaku View of the Swift/BAT Active Galactic Nuclei. V. Torus Structure of Two Luminous Radio-Loud Active Galactic Nuclei (3C 206 and PKS 0707-35)

    Science.gov (United States)

    Tazaki, Fumie; Ueda, Yoshihiro; Terashima, Yuichi; Mushotzky, Richard F.; Tombesi, Francesco

    2013-01-01

    We present the results from broadband X-ray spectral analysis of 3C 206 and PKS 0707-35 with Suzaku and Swift/BAT, two of the most luminous unobscured and obscured radio-loud active galactic nuclei (AGNs) with hard X-ray luminosities of 10(sup 45.5) erg per second and 10(sup 44.9) erg per second (14-195 keV), respectively. Based on the radio core luminosity, we estimate that the X-ray spectrum of 3C 206 contains a significant (60% in the 14-195 keV band) contribution from the jet, while it is negligible in PKS 0707-35.We can successfully model the spectra with the jet component (for 3C 206), the transmitted emission, and two reflection components from the torus and the accretion disk. The reflection strengths from the torus are found to be R(sub torus)(=Omega/2pi) = 0.29 +/- 0.18 and 0.41 +/- 0.18 for 3C 206 and PKS 0707-35, respectively, which are smaller than those in typical Seyfert galaxies. Utilizing the torus model by Ikeda et al., we quantify the relation between the half-opening angle of a torus (theta(sub oa)) and the equivalent width of an iron-K line. The observed equivalent width of 3C 206, less than 71 eV, constrains the column density in the equatorial plane to N(sup eq)(sub H) lesst han 10(sup 23) per square centimeter, or the half-opening angle to theta(sub oa) greater than 80 deg. if N(sup eq)(sub H) = 10(sup 24) per square centimeter is assumed. That of PKS 0707-35, 72 +/- 36 eV, is consistent with N(sup eq)(sub H) 10(sup 23) per square centimeter. Our results suggest that the tori in luminous radio-loud AGNs are only poorly developed. The trend is similar to that seen in radio-quiet AGNs, implying that the torus structure is not different between AGNs with jets and without jets.

  16. Long-Term and Rapid Radio Variability of the Blazar 3C 454.3 in 2010-2017

    Science.gov (United States)

    Gorshkov, A. G.; Ipatov, A. V.; Ipatova, I. A.; Konnikova, V. K.; Mardyshkin, V. V.; Mingaliev, M. G.; Kharinov, M. A.

    2018-03-01

    The article presents the results of observations of the blazar 3C 454.3 (J2253+1608), obtained in 2010-2017 on the RATAN-600 radio telescope of the Special Astrophysical Observatory at 4.6, 8.2, 11.2, and 21.7 GHz and on the 32-m Zelenchuk and Badary radio telescopes of the Quasar VLBI Network of the Institute of Applied Astronomy at 4.84 and 8.57 GHz. Long-term variability of the radio emission is studied, as well as variability on time scales of several days and intraday variability (IDV). Two flares were observed in the long-term light curve, in 2010 and in 2015-2017. The flux density at 21.7 GHz increased by a factor of ten during these flares. The delay in the maximum of the first flare at 4.85 GHz relative to the maximum at 21.7 GHz was six months. The time scale for variability on the descending branch of the first flare at 21.7 GHz was τvar = 1.2 yrs, yielding an upper limit on the linear size of the emitting region of 0.4 pc, corresponding to an angular size of 0.06 mas. The brightness temperature during the flare exceeded the Compton limit, implying a Doppler factor δ = 3.5, consistent with the known presence of a relativistic jet oriented close to the line of sight. No significant variability on time scales from several days to several weeks was found in five sets of daily observations carried out over 120 days. IDV was detected at 8.57 GHz on the 32-m telescopes in 30 of 61 successful observing sessions, with the presence of IDV correlated with the maxima of flares. The characteristic time scale for the IDV was from two to ten hours. A number of IDV light curves show the presence of a time delay in the maxima in the light curves for simultaneous observations carried out on the Badary and Zelenchuk antennas, which are widely separated in longitude. This demonstrates that the IDV most like arises in the interstellar medium.

  17. Modelling the flaring activity of the high-z, hard X-ray-selected blazar IGR J22517+2217: Flaring activity of IGR J22517+2217

    International Nuclear Information System (INIS)

    Lanzuisi, G.; De Rosa, A.; Ghisellini, G.; Panessa, F.

    2012-01-01

    We present new Suzaku and Fermi data and re-analysed archival hard X-ray data from the INTErnational Gamma-Ray Astrophysics Laboratory (INTEGRAL) and Swift–Burst Alert Telescope (BAT) surveys to investigate the physical properties of the luminous, high-redshift, hard X-ray-selected blazar IGR J22517+2217, through the modelling of its broad-band spectral energy distribution (SED) in two different activity states. Through analysis of new Suzaku data and flux-selected data from archival hard X-ray observations, we build the source SED in two different states, one for the newly discovered flare that occurred in 2005 and one for the following quiescent period. Both SEDs are strongly dominated by the high-energy hump peaked at 10 20 –10 22 Hz, which is at least two orders of magnitude higher than the low-energy (synchrotron) one at 10 11 –10 14 Hz and varies by a factor of 10 between the two states. In both states the high-energy hump is modelled as inverse Compton emission between relativistic electrons and seed photons produced externally to the jet, while the synchrotron self-Compton component is found to be negligible. In our model the observed variability can be accounted for by a variation of the total number of emitting electrons and by a dissipation region radius changing from inside to outside the broad-line region as the luminosity increases. In its flaring activity, IGR J22517+2217 is revealed as one of the most powerful jets among the population of extreme, hard X-ray-selected, high-redshift blazars observed so far.

  18. BL Lacertae Objects Beyond Redshift 1.3 - UV-to-NIR Photometry and Photometric Redshift for Fermi/LAT Blazars

    Science.gov (United States)

    Rau, A.; Schady, P.; Greiner, J.; Salvato, M.; Ajello, M.; Bottacini, E.; Gehrels, N.; Afonso, P. M. J.; Elliott, J.; Filgas, R.; hide

    2011-01-01

    Context. Observations of the gamma-ray sky with Fermi led to significant advances towards understanding blazars, the most extreme class of Active Galactic Nuclei. A large fraction of the population detected by Fermi is formed by BL Lacertae (BL Lac) objects, whose sample has always suffered from a severe redshift incompleteness due to the quasi-featureless optical spectra. Aims. Our goal is to provide a significant increase of the number of confirmed high-redshift BL Lac objects contained in the 2 LAC Fermi/LAT catalog. Methods. For 103 Fermi/LAT blazars, photometric redshifts using spectral energy distribution fitting have been obtained. The photometry includes 13 broad-band filters from the far ultraviolet to the near-IR observed with Swift/UVOT and the multi-channel imager GROND at the MPG/ESO 2.2m telescope. Data have been taken quasi-simultaneously and the remaining source-intrinsic variability has been corrected for. Results. We release the UV-to-near-IR 13-band photometry for all 103 sources and provide redshift constraints for 75 sources without previously known redshift. Out of those, eight have reliable photometric redshifts at z > or approx. 1.3, while for the other 67 sources we provide upper limits. Six of the former eight are BL Lac objects, which quadruples the sample of confirmed high-redshift BL Lac. This includes three sources with redshifts higher than the previous record for BL Lac, including CRATES J0402-2615, with the best-fit solution at z approx. = 1.9.

  19. Measurement of the gamma ray flux between 50 and 350 GeV from the Mrk 501 Blazar with the experiment CELESTE

    International Nuclear Information System (INIS)

    Brion, E.

    2005-10-01

    The blazar Mrk 501 has a non-thermal emission spectrum with 2 components. The first one, located between radio waves and X-rays, is due to the synchrotron emission of the magnetized jet, while the second one, emitted in the high energy gamma-ray domain, is still not fully understood. Until 1999, this last domain had only been covered between 100 MeV and 4 GeV as well as above 300 GeV. This energy gap was filled by the creation of the CELESTE experiment, recording Cherenkov emission produced by gamma-rays between 50 and 350 GeV penetrating the atmosphere. Mrk 501, which has a variable emission, was observed in 2000 and 2001, and was detected in 2000. A flux has been calculated which constrains the high energy emission models, presented in this thesis. Crab nebula flux measurements validate the method since this source is the standard candle for atmospheric Cherenkov telescopes. Analysis cuts for Mrk 501 are determined using data from the blazar Mrk 421, which has nearly the same declination as Mrk 501. Finally, improved detector simulations were used to calculate the effective area of the instrument, taking the atmosphere quality into account, yielding the flux for Mrk 501 during observations taken between April and June 2000. This flux was compared with a synchrotron self-Compton emission model and with data taken in X-rays. It shows that Mrk 501 was slightly more active during this period compared to the remainder of the year and to the year 2001. A flux upper limit is calculated for other measurements. This is the first measurement in the energy range 50 - 350 GeV (this range represents the limits in energy for which the trigger rate, that is the convolution between the source spectrum and the effective area of the instrument, is higher than 20% of the trigger maximum). It helps to constrain the position of the inverse Compton emission maximum and tends to favor, in this particular case, X- and gamma-ray emission processes from 2 different electron populations

  20. MAXI INVESTIGATION INTO THE LONG-TERM X-RAY VARIABILITY FROM THE VERY-HIGH-ENERGY γ-RAY BLAZAR Mrk 421

    Energy Technology Data Exchange (ETDEWEB)

    Isobe, Naoki [Institute of Space and Astronautical Science (ISAS), Japan Aerospace Exploration Agency (JAXA) 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Sato, Ryosuke; Ueda, Yoshihiro; Hayashida, Masaaki; Shidatsu, Megumi; Kawamuro, Taiki [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Ueno, Shiro; Matsuoka, Masaru [ISS Science Project Office, Institute of Space and Astronautical Science (ISAS), Japan Aerospace Exploration Agency (JAXA), 2-1-1 Sengen, Tsukuba, Ibaraki 305-8505 (Japan); Sugizaki, Mutsumi; Sugimoto, Juri; Mihara, Tatehiro [MAXI team, Institute of Physical and Chemical Research (RIKEN), 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Negoro, Hitoshi, E-mail: n-isobe@ir.isas.jaxa.jp [Department of Physics, Nihon University, 1-8-14 Kanda-Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan)

    2015-01-01

    The archetypical very-high-energy γ-ray blazar Mrk 421 was monitored for more than three years with the Gas Slit Camera on board Monitor of All Sky X-ray Image (MAXI), and its long-term X-ray variability was investigated. The MAXI light curve in the 3-10 keV range was transformed into the periodogram in the frequency range f = 1 × 10{sup –8}-2 × 10{sup –6} Hz. The artifacts on the periodogram, resulting from data gaps in the observed light curve, were extensively simulated for variations with a power-law-like power spectrum density (PSD). By comparing the observed and simulated periodograms, the PSD index was evaluated as α = 1.60 ± 0.25. This index is smaller than that obtained in the higher-frequency range (f ≳ 1 × 10{sup –5} Hz), namely, α = 2.14 ± 0.06 in the 1998 ASCA observation of the object. The MAXI data impose a lower limit on the PSD break at f {sub b} = 5 × 10{sup –6} Hz, consistent with the break of f {sub b} = 9.5 × 10{sup –6} Hz suggested from the ASCA data. The low-frequency PSD index of Mrk 421 derived with MAXI falls well within the range of typical values among nearby Seyfert galaxies (α = 1-2). The physical implications from these results are briefly discussed.

  1. The Optical Variability of the Blazar 3C 454.3 over Three Decades from the Colgate University Foggy Bottom Observatory

    Science.gov (United States)

    Balonek, Thomas J.; Weaver, Zachary R.; Didio, Nicholas; Jenks, Leah; Morris, Carolyn; Stahlin, Ryan; Zagorac, Jovana; Chapman, Katie; D'Auteuil, Brian; Karnes, Katherine L.; Reding, Joshua S.; Sabyr, Alina; Zhang, Saiyang; Boni, Samantha; Rose, Caitlin; Rilinger, Anneliese

    2017-01-01

    Using images from the ongoing quasar monitoring program at Colgate University’s Foggy Bottom Observatory (FBO), we present a twenty-eight year light curve of the blazar 3C 454.3 in Johnson-Cousins V, R, and I filters. Using additional data from several sources, we construct an historic light curve going back to 1899. We compare the variations in several outbursts beginning with the great outburst of 2005. Following its historic minimum in 2012 (R=16.4 magnitude), 3C 454.3 has exhibited several outbursts, always remaining above a base level of 15.8 magnitude. Short timescale activity with duration of hours to days and brightness range of a magnitude or smaller are superposed on the longer-term events. We investigate the characteristic timescales and intensities of these events. We observe V-R and R-I color index variations that are correlated with brightness. The most recent flare, June 2016, has been studied by Weaver & Balonek (2017, at this conference). We gratefully acknowledge support through Colgate University’s Justus and Jayne Schlichting Student Research and NASC Division funds, a National Science Foundation REU grant (AST-1005024) to the Keck Northeast Astronomy Consortium, and the NASA / New York Space Grant.

  2. Investigating the Innermost Jet Structures of Blazar S5 0716+714 Using Uniquely Dense Intra-day Photo-polarimetric Observations

    Directory of Open Access Journals (Sweden)

    Gopal Bhatta

    2016-10-01

    Full Text Available The sub-hour timescale variability commonly observed in blazars—widely known as intra-day or microvariability—has been extensively studied in optical photo-polarimetric bands over the past 25–30 years. In addition, there have been comprehensive theoretical discussions on the topic, with various models and scenarios proposed; however, the phenomenon still remains relatively poorly understood. Here we present the summary of our optical microvariability studies over the past few years based on multi-frequency photo-polarimetric Whole Earth Blazar Telescope (WEBT observation campaigns. The primary objective of the study was to explore the characteristics of the source microvariability on timescales of a few minutes to a few days using exceptionally dense photo-polarimetric observations. The results show that the source often displays fast variability with an amplitude as large as 0.3 mag within a few hours, as well as color variability on similar time scales often characterized by “bluer-when-brighter” trend. Similarly, the correlation between variability in flux and polarization appears to depend upon the configuration of the optical polarization angle relative to the positional angle of the innermost radio core of the jet. Other fascinating observations include a sudden and temporary disappearance in the observed variability lasting for ∼6 h. In addition, the modeling of individual microflares strongly suggests that the phenomenon of microvariability can be best explained by convolved emission from compact emission sites distributed stochastically in the turbulent jet. Besides, analysis of some of the well resolved micro-flares exhibiting high degrees of polarization points towards a complex magnetic geometry pervading the jet with the possible presence of small-scale regions of highly ordered and enhanced magnetic field similar to so-called “magnetic islands”.

  3. Gamma-Ray Loudness, Synchrotron Peak Frequency, and Parsec-scale Properties of Blazars Detected by the Fermi Large Area Telescope

    Science.gov (United States)

    Linford, J. D.; Taylor, G. B.; Schinzel, F. K.

    2012-09-01

    The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' γ-ray properties. We use the ratio of the γ-ray-to-radio luminosity as a measure of γ-ray loudness. We investigate the relationship of several radio properties to γ-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between γ-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with γ-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.

  4. GAMMA-RAY LOUDNESS, SYNCHROTRON PEAK FREQUENCY, AND PARSEC-SCALE PROPERTIES OF BLAZARS DETECTED BY THE FERMI LARGE AREA TELESCOPE

    Energy Technology Data Exchange (ETDEWEB)

    Linford, J. D.; Taylor, G. B.; Schinzel, F. K., E-mail: jlinford@unm.edu [Department of Physics and Astronomy, University of New Mexico, MSC07 4220, Albuquerque, NM 87131-0001 (United States)

    2012-09-20

    The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' {gamma}-ray properties. We use the ratio of the {gamma}-ray-to-radio luminosity as a measure of {gamma}-ray loudness. We investigate the relationship of several radio properties to {gamma}-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between {gamma}-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with {gamma}-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.

  5. GAMMA-RAY LOUDNESS, SYNCHROTRON PEAK FREQUENCY, AND PARSEC-SCALE PROPERTIES OF BLAZARS DETECTED BY THE FERMI LARGE AREA TELESCOPE

    International Nuclear Information System (INIS)

    Linford, J. D.; Taylor, G. B.; Schinzel, F. K.

    2012-01-01

    The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' γ-ray properties. We use the ratio of the γ-ray-to-radio luminosity as a measure of γ-ray loudness. We investigate the relationship of several radio properties to γ-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between γ-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with γ-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.

  6. Gamma-ray astronomy from the ground and the space: first analyses of the HESS-II hybrid array and search for blazar candidates among the unidentified Fermi-LAT sources

    International Nuclear Information System (INIS)

    Lefaucheur, Julien

    2015-01-01

    This manuscript is about high energy gamma-ray astronomy (between 30 GeV and 300 GeV) with the Fermi-LAT satellite and very high energy gamma-ray astronomy (above ∼100 GeV) via the H.E.S.S. experiment. The second phase of the H.E.S.S. experiment began in July 2012 with the inauguration of a fifth 28 m-diameter telescope added to the initial array composed of four 12 m-diameter imaging atmospheric Cherenkov telescopes. In the first part of this thesis, we present the development of an analysis in hybrid mode based on a multivariate method dedicated to detect and study sources with different spectral shapes and the first analysis results on real data. The second part is dedicated to the research of blazar candidates among the Fermi-LAT unidentified sources of the 2FGL catalog. A first development is based on a multivariate approach using discriminant parameters built with the 2FGL catalog parameters. A second development is done with the use of the WISE satellite catalog and a non-parametric technic in order to find the blazar-like infrared counterparts of the unidentified sources of the 2FGL catalog. (author)

  7. Deriving the Contribution of Blazars to the Fermi-LAT Extragalactic γ-ray Background at E > 10 GeV with Efficiency Corrections and Photon Statistics

    Science.gov (United States)

    Di Mauro, M.; Manconi, S.; Zechlin, H.-S.; Ajello, M.; Charles, E.; Donato, F.

    2018-04-01

    The Fermi Large Area Telescope (LAT) Collaboration has recently released the Third Catalog of Hard Fermi-LAT Sources (3FHL), which contains 1556 sources detected above 10 GeV with seven years of Pass 8 data. Building upon the 3FHL results, we investigate the flux distribution of sources at high Galactic latitudes (| b| > 20^\\circ ), which are mostly blazars. We use two complementary techniques: (1) a source-detection efficiency correction method and (2) an analysis of pixel photon count statistics with the one-point probability distribution function (1pPDF). With the first method, using realistic Monte Carlo simulations of the γ-ray sky, we calculate the efficiency of the LAT to detect point sources. This enables us to find the intrinsic source-count distribution at photon fluxes down to 7.5 × 10‑12 ph cm‑2 s‑1. With this method, we detect a flux break at (3.5 ± 0.4) × 10‑11 ph cm‑2 s‑1 with a significance of at least 5.4σ. The power-law indexes of the source-count distribution above and below the break are 2.09 ± 0.04 and 1.07 ± 0.27, respectively. This result is confirmed with the 1pPDF method, which has a sensitivity reach of ∼10‑11 ph cm‑2 s‑1. Integrating the derived source-count distribution above the sensitivity of our analysis, we find that (42 ± 8)% of the extragalactic γ-ray background originates from blazars.

  8. Is PKS 2155 an extragalactic source

    International Nuclear Information System (INIS)

    Maraschi, L.; Treves, A.

    1981-01-01

    We present here observations in the far ultraviolet (1200-3000 Angstroem) obtained with I.U.E. The presence of weak variable emission features is discussed and the extragalactic nature of the object is questioned. (orig./WL)

  9. Is PKS 2155 an extragalactic source

    Energy Technology Data Exchange (ETDEWEB)

    Maraschi, L.; Treves, A. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica e Tecnologie Relative; Milan Univ. (Italy). Ist. di Fisica); Tanzi, E.G. (Consiglio Nazionale delle Ricerche, Milan (Italy). Lab. di Fisica Cosmica e Tecnologie Relative); Tarenghi, M. (European Southern Observatory, Garching (Germany, F.R.))

    1981-01-01

    We present here observations in the far ultraviolet (1200-3000 Angstroem) obtained with I.U.E. The presence of weak variable emission features is discussed and the extragalactic nature of the object is questioned.

  10. Study and modeling of the most energetic Active Galactic Nuclei with the Fermi satellite; Etude et modelisation des noyaux actifs de galaxie les plus energetiques avec le satellite Fermi

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, D.

    2010-06-15

    The Fermi satellite was launched in June 2008. The onboard LAT detector is dedicated to the study of galactic and extra-galactic gamma sources with an energy comprised between 200 MeV and 300 GeV. 1451 sources have been detected in less than 11 months. This document is divided into 6 chapters: 1) gamma astronomy, 2) the Fermi satellite, 3) the active galactic nuclei (NAG), 4) the observation of several blazars (PKS-2155-304 and PG-1553+113) and its simulation, 5) the observation of PKS-2155-304 with both RXTE and Fermi, and 6) conclusion

  11. Study and modeling of the most energetic Active Galactic Nuclei with the Fermi satellite

    International Nuclear Information System (INIS)

    Sanchez, D.

    2010-06-01

    The Fermi satellite was launched in June 2008. The onboard LAT detector is dedicated to the study of galactic and extra-galactic gamma sources with an energy comprised between 200 MeV and 300 GeV. 1451 sources have been detected in less than 11 months. This document is divided into 6 chapters: 1) gamma astronomy, 2) the Fermi satellite, 3) the active galactic nuclei (NAG), 4) the observation of several blazars (PKS-2155-304 and PG-1553+113) and its simulation, 5) the observation of PKS-2155-304 with both RXTE and Fermi, and 6) conclusion

  12. Automated Blazar Light Curves Using Machine Learning

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Spencer James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-27

    Every night in a remote clearing called Fenton Hill high in the Jemez Mountains of central New Mexico, a bank of robotically controlled telescopes tilt their lenses to the sky for another round of observation through digital imaging. Los Alamos National Laboratory’s Thinking Telescopes project is watching for celestial transients including high-power cosmic flashes called, and like all science, it can be messy work. To keep the project clicking along, Los Alamos scientists routinely install equipment upgrades, maintain the site, and refine the sophisticated machinelearning computer programs that process those images and extract useful data from them. Each week the system amasses 100,000 digital images of the heavens, some of which are compromised by clouds, wind gusts, focus problems, and so on. For a graduate student at the Lab taking a year’s break between master’s and Ph.D. studies, working with state-of-the-art autonomous telescopes that can make fundamental discoveries feels light years beyond the classroom.

  13. Small Private Key PKS on an Embedded Microprocessor

    OpenAIRE

    Seo, Hwajeong; Kim, Jihyun; Choi, Jongseok; Park, Taehwan; Liu, Zhe; Kim, Howon

    2014-01-01

    Multivariate quadratic (MQ) cryptography requires the use of long public and private keys to ensure a sufficient security level, but this is not favorable to embedded systems, which have limited system resources. Recently, various approaches to MQ cryptography using reduced public keys have been studied. As a result of this, at CHES2011 (Cryptographic Hardware and Embedded Systems, 2011), a small public key MQ scheme, was proposed, and its feasible implementation on an embedded microprocessor...

  14. Small Private Key PKS on an Embedded Microprocessor

    Science.gov (United States)

    Seo, Hwajeong; Kim, Jihyun; Choi, Jongseok; Park, Taehwan; Liu, Zhe; Kim, Howon

    2014-01-01

    Multivariate quadratic ( ) cryptography requires the use of long public and private keys to ensure a sufficient security level, but this is not favorable to embedded systems, which have limited system resources. Recently, various approaches to cryptography using reduced public keys have been studied. As a result of this, at CHES2011 (Cryptographic Hardware and Embedded Systems, 2011), a small public key scheme, was proposed, and its feasible implementation on an embedded microprocessor was reported at CHES2012. However, the implementation of a small private key scheme was not reported. For efficient implementation, random number generators can contribute to reduce the key size, but the cost of using a random number generator is much more complex than computing on modern microprocessors. Therefore, no feasible results have been reported on embedded microprocessors. In this paper, we propose a feasible implementation on embedded microprocessors for a small private key scheme using a pseudo-random number generator and hash function based on a block-cipher exploiting a hardware Advanced Encryption Standard (AES) accelerator. To speed up the performance, we apply various implementation methods, including parallel computation, on-the-fly computation, optimized logarithm representation, vinegar monomials and assembly programming. The proposed method reduces the private key size by about 99.9% and boosts signature generation and verification by 5.78% and 12.19% than previous results in CHES2012. PMID:24651722

  15. Time Series Analysis of the Quasar PKS 1749+096

    Science.gov (United States)

    Lam, Michael T.; Balonek, T. J.

    2011-01-01

    Multiple timescales of variability are observed in quasars at a variety of wavelengths, the nature of which is not fully understood. In 2007 and 2008, the quasar 1749+096 underwent two unprecedented optical outbursts, reaching a brightness never before seen in our twenty years of monitoring. Much lower level activity had been seen prior to these two outbursts. We present an analysis of the timescales of variability over the two regimes using a variety of statistical techniques. An IDL software package developed at Colgate University over the summer of 2010, the Quasar User Interface (QUI), provides effective computation of four time series functions for analyzing underlying trends present in generic, discretely sampled data sets. Using the Autocorrelation Function, Structure Function, and Power Spectrum, we are able to quickly identify possible variability timescales. QUI is also capable of computing the Cross-Correlation Function for comparing variability at different wavelengths. We apply these algorithms to 1749+096 and present our analysis of the timescales for this object. Funding for this project was received from Colgate University, the Justus and Jayne Schlichting Student Research Fund, and the NASA / New York Space Grant.

  16. Axion-like particle imprint in cosmological very-high-energy sources

    International Nuclear Information System (INIS)

    Domínguez, A.; Sánchez-Conde, M.A.; Prada, F.

    2011-01-01

    Discoveries of very high energy (VHE) photons from distant blazars suggest that, after correction by extragalactic background light (EBL) absorption, there is a flatness or even a turn-up in their spectra at the highest energies that cannot be easily explained by the standard framework. Here, it is shown that a possible solution to this problem is achieved by assuming the existence of axion-like particles (ALPs) with masses ∼ 1 neV. The ALP scenario is tested making use of observations of the highest redshift blazars known in the VHE energy regime, namely 3C 279, 3C 66A, PKS 1222+216 and PG 1553+113. In all cases, better fits to the observed spectra are found when including ALPs rather than considering EBL only. Interestingly, quite similar critical energies for photon/ALP conversions are also derived, independently of the source considered

  17. Quasi Periodic Oscillations in Blazars Alok C. Gupta

    Indian Academy of Sciences (India)

    very important to understand AGN emission models. The centre of the .... the disk and in the optical/UV bands QPOs could arise from the hot-spots or spiral .... We used wavelet plus randomization technique, which had certain advantages over.

  18. Lessons learned from ESA INTEGRAL: cataclysmic variables and blazars

    Czech Academy of Sciences Publication Activity Database

    Hudec, René; Gális, R.; Kocka, Matúš

    2010-01-01

    Roč. 81, č. 1 (2010), s. 320-325 ISSN 0037-8720. [Multifrequency behaviour of high energy cosmic sources. Vulcano, 25.05.2009-30.05. 2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : high-energy sources * cataclysmic variables * INTEGRAL Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Orbital Signatures from Observed Light Curves of Blazars

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Variability in active galactic nuclei is observed in UV to X-ray emission based light curves. This could be attributed to orbital signatures of the plasma that constitutes the accretion flow on the putative disk or in the developing jet close to the inner region of the central black hole. We discuss some theoretical ...

  20. Radio Band Observations of Blazar Variability Margo F. Aller , Hugh ...

    Indian Academy of Sciences (India)

    gle dish monitoring and spatial resolution from VLBA imaging. Such measurements now available in all four ... linear-to-circular mode conversion in a region that is at least partially self- absorbed. Detailed analysis of ... Single dish monitoring observations from Metsähovi, Michigan (hereafter. UMRAO), and recently from the ...

  1. Recent optical activity of the blazar OT 355

    Science.gov (United States)

    Bachev, R.; Kurtenkov, A.; Nikolov, Y.; Spassov, B.; Boeva, S.; Latev, G.; Dimitrova, R. V. Munoz

    2017-06-01

    The Flat Spectrum Radio Quasar OT 355 (also known as 7C 173240.70+385949.00, z=0.975) was typically observed to be in the optical between 16th and 21th magnitude (CRTS, http://nesssi.cacr.caltech.edu/catalina/20011332/113321380764100137p.html).

  2. Astronomical Plate Archives and Binary Blazars Studies Rene Hudec

    Indian Academy of Sciences (India)

    Faculty of Electrical Engineering, Technicka 2, Prague 6, Czech Republic. e-mail: ... development of dedicated software, enables for the first time, effective data mining and data analyses by powerful computers with these archives. Examples of ...

  3. Gamma-Ray and Multiwavelength Emission from Blazars

    Indian Academy of Sciences (India)

    Since January 2016, the Journal of Astrophysics and Astronomy has moved to Continuous Article Publishing (CAP) mode. This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1. Articles are also visible in Web of Science immediately.

  4. Long periodicity of Blazar with RXTE ASM, TA and HEGRA

    OpenAIRE

    Osone, S.; Teshima, M.

    2002-01-01

    Long periodicity for Mkn501 during a large flare in 1997 have been reported by TA, HEGRA group. Here, we establish this periodicity with archival data of RXTE All Sky Monitor(ASM), Telescope Array(TA) and HEGRA with a chance probability less than $10^{-5}$. We also find that an origin of 23 day periodicity is related with a change of either a gamma factor of electrons $\\gamma$ or the magnetic field or a beaming factor. And, in order to search for a category which have a long periodicity, we m...

  5. Orbital Signatures from Observed Light Curves of Blazars A ...

    Indian Academy of Sciences (India)

    Possible extents of this inner region and a break frequency as an orbital sig- nature are ... many is dictated by statistical analysis (Mohan et al. 2014). ... ting region, even inside of ISCO, implying that its source is on the disk (Doeleman et al.

  6. What Governs Lorentz Factors of Jet Components in Blazars? Xinwu ...

    Indian Academy of Sciences (India)

    Abstract. We use a sample of radio-loud Active Galactic Nuclei. (AGNs) with measured black hole masses to explore the jet formation mechanisms in these sources. We find a significant correlation between black hole mass and the bulk Lorentz factor of the jet components for this sample, while no significant correlation is ...

  7. What Governs Lorentz Factors of Jet Components in Blazars?

    Indian Academy of Sciences (India)

    We use a sample of radio-loud Active Galactic Nuclei (AGNs) with measured black hole masses to explore the jet formation mechanisms in these sources. We find a significant correlation between black hole mass and the bulk Lorentz factor of the jet components for this sample, while no significant correlation is present ...

  8. A window on stochastic processes and gamma-ray cosmology through spectral and temporal studies of AGN observed with H.E.S.S

    International Nuclear Information System (INIS)

    Biteau, J.

    2013-01-01

    Fifty years after the discovery that quasars are extragalactic sources, their bright cores (AGN) and the jets that some of them exhibit still have plenty of secrets to share, particularly through observations in the gamma-ray band. Above 100 GeV, Cherenkov telescopes such as H.E.S.S. have detected 50 AGN, mostly blazars, objects whose jets are pointed toward the observer. The detection of two faint ones, 1ES 1312-423 and SHBL J001355.9-185406, is described in this thesis. Their multiwavelength spectra are reproduced with a synchrotron self-Compton model. The γ rays emitted by blazars are partly absorbed by the extragalactic background light (EBL), the second most intense cosmological background, which carries the integrated history of star formation. The first detection of this absorption above 100 GeV is performed, enabling the measurement of the EBL peak-amplitude in the optical band at the 20% level. In addition to these spectral studies, the fast flux-variations of blazars are investigated using the outbursts of PKS 2155-304 seen by H.E.S.S.. The observation of a skewed flux distribution and of an R.M.S.-flux correlation are interpreted within a kinematic model, where the emission is a realization of a stochastic process. (author)

  9. Gamma radiation from active galaxy nuclei detected at very high energies with H.E.S.S: Multi-wavelength study and simulation of radioactive processes

    International Nuclear Information System (INIS)

    Lenain, J.P.

    2009-01-01

    Active Galactic Nuclei (AGN) are among the most energetic sources in the Universe. A subgroup of AGN possesses relativistic jets, the emission of which is purely non-thermal. In the case where the jet is aligned to the line of sight, these objects, called 'blazars', have their emission amplified by the relativistic Doppler effect. Since the advent of very high energy (VHE; E > 100 GeV) γ-ray astrophysics, Cerenkov telescopes like H.E.S.S. have observed almost thirty AGN, mainly blazars, from the ground. Cerenkov radiation from particle showers created by the interaction of γ-rays in the terrestrial atmosphere is used to derive the properties of the incident photon and thus to study these extragalactic sources. We have studied the highly variable VHE γ-ray emission from the blazar PKS 2155-304, from which 2 major outbursts were detected in July 2006, within the framework of a dynamic Synchrotron self-Compton (SSC) model. This variable emission presents properties excluding the most standard emission scenarios for blazars. We have also developed an SSC emission model for misaligned relativistic jets, to interpret the recent discovery of VHE γ-ray emission from 2 radio galaxies, M87 and Cen-A, which established the emergence of a new family of cosmic TeV emitters. We conclude with a systematic study conducted on all the AGN currently known at TeV with a stationary SSC model. We present tools for predictions of flux densities in these objects, which can be confronted with future observations by the Cerenkov Telescope Array (CTA). (author)

  10. GENDER DALAM KOMUNIKASI POLITIK AKTIVIS PARTAI ISLAM (Analisis Terhadap Aktivis PBB, PPP dan PKS di Padang

    Directory of Open Access Journals (Sweden)

    Alqanitah Pohan

    2014-05-01

    Full Text Available Affirmative action in gender mainstreaming at politic party, is marked with the existence of quota 30% women role in nomination quota of legislative member inviting pro and contra. There are two perspectives in looking at this gender. First, positivistic perspective (or objective which sees that women have to be given opportunity in political space, its importance if women to have make of policy. Proper women isn’t it well-balance position with men in legislative because amount residents of more women compared to men. Second the naturalistic perspective (or subjective. Which my tries to express that women have their own responsible and their readiness of women to enter political world. The activities of model political communications of Islamic activist party, activist humanity and with candidate elector of legislative general election 2004 there are three models which conventional model, contemporary model and mutant model.Keywords : Gender, Islamic Activist Party and Political Communications ModelCopyright © 2012 by Kafa`ah All right reservedDOI : 10.15548/jk.v2i1.37

  11. Chain elongation and cyclization in type III PKS DpgA.

    Science.gov (United States)

    Wu, Hai-Chen; Li, Yi-San; Liu, Yu-Chen; Lyu, Syue-Yi; Wu, Chang-Jer; Li, Tsung-Lin

    2012-04-16

    Chain elongation and cyclization of precursors of dihydroxyphenylacetyl-CoA (DPA-CoA) catalyzed by the bacterial type III polyketide synthase DpgA were studied. Two labile intermediates, di- and tri-ketidyl-CoA (DK- and TK-CoA), were proposed and chemically synthesized. In the presence of DpgABD, each of these with [(13)C(3)]malonyl-CoA (MA-CoA) was able to form partially (13)C-enriched DPA-CoA. By NMR and MS analysis, the distribution of (13)C atoms in the partially (13)C-enriched DPA-CoA shed light on how the polyketide chain elongates and cyclizes in the DpgA-catalyzed reaction. Polyketone intermediates elongate in a manner different from that which had been believed: two molecules of DK-CoA, or one DK-CoA plus one acetoacetyl-CoA (AA-CoA), but not two molecules of AA-CoA can form one molecule of DPA-CoA. As a result, polyketidyl-CoA serves as both the starter and extender, whereas polyketone-CoA without the terminal carboxyl group can only act as an extender. The terminal carboxyl group is crucial for the cyclization that likely takes place on CoA. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Partisipasi Politik Perempuan dalam Partai Keadilan Sejahtera (PKS) di Kabupaten Jepara

    OpenAIRE

    Haryati, Eri; Yuwanto; Fitriyah

    2017-01-01

    . Gender equation concept has been spread out and developing in such way that affecting the reformation of Indonesia. One the changes that did by the reformation related to the system which aim to make women can fight for her interests in many sector, and politic is one of them. Political party is one of the most important factor that deciding whether the women's political participation and representation. Women's political participation will never fully happen if the political party does not...

  13. Optimization of hydrogen and syngas production from PKS gasification by using coal bottom ash.

    Science.gov (United States)

    Shahbaz, Muhammad; Yusup, Suzana; Inayat, Abrar; Patrick, David Onoja; Pratama, Angga; Ammar, Muhamamd

    2017-10-01

    Catalytic steam gasification of palm kernel shell is investigated to optimize operating parameters for hydrogen and syngas production using TGA-MS setup. RSM is used for experimental design and evaluating the effect of temperature, particle size, CaO/biomass ratio, and coal bottom ash wt% on hydrogen and syngas. Hydrogen production appears highly sensitive to all factors, especially temperature and coal bottom ash wt%. In case of syngas, the order of parametric influence is: CaO/biomass>coal bottom ash wt%>temperature>particle size. The significant catalytic effect of coal bottom ash is due to the presence of Fe 2 O 3 , MgO, Al 2 O 3 , and CaO. A temperature of 692°C, coal bottom ash wt% of 0.07, CaO/biomass of 1.42, and particle size of 0.75mm are the optimum conditions for augmented yield of hydrogen and syngas. The production of hydrogen and syngas is 1.5% higher in the pilot scale gasifier as compared to TGA-MS setup. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Short timescale photometric and polarimetric behavior of two BL Lacertae type objects

    International Nuclear Information System (INIS)

    Covino, S.; Baglio, M. C.; Foschini, L.; Sandrinelli, A.; Tavecchio, F.; Treves, A.; Zhang, H.; Barres de Almeida, U.; Bonnoli, G.; Boettcher, M.; Cecconi, M.; D'Ammando, F.; Fabrizio, L. di; Giarrusso, M.; Leone, F.; Lindfors, E.; Lorenzi, V.; Molinari, E.; Paiano, S.; Prandini, E.; Raiteri, C. M.; Stamerra, A.; Tagliaferri, G.

    2015-01-01

    Context. Blazars are astrophysical sources whose emission is dominated by non-thermal processes, typically interpreted as synchrotron and inverse Compton emission. Although the general picture is rather robust and consistent with observations, many aspects are still unexplored. Aims. Polarimetric monitoring can offer a wealth of information about the physical processes in blazars. Models with largely different physical ingredients can often provide almost indistinguishable predictions for the total flux, but usually are characterized by markedly different polarization properties. We explore, with a pilot study, the possibility to derive structural information about the emitting regions of blazars by means of a joint analysis of rapid variability of the total and polarized flux at optical wavelengths. Methods. Short timescale (from tens of seconds to a couple of minutes) optical linear polarimetry and photometry for two blazars, BL Lacertae and PKS 1424+240, was carried out with the PAOLO polarimeter at the 3.6 m Telescopio Nazionale Galileo. Several hours of almost continuous observations were obtained for both sources. Results. Our intense monitoring allowed us to draw strongly different scenarios for BL Lacertae and PKS 1424+240, with the former characterized by intense variability on time-scales from hours to a few minutes and the latter practically constant in total flux. Essentially the same behavior is observed for the polarized flux and the position angle. The variability time-scales turned out to be as short as a few minutes, although involving only a few percent variation of the flux. The polarization variability time-scale is generally consistent with the total flux variability. Total and polarized flux appear to be essentially uncorrelated. However, even during our relatively short monitoring, different regimes can be singled out. Conclusions. No simple scenario is able to satisfactorily model the very rich phenomenology exhibited in our data. As a

  15. Hubble Space Telescope Ultraviolet Spectroscopy of Fourteen Low-Redshift Quasars

    DEFF Research Database (Denmark)

    Ganguly, Rajib; Brotherton, Michael S.; Arav, Nahum

    2007-01-01

    We present low-resolution ultraviolet spectra of 14 low redshift (z zz 1.4 Large Bright Quasar samples. By design, our objects sample luminosities in between these two surveys, and our four absorbed objects are consistent with the v ~ L^0.62 relation derived by Laor & Brandt (2002). Another quasar......, HE0441-2826, contains extremely weak emission lines and our spectrum is consistent with a simple power-law continuum. The quasar is radio-loud, but has a steep spectral index and a lobe-dominated morphology, which argues against it being a blazar. The unusual spectrum of this quasar resembles...... the spectra of the quasars PG1407+265, SDSSJ1136+0242, and PKS1004+13 for which several possible explanations have been entertained....

  16. Isolation and Biosynthetic Analysis of Haliamide, a New PKS-NRPS Hybrid Metabolite from the Marine Myxobacterium Haliangium ochraceum

    Directory of Open Access Journals (Sweden)

    Yuwei Sun

    2016-01-01

    Full Text Available Myxobacteria of marine origin are rare and hard-to-culture microorganisms, but they genetically harbor high potential to produce novel antibiotics. An extensive investigation on the secondary metabolome of the unique marine myxobacterium Haliangium ochraceum SMP-2 led to the isolation of a new polyketide-nonribosomal peptide hybrid product, haliamide (1. Its structure was elucidated by spectroscopic analyses including NMR and HR-MS. Haliamide (1 showed cytotoxicity against HeLa-S3 cells with IC50 of 12 μM. Feeding experiments were performed to identify the biosynthetic building blocks of 1, revealing one benzoate, one alanine, two propionates, one acetate and one acetate-derived terminal methylene. The biosynthetic gene cluster of haliamide (hla, 21.7 kbp was characterized through the genome mining of the producer, allowing us to establish a model for the haliamide biosynthesis. The sulfotransferase (ST-thioesterase (TE domains encoded in hlaB appears to be responsible for the terminal alkene formation via decarboxylation.

  17. Enormous Disc of Cool Gas Surrounding the Nearby Powerful Radio Galaxy NGC 612 (PKS 0131-36)

    Science.gov (United States)

    2008-05-22

    galaxies in clus- ters appear to be much more devoid of H I gas, as sug- gested by a recent H I survey of the VIRGO cluster by di Serego Alighieri et...120th Street, New York, N.Y. 10027, USA 2Netherlands Foundation for Research in Astronomy, Postbus 2, 7990 AA Dwingeloo, the Netherlands 3Kapteyn...NGC 612. This paper is part of an ongoing study to map the large-scale neutral hydrogen properties of nearby radio galaxies and it presents the first

  18. The Land-Potential Knowledge System (LandPKS): mobile apps and collaboration for optimizing climate change investments

    Science.gov (United States)

    Massive investments in climate change mitigation and adaptation are projected during coming decades. Many of these investments will seek to modify how land is managed. The return on both types of investments can be increased through an understanding of land potential: the potential of the land to s...

  19. Multi-Wavelength Variability Properties of Fermi Blazar S5 0716+ ...

    Indian Academy of Sciences (India)

    Academy of Sciences, 19B Yuquan Road, Beijing 100049, China. 5Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical. Observatory, Chinese Academy of Sciences, 80 Nandan Road, Shanghai 200030, China. ... tons from hot dust or Broad Line Region (BLR) emission is probably favourable ...

  20. Testing the blazar sequence and black hole mass scaling with BL Lac objects

    NARCIS (Netherlands)

    Plotkin, Richard M.; Markoff, Sera; Anderson, Scott F.; Kelly, Brandon C.; Körding, Elmar; Trager, Scott C.; Romero, Gustavo E.; Sunyaev, Rashid A.; Belloni, Tomaso

    Jets from accreting black holes appear remarkably similar over eight orders of magnitude in black hole mass, with more massive black holes generally launching more powerful jets. For example, there is an observed correlation, termed the fundamental plane of black hole accretion, between black hole

  1. Testing the blazar sequence and black hole mass scaling with BL Lac objects

    NARCIS (Netherlands)

    Plotkin, R.M.; Markoff, S.; Anderson, S.F.; Kelly, B.C.; Körding, E.; Trager, S.C.

    2010-01-01

    Jets from accreting black holes appear remarkably similar over eight orders of magnitude in black hole mass, with more massive black holes generally launching more powerful jets. For example, there is an observed correlation, termed the fundamental plane of black hole accretion, between black hole

  2. Contemporaneous VLBA 5 GHz Observations of Large Area Telescope Detected Blazars

    Science.gov (United States)

    2012-01-10

    on board the Fermi Gamma-ray Space Telescope is a wide-field telescope covering the energy range from about 20 MeV to more than 300 GeV. It has been... energies via inverse Compton processes (e.g., Björnsson 2010; Tavecchio et al. 2011; Abdo et al. 2011). Meier (2005) expected several reconnection...Astrophys. Space Sci. Libr ., 285, 109 Healey, S. E., Romani, R. W., Cotter, G., et al. 2008, ApJS, 175, 97 Healey, S. E., Romani, R. W., Taylor, G. B

  3. A Search for Blazar-Like Radio-Loud Narrow-Line Seyfert 1 Galaxies

    Directory of Open Access Journals (Sweden)

    Hugh R. Miller

    2017-03-01

    Full Text Available We report the results of an observational program to investigate the gamma-ray and optical variability properties of the vRL NLSY1 galaxies listed in the Yuan et al. sample. We have identified 17 members of the Yuan et al. sample possibly associated with gamma-ray sources based on a combination of their optical polarization and optical variability and their gamma-ray properties. Eight have previously been associated with gamma-ray sources. We find nine additional members that we predict are excellent candidates to be associated with gamma-ray sources in the future. All 17 sources have many properties in common with flat spectrum radio quasars (FSRQs, suggesting that they may, in fact, constitute a new subclass of FSRQs.

  4. Quasi-Periodic Oscillations in the X-ray Light Curves of Blazars Paul ...

    Indian Academy of Sciences (India)

    the quasi-periodic component could provide a powerful tool for diagnosing the jet's structure. ... tent with the red-noise seen in most power spectra of AGN variability; QPOs would ... A statistical analysis of the periodogram for that observation yields a peak at ... (2008) also employed structure functions to try to characterize.

  5. Study of 23 day periodicity of Blazar Mkn501 in 1997

    Science.gov (United States)

    Osone, S.

    2006-10-01

    We confirm a 23 day periodicity during a large flare in 1997 for X-ray data of X-ray satellite RXTE all sky monitor (ASM), 2 TeV gamma ray data from Utah Seven Telescope and HEGRA, with a Fourier analysis. We found the three results to be the same with a newly estimated error. We confirm the presence of a frequency dependent power (1/ f noise) in a frequency-power diagram. Further, we calculated a chance probability of the occurrence of the 23 day periodicity by considering the 1/ f noise and obtained a chance probability 4.88 × 10 -3 for the HEGRA data: this is more significant than the previous result by an order. We also obtained an indentical periodicity with another kind of timing analysis-epoch folding method for the ASM data and HEGRA data. We strongly suggest an existence of the periodicity. We divided the HEGRA data into two data sets, analyzed them with a Fourier method, and found an unstableness of the periodicity with a 3.4 sigma significance. We also analyzed an energy spectra of the X-ray data of a RXTE proportional counter array and we found that a combination of three physical parameters—a magnetic field, a Lorentz factor, and a beaming factor—is related to the periodicity.

  6. Radio and Gamma-Ray Monitoring of Strongly Lensed Quasars and Blazars

    NARCIS (Netherlands)

    Rumbaugh, Nick; Fassnacht, Chris; McKean, John; Koopmans, Leon; Auger, Matthew; Suyu, Sherry; Marshall, Philip J.

    2015-01-01

    We observed six strongly lensed, radio-loud quasars (MG 0414+0534, CLASS B0712+472, JVAS B1030+074, CLASS B1127+385, CLASS B1152+199, and JVAS B1938+666) in order to identify systems suitable for measuring cosmological parameters using time delays between their multiple images. Two separate

  7. The historical 1900 and 1913 outbursts of the binary blazar candidate OJ287

    Czech Academy of Sciences Publication Activity Database

    Hudec, René; Bašta, M.; Pihajoki, P.; Valtonen, M.J.

    2013-01-01

    Roč. 559, October (2013), A20/1-A20/9 ISSN 0004-6361 Institutional support: RVO:67985815 Keywords : observational methods * OJ287 * photometric techniques Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.479, year: 2013

  8. Low-luminosity Blazars in Wise: A Mid-infrared View of Unification

    Science.gov (United States)

    Plotkin, Richard M.; Anderson, S. F.; Brandt, W. N.; Markoff, S.; Shemmer, O.; Wu, J.

    2012-01-01

    We use the preliminary data release from the Wide-Field Infrared Survey Explorer (WISE) to perform the first statistical study on the mid-infrared (IR) properties of a large number ( 102) of BL Lac objects -- low-luminosity Active Galactic Nuclei (AGN) with a jet beamed toward the Earth. As expected, many BL Lac objects are so highly beamed that their jet synchrotron emission dominates their IR spectral energy distributions (SEDs), and the shape of their SEDs in the IR correlates well with SED peak frequency. In other BL Lac objects, the jet is not strong enough to completely dilute the rest of the AGN, and we do not see observational signatures of the dusty torus from these weakly beamed BL Lac objects. While at odds with simple unification, the missing torus is consistent with recent suggestions that BL Lac objects are fed by radiatively inefficient accretion flows. We discuss implications on the ``nature vs. nurture" debate for FR I and FR II galaxies, and also on the standard orientation-based AGN unification model.

  9. Constraints on the Gamma-Ray Emitting Region in Blazars from Multi-Frequency VLBI Measurements

    Science.gov (United States)

    2010-06-23

    H. Chavushyan9, L. Carrasco9, A. Carramiñana9, and M. A. Gurwell10 1 Max–Planck–Institut für Radioastronomie , Auf dem Hügel 69, 53121 Bonn...Planck?Institut f?ur Radioastronomie ,Auf dem H?ugel 69, 53121 Bonn,Germany, , 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY

  10. Fermi-LAT View of Bright Flaring Gamma-Ray Blazars D. Bastieri1,2 ...

    Indian Academy of Sciences (India)

    Sun while in a quiet state were promptly detected. This is mainly due to the design of the mission, featuring a detector, the LAT with a wide field of view, and to ... the energies of all photons falling inside a solid angle, of a proper opening, cen- ... Opportunity (ToO) triggers for multifrequency observations; to start possible ToO.

  11. THE DISCOVERY OF γ-RAY EMISSION FROM THE BLAZAR RGB J0710+591

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Arlen, T.; Aune, T.; Bautista, M.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R.; Boettcher, M.; Boltuch, D.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.

    2010-01-01

    The high-frequency-peaked BL Lacertae object RGB J0710+591 was observed in the very high-energy (VHE; E > 100 GeV) wave band by the VERITAS array of atmospheric Cherenkov telescopes. The observations, taken between 2008 December and 2009 March and totaling 22.1 hr, yield the discovery of VHE gamma rays from the source. RGB J0710+591 is detected at a statistical significance of 5.5 standard deviations (5.5σ) above the background, corresponding to an integral flux of (3.9 ± 0.8) x 10 -12 cm -2 s -1 (3% of the Crab Nebula's flux) above 300 GeV. The observed spectrum can be fit by a power law from 0.31 to 4.6 TeV with a photon spectral index of 2.69 ± 0.26 stat ± 0.20 sys . These data are complemented by contemporaneous multiwavelength data from the Fermi Large Area Telescope, the Swift X-ray Telescope, the Swift Ultra-Violet and Optical Telescope, and the Michigan-Dartmouth-MIT observatory. Modeling the broadband spectral energy distribution (SED) with an equilibrium synchrotron self-Compton model yields a good statistical fit to the data. The addition of an external-Compton component to the model does not improve the fit nor brings the system closer to equipartition. The combined Fermi and VERITAS data constrain the properties of the high-energy emission component of the source over 4 orders of magnitude and give measurements of the rising and falling sections of the SED.

  12. Optical flare observed in the flaring gamma-ray blazar Ton 599

    Science.gov (United States)

    Pursimo, Tapio; Sagues, Ana; Telting, John; Ojha, Roopesh

    2017-11-01

    We report optical photometry of the flat spectrum radio quasar Ton 599, obtained with the 2.56m Nordic Optical Telescope in La Palma, to look for any enhanced optical activity associated with a recent flare in the daily averaged gamma-ray flux (ATel#10931, ATel#10937).

  13. γ-Rays Radiation of High Redshift Fermi Blazars WG Liu1, SH Fu2 ...

    Indian Academy of Sciences (India)

    FSRQs), which is from the second Fermi-LAT AGNs catalogue. (2LAC), we studied the correlation between flux densities (FR,FK,Fγ ) in the radio, infrared and γ-ray wave bands. We found that there is a significant positive correlation between Fγ ...

  14. Resolving the host galaxy of a distant blazar with LBT/LUCI 1 + ARGOS

    Science.gov (United States)

    Farina, E. P.; Georgiev, I. Y.; Decarli, R.; Terzić, T.; Busoni, L.; Gässler, W.; Mazzoni, T.; Borelli, J.; Rosensteiner, M.; Ziegleder, J.; Bonaglia, M.; Rabien, S.; Buschkamp, P.; Orban de Xivry, G.; Rahmer, G.; Kulas, M.; Peter, D.

    2018-05-01

    BL Lac objects emitting in the very high energy (VHE) regime are unique tools to peer into the properties of the extragalactic background light (EBL). However, due to the typical absence of features in their spectra, the determination of their redshifts has proven challenging. In this work, we exploit the superb spatial resolution delivered by the new Advanced Rayleigh guided Ground layer adaptive Optics System (ARGOS) at the Large Binocular Telescope to detect the host galaxy of HESS J1943+213, a VHE emitting BL Lac shining through the Galaxy. Deep H-band imaging collected during the ARGOS commissioning allowed us to separate the contribution of the nuclear emission and to unveil the properties of the host galaxy with unprecedented detail. The host galaxy is well fitted by a Sérsic profile with index of n ˜ 2 and total magnitude of HHost ˜ 16.15 mag. Under the assumption that BL Lac host galaxies are standard candles, we infer a redshift of z ˜ 0.21. In the framework of the current model for the EBL, this value is in agreement with the observed dimming of the VHE spectrum due to the annihilation of energetic photons on the EBL

  15. Fermi-LAT observation of nonblazar AGNs

    Science.gov (United States)

    Sahakyan, N.; Baghmanyan, V.; Zargaryan, D.

    2018-06-01

    Context. Fermi Large Area Telescope (Fermi-LAT) has recently detected γ-ray emission from active galactic nuclei (AGN) that do not show clear evidence for optical blazar characteristics or have jets pointing away from the observer (nonblazar AGNs). These are interesting γ-ray emitters providing an alternative approach to studying high energy emission processes. Aims: This paper investigates the spectral and temporal properties of γ-ray emission from nonblazar AGNs using the recent Fermi-LAT observational data. Methods: The data collected by Fermi-LAT during 2008-2015, from the observations of 26 nonblazar AGNs, including 11 Fanaroff-Riley Type I (FRI) and ten FRII radio galaxies and steep spectrum radio quasars (SSRQs) and five narrow line seyfert 1s (NLSy1s) are analysed using the new PASS 8 event selection and instrument response function. Possible spectral changes above GeV energies are investigated with a detailed spectral analysis. Light curves generated with normal and adaptive time bins are used to study the γ-ray flux variability. Results: Non-blazar AGNs have a γ-ray photon index in the range of 1.84-2.86 and a flux varying from a few times 10-9 photon cm-2 s-1 to 10-7 photon cm-2 s-1. Over long time periods, the power law provides an adequate description of the γ-ray spectra of almost all sources. Significant curvature is observed in the γ-ray spectra of NGC 1275, NGC 6251, SBS 0846 + 513, and PMN J0948 + 0022 and their spectra are better described by log parabola or by the power law with exponential cut-off models. The γ-ray spectra of PKS 0625-25 and 3C 380 show a possible deviation from a simple power-law shape, indicating a spectral cut-off around the observed photon energy of Ecut = 131.2 ± 88.04 GeV and Ecut = 55.57 ± 50.74 GeV, respectively. Our analysis confirms the previous finding of an unusual spectral turnover in the γ-ray spectrum of Cen A: the photon index changes from Γ = 2.75 ± 0.02 to 2.31 ± 0.1 at 2.35 ± 0.08 GeV. In the

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Keywords. Blazars; spectral energy distributions; gamma-ray emission; radio emission; host galaxies; blazar demographics; redshifts; polarization; Yung Wing; optical emissions; emission mechanism; black holes.

  17. The New BeppoSAX Observation of the Brightest X-Ray Quasar at Redshift

    Science.gov (United States)

    Nicastro, Fabrizio; Oliversen, Ronald J. (Technical Monitor)

    2001-01-01

    This grant was to support the reduction and analysis of our approved SAX observation of the high redshift (z=3.2) blazar PKS 2126-158. This is the brightest quasar at z greater than 3 and has been intensively studied in X-ray, since the first Einstein detection. In 1994 Elvis et al., discovered a strong low energy cutoff in this object, which could imply either quasar frame photoelectric absorption by a column of 0.8-2.7 x 1e22 cm-2 cold gas, or a lower column of cold gas at z=0. Subsequent ASCA observations of this object, could not definitely address this issue, nor could establish whether the curvature of the low energy portion of the spectrum was due to pure photoelectric absorption (considerably exceeding the Galactic value along the line of sight) or to an intrinsic continuum curvature. We proposed to observe PKS 2126-158 with BeppoSAX, to try to solve this puzzle (thanks to the broadband of BeppoSAX: 0.1-250 keV). PKS 2126 was observed by BeppoSAX on May 1999, with a MECS exposure of 100 ks. We have reduced and analyzed the BeppoSAX data, and compared them with a Chandra ACIS observation of the same object, taken only 6 months apart (Nov. 1999). We have recently finished to write a paper on the BeppoSAX data only, that concentrate on the properties of the X-ray absorber, which is highly requested by our SAX data, independently on the continuum model adopted. The paper (P.I.F. Fiore) will be submitted to APJ in the next few days. A second paper on the combined BeppoSAX and Chandra data, and based on the broad band spectral energy distribution of this quasar, is currently in preparation. Our main results, on the X-ray absorber, are: (a) the presence of an X-ray absorber is confirmed, indipendently on the continuum adopted (simple power law, or curved continuum); (b) if the absorber is not significantly ionized, then the BeppoSAX data do prefer a low redshift absorber; (c) if the gas is ionized, then it can be located in the quasar environment, but its metal

  18. Molecular characterization of two alkylresorcylic acid synthases from Sordariomycetes fungi

    DEFF Research Database (Denmark)

    Ramakrishnan, Dhivya; Tiwari, Manish Kumar; Manoharan, Gomathi

    2018-01-01

    Two putative type III polyketide synthase genes (PKS) were identified from Sordariomycetes fungi. These two type III PKS genes from Sordaria macrospora (SmPKS) and Chaetomium thermophilum (CtPKS), shared 59.8% sequence identity. Both, full-length and truncated versions of type III PKSs were...

  19. Observations of low and intermediate-frequency-peaked BL Lacs above 100 GeV with VERITAS

    Directory of Open Access Journals (Sweden)

    Errando M.

    2013-12-01

    Full Text Available Most of the ~ 50 blazars detected to date at TeV energies (E > 0.1 TeV are high-frequency-peaked BL Lacs (HBLs. Only a handful episodic detections of low- and intermediate-frequency-peaked BL Lacs (LBL/IBLs, with synchrotron peak frequencies in the infrared and optical regime have been reported by ground-based gamma-ray telescopes, typically during high-flux states. The VERITAS array located in southern Arizona has observed five known TeV LBL/IBLs since 2009: 3C 66A, WComae, PKS 1424+240, S5 0716+714 and BL Lacertae, with exposures of 5-10 hours/year, which so far resulted in the detection of a bright, sub-hour timescale gamma-ray flare of BL Lacertae in June 2011. We also report the detection and characterization of two new IBLs: VER J0521+211 and B2 1215+30.

  20. Biosynthetic potential for polyketides in Talaromyces atroroseus

    DEFF Research Database (Denmark)

    Rasmussen, Kasper Bøwig; Mortensen, Uffe Hasbro; Thrane, Ulf

    11, and deletion of PKS11 results in the loss of Monascus pigment production. T. atroroseus PKS11 is delivering a precursor for both the mitorubrins and the Monascus pigments. Based on this finding we propose hypothetical models for the evolution of azaphilone pigment PKS clusters in Talaromyces......Talaromyces atroroseus is an efficient producer of red Monascus pigments. We genome sequenced Talaromyces atroroseus IBT11181 and found it to lack the Monascus pigment PKS with the rest of the Monascus pigment cluster intact. The PKS closest related to the Monascus pigment PKS is the mitorubrin PKS...

  1. MULTI-WAVELENGTH OBSERVATIONS OF THE FLARING GAMMA-RAY BLAZAR 3C 66A IN 2008 OCTOBER

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Borgland, A. W.; Bouvier, A.; Buehler, R.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Buson, S.; Bonamente, E.; Brigida, M.; Bruel, P.

    2011-01-01

    The BL Lacertae object 3C 66A was detected in a flaring state by the Fermi Large Area Telescope (LAT) and VERITAS in 2008 October. In addition to these gamma-ray observations, F-GAMMA, GASP-WEBT, PAIRITEL, MDM, ATOM, Swift, and Chandra provided radio to X-ray coverage. The available light curves show variability and, in particular, correlated flares are observed in the optical and Fermi-LAT gamma-ray band. The resulting spectral energy distribution can be well fitted using standard leptonic models with and without an external radiation field for inverse Compton scattering. It is found, however, that only the model with an external radiation field can accommodate the intra-night variability observed at optical wavelengths.

  2. A Search for QPOs in the Blazar OJ287: Preliminary Results from the 2015/2016 Observing Campaign

    Czech Academy of Sciences Publication Activity Database

    Zola, S.; Valtonen, M.J.; Bhatta, G.; Goyal, A.; Debski, B.; Baran, A.; Krzesinski, J.; Siwak, M.; Ciprini, S.; Gopakumar, A.; Hudec, René; Jelínek, Martin; Štrobl, Jan

    2016-01-01

    Roč. 4, č. 4 (2016), 41/1-41/7 E-ISSN 2075-4434 Grant - others:GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : active galaxies * BL Lacertae objects * supermassive black holes Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  3. X-ray Time Lags in TeV Blazars X. Chen1,∗ , G. Fossati1, E. Liang1 ...

    Indian Academy of Sciences (India)

    Abstract. We use Monte Carlo/Fokker–Planck simulations to study the. X-ray time lags. Our results show that soft lags will be observed as long as the decay of the flare is dominated by radiative cooling, even when acceleration and cooling time scales are similar. Hard lags can be pro- duced in the presence of a competitive ...

  4. The global land-potential knowledge system (LandPKS): Supporting evidence-based, site-specific land use and management through cloud computing, mobile applications and crowdsourcing

    Science.gov (United States)

    Agricultural production must increase significantly to meet the needs of a growing global population with increasing per capita consumption of food, fiber, building materials, and fuel. Consumption already exceeds net primary production in many parts of the world. In addition to reducing consumptio...

  5. Genome mining reveals high incidence of putative lipopeptide biosynthesis NRPS/PKS clusters containing fatty acyl-AMP ligase genes inbiofilm-forming cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Galica, Tomáš; Hrouzek, Pavel; Mareš, Jan

    2017-01-01

    Roč. 53, č. 5 (2017), s. 985-998 ISSN 0022-3646 R&D Projects: GA ČR(CZ) GA16-09381S; GA MŠk(CZ) LO1416; GA MŠk(CZ) ED2.1.00/19.0392 Institutional support: RVO:61388971 Keywords : cyanobacteria * fatty-acyl AMP ligase * genome mining Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.608, year: 2016

  6. Genome mining reveals high incidence of putative lipopeptide biosynthesis NRPS/PKS clusters containing fatty acyl-AMP ligase genes inbiofilm-forming cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Galica, Tomáš; Hrouzek, P.; Mareš, Jan

    2017-01-01

    Roč. 53, č. 5 (2017), s. 985-998 ISSN 0022-3646 R&D Projects: GA ČR(CZ) GA16-09381S Institutional support: RVO:60077344 Keywords : cyanobacteria * fatty-acyl AMP ligase * genome mining * lipopeptides * microbial biofilm Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.608, year: 2016

  7. First discovery of two polyketide synthase genes for mitorubrinic acid and mitorubrinol yellow pigment biosynthesis and implications in virulence of Penicillium marneffei.

    Directory of Open Access Journals (Sweden)

    Patrick C Y Woo

    Full Text Available BACKGROUND: The genome of P. marneffei, the most important thermal dimorphic fungus causing respiratory, skin and systemic mycosis in China and Southeast Asia, possesses 23 polyketide synthase (PKS genes and 2 polyketide synthase nonribosomal peptide synthase hybrid (PKS-NRPS genes, which is of high diversity compared to other thermal dimorphic pathogenic fungi. We hypothesized that the yellow pigment in the mold form of P. marneffei could also be synthesized by one or more PKS genes. METHODOLOGY/PRINCIPAL FINDINGS: All 23 PKS and 2 PKS-NRPS genes of P. marneffei were systematically knocked down. A loss of the yellow pigment was observed in the mold form of the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants. Sequence analysis showed that PKS11 and PKS12 are fungal non-reducing PKSs. Ultra high performance liquid chromatography-photodiode array detector/electrospray ionization-quadruple time of flight-mass spectrometry (MS and MS/MS analysis of the culture filtrates of wild type P. marneffei and the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants showed that the yellow pigment is composed of mitorubrinic acid and mitorubrinol. The survival of mice challenged with the pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants was significantly better than those challenged with wild type P. marneffei (P<0.05. There was also statistically significant decrease in survival of pks11 knockdown, pks12 knockdown and pks11pks12 double knockdown mutants compared to wild type P. marneffei in both J774 and THP1 macrophages (P<0.05. CONCLUSIONS/SIGNIFICANCE: The yellow pigment of the mold form of P. marneffei is composed of mitorubrinol and mitorubrinic acid. This represents the first discovery of PKS genes responsible for mitorubrinol and mitorubrinic acid biosynthesis. pks12 and pks11 are probably responsible for sequential use in the biosynthesis of mitorubrinol and mitorubrinic acid

  8. Identification of a polyketide synthase required for alternariol (AOH and alternariol-9-methyl ether (AME formation in Alternaria alternata.

    Directory of Open Access Journals (Sweden)

    Debjani Saha

    Full Text Available Alternaria alternata produces more than 60 secondary metabolites, among which alternariol (AOH and alternariol-9-methyl ether (AME are important mycotoxins. Whereas the toxicology of these two polyketide-based compounds has been studied, nothing is known about the genetics of their biosynthesis. One of the postulated core enzymes in the biosynthesis of AOH and AME is polyketide synthase (PKS. In a draft genome sequence of A. alternata we identified 10 putative PKS-encoding genes. The timing of the expression of two PKS genes, pksJ and pksH, correlated with the production of AOH and AME. The PksJ and PksH proteins are predicted to be 2222 and 2821 amino acids in length, respectively. They are both iterative type I reducing polyketide synthases. PksJ harbors a peroxisomal targeting sequence at the C-terminus, suggesting that the biosynthesis occurs at least partly in these organelles. In the vicinity of pksJ we found a transcriptional regulator, altR, involved in pksJ induction and a putative methyl transferase, possibly responsible for AME formation. Downregulation of pksJ and altR caused a large decrease of alternariol formation, suggesting that PksJ is the polyketide synthase required for the postulated Claisen condensations during the biosynthesis. No other enzymes appeared to be required. PksH downregulation affected pksJ expression and thus caused an indirect effect on AOH production.

  9. Identification and functional characterization of three type III polyketide synthases from Aquilaria sinensis calli

    International Nuclear Information System (INIS)

    Wang, Xiaohui; Zhang, Zhongxiu; Dong, Xianjuan; Feng, Yingying; Liu, Xiao; Gao, Bowen; Wang, Jinling; Zhang, Le; Wang, Juan; Shi, Shepo; Tu, Pengfei

    2017-01-01

    Type III polyketide synthases (PKSs) play an important role in biosynthesis of various plant secondary metabolites and plant adaptation to environmental stresses. Aquilaria sinensis (A. sinensis) is the main plant species for production of agarwood, little is known about its PKS family. In this study, AsCHS1 and two new type III PKSs, AsPKS1 and AsPKS2, were isolated and characterized in A. sinensis calli. The comparative sequence and phylogenetic analysis indicated that AsPKS1 and AsPKS2 belonged to non-CHS group different from AsCHS1. The recombinant AsPKS1 and AsPKS2 produced the lactone-type products, suggesting their different enzyme activities from AsCHS1. Three PKS genes had a tissues-specific pattern in A. sinensis. Moreover, we examined the expression profiles of three PKS genes in calli under different abiotic stresses and hormone treatments. AsCHS1 transcript was most significantly induced by salt stress, AsPKS1 abundance was most remarkably enhanced by CdCl 2 treatment, while AsPKS2 expression was most significantly induced by mannitol treatment. Furthermore, AsCHS1, AsPKS1 and AsPKS2 expression was enhanced upon gibberellins (GA3), methyl jasmonate (MeJA), or salicylic acid (SA) treatment, while three PKS genes displayed low transcript levels at the early stage under abscisic acid (ABA) treatment. In addition, three GFP:PKSs fusion proteins were localized in the cytoplasm and cell wall in Nicotiana benthamiana cells. These results indicated the multifunctional role of three type III PKSs in polyketide biosynthesis, plant resistance to abiotic stresses and signal transduction. - Highlights: • Two new PKS genes (AsPKS1 and AsPKS2) were isolated and characterized from A. sinensis. • The recombinant AsPKS1 and AsPKS2 catalyzed lactone-type products in vitro. • AsCHS1, AsPKS1 and AsPKS2 were involved in plant responses to abiotic stresses and hormone stimuli. • Our results also indicated that AsCHS1, AsPKS1 and AsPKS2 were predominantly localized

  10. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A

  11. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A

  12. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis... Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis pdb|1TED|A Chain ... A..., Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculosis emb|C... pdb|1TED|C Chain ... C, Crystal Structure Of A Type Iii Polyketide Synthase ... Pks18 From Mycobacterium Tuberculos...is pdb|1TED|B Chain ... B, Crystal Structure Of A

  13. On the Redshift of TeV BL Lac Objects

    Energy Technology Data Exchange (ETDEWEB)

    Paiano, Simona; Falomo, Renato [INAF, Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5 I-35122 Padova (PD) (Italy); Landoni, Marco; Righi, Chiara [INAF, Osservatorio Astronomico di Brera, Via E. Bianchi 46 I-23807 Merate (Italy); Treves, Aldo [Università degli Studi dell’Insubria, Via Valleggio 11 I-22100 Como (Italy); Scarpa, Riccardo [Instituto de Astrofisica de Canarias, C/O Via Lactea, s/n E38205—La Laguna (Tenerife) (Spain)

    2017-03-10

    We report results of a spectroscopic campaign carried out at the 10 m Gran Telescopio Canarias for a sample of 22 BL Lac objects detected (or candidates) at TeV energies, aiming to determine or constrain their redshift. This is of fundamental importance for the interpretation of their emission models and for population studies and is also mandatory for studying the interaction of high-energy photons with the extragalactic background light using TeV sources. Optical spectra with high signal-to-noise ratios in the range 4250–10000 Å were obtained to search for faint emission or absorption lines from both the host galaxy and the nucleus. We determine a new redshift for PKS 1424+240 ( z = 0.604) and a tentative one for 1ES 0033+595 ( z = 0.467). We are able to set new spectroscopic redshift lower limits for three other sources on the basis of Mg ii and Ca ii intervening absorption features: BZB J1243+3627 ( z > 0.483), BZB J1540+8155 ( z > 0.672), and BZB 0J2323+4210 ( z > 0.267). We confirm previous redshift estimates for four blazars: S3 0218+357 ( z = 0.944), 1ES 1215+303 ( z = 0.129), W Comae ( z = 0.102), and MS 1221.8+2452 ( z = 0.218). For the remaining targets, in seven cases (S2 0109+22, 3C 66A, VER J0521+211, S4 0954+65, BZB J1120+4214, S3 1227+25, BZB J2323+4210), we do not validate the proposed redshift. Finally, for all sources of still-unknown redshift, we set a lower limit based on the minimum equivalent width of absorption features expected from the host galaxy.

  14. Search for GeV and X-Ray Flares Associated with the IceCube Track-like Neutrinos

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Fang-Kun; Wang, Xiang-Yu, E-mail: xywang@nju.edu.cn [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China)

    2017-02-01

    Dozens of high-energy neutrinos have been detected by the IceCube neutrino telescope, but no clear association with any classes of astrophysical sources has been identified so far. Recently, Kadler et al. reported that a PeV cascade-like neutrino event occurred in positional and temporal coincidence with a giant gamma-ray flare of the blazar PKS B1424-418. Since IceCube track-like events have much better angular resolution, we here search for possible short-term gamma-ray flares that are associated with the IceCube track-like events with Fermi Large Area Telescope (LAT) observations. Among them, three track-like neutrino events occur within the field of view of Fermi -LAT at the time of the detection, so searching for the prompt gamma-ray emission associated with neutrinos is possible. Assuming a point source origin and a single power-law spectrum for the possible gamma-ray sources associated with neutrinos, a likelihood analysis of 0.2–100 GeV photons observed by Fermi -LAT on the timescales of ∼12 hr and one year are performed, and for the three special neutrinos, the analyses are also performed on the timescales of thousands of seconds before and after the neutrino detection. No significant GeV excesses over the background are found and upper limit fluxes at the 95% confidence level are obtained for different timescales. We also search for possible the Swift hard X-ray transient sources associated with the IceCube track-like neutrino events, but the search also yields null results. We discuss the implication of the non-detection of gamma-ray flares for the constraints on the neutrino source density.

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... In this paper, we review the latest research results on the topic of blazar sequence. It seems that the blazar sequence is phenomenally ruled out, while the theoretical blazar sequence still holds. We point out that black hole mass is a dominated parameter accounting for high-power-high-synchrotron-peaked ...

  16. Probing the very-high-energy gamma-ray spectral curvature in the blazar PG 1553+113 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L

    2015-01-01

    PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.

  17. R-band host galaxy contamination of TeV γ-ray blazar Mrk 501: effects of aperture size and seeing

    Science.gov (United States)

    Feng, Hai-Cheng; Liu, Hong-Tao; Zhao, Ying-He; Bai, Jin-Ming; Wang, Fang; Fan, Xu-Liang

    2018-02-01

    We simulated the R-band contribution of the host galaxy of TeV γ-ray BL Lac object Mrk 501 in different aperture sizes and seeing conditions. An intensive set of observations was acquired with the 1.02 m optical telescope, managed by Yunnan Observatories, from 2010 May 15 to 18. Based on the host subtraction data usually used in the literature, the subtraction of host galaxy contamination results in significant seeing-brightness correlations. These correlations would lead to illusive large amplitude variations at short timescales, which will mask the intrinsic microvariability, thus giving rise to difficulty in detecting the intrinsic microvariability. Both aperture size and seeing condition influence the flux measurements, but the aperture size impacts the result more significantly. Based on the parameters of an elliptical galaxy provided in the literature, we simulated the host contributions of Mrk 501 in different aperture sizes and seeing conditions. Our simulation data of the host galaxy obviously weaken these significant seeing-brightness correlations for the host-subtracted brightness of Mrk 501, and can help us discover the intrinsic short timescale microvariability. The pure nuclear flux is ∼8.0mJy in the R band, i.e., the AGN has a magnitude of R ∼ 13.96 mag.

  18. FLARE-LIKE VARIABILITY OF THE Mg II {lambda}2800 EMISSION LINE IN THE {gamma}-RAY BLAZAR 3C 454.3

    Energy Technology Data Exchange (ETDEWEB)

    Leon-Tavares, J. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Vaeisaelaentie 20, FI-21500 Piikkioe (Finland); Chavushyan, V.; Patino-Alvarez, V.; Carraminana, A.; Carrasco, L. [Instituto Nacional de Astrofisica Optica y Electronica (INAOE), Apartado Postal 51 y 216, 72000 Puebla (Mexico); Valtaoja, E. [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, FI-20100 Turku (Finland); Arshakian, T. G. [I. Physikalisches Institut, Universitaet zu Koeln, Zuelpicher Str. 77, D-50937 Koeln (Germany); Popovic, L. C. [Astronomical Observatory, Volgina 7, 11160 Belgrade 74 (Serbia); Tornikoski, M.; Laehteenmaeki, A. [Aalto University Metsaehovi Radio Observatory, Metsaehovintie 114, FI-02540 Kylmaelae (Finland); Lobanov, A. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany)

    2013-02-01

    We report the detection of a statistically significant flare-like event in the Mg II {lambda}2800 emission line of 3C 454.3 during the outburst of autumn 2010. The highest levels of emission line flux recorded over the monitoring period (2008-2011) coincide with a superluminal jet component traversing through the radio core. This finding crucially links the broad emission line fluctuations to the non-thermal continuum emission produced by relativistically moving material in the jet and hence to the presence of broad-line region clouds surrounding the radio core. If the radio core were located at several parsecs from the central black hole, then our results would suggest the presence of broad-line region material outside the inner parsec where the canonical broad-line region is envisaged to be located. We briefly discuss the implications of broad emission line material ionized by non-thermal continuum in the context of virial black hole mass estimates and gamma-ray production mechanisms.

  19. First detection of very-high-energy gamma-ray emission from the extreme blazar PGC 2402248 with the MAGIC telescopes

    Science.gov (United States)

    Mirzoyan, Razmik

    2018-04-01

    The MAGIC collaboration reports the first detection of very-high-energy (VHE; E > 100 GeV) gamma-ray emission from PGC 2402248, also known as 2WHSP J073326.7+515354 (Chang et al. 2016, A & A, 598, A17) with coordinates R.A.: 07:33:26.7 h, Dec: +51:53:54.99 deg. The source is classified as an extreme high-energy peaked BL Lacertae object of unknown redshift, included in the 2WHSP catalog with a synchrotron peak located at 10^17.9 Hz. PGC 2402248 was observed with the MAGIC telescopes from 2018/01/23 to 2018/04/18 (MJD 58141-58226) for about 23 h. The preliminary analysis of these data resulted in the detection of PGC 2402248 with a statistical significance of more than 6 standard deviations.

  20. PKS’ DEMOCRATIC EXPERIENCES IN RECRUITING MEMBERS AND LEADERS

    Directory of Open Access Journals (Sweden)

    Ahmad Ali Nurdin

    2011-08-01

    Full Text Available This paper focuses on the views of democracy and the implementation of democratic rules in real politics by the Islamic political party that has a democracy platform in Indonesia, Partai Keadilan Sejahtera (PKS. I examine PKS views on the relationship between Islam and democracy and its manner of recruiting members and leaders to show that this Islamic political party is not a threat to democracy at all. PKS believes that democracy goes to the roots of Islam and the Indonesian context in which they exist; and that it is a good political tool for an Islamic party like PKS to achieve its political goals. Taking the process of recruitment of members and leaders of PKS as examples, the paper also shows that the commitment of PKS to strengthening democracy in Indonesia could be seen in their process of recruiting leaders. PKS has practiced democratic rules in their internal party activities, particularly in the way they used to recruit their members who would be nominated as parliamentary members and how they choose their own leaders. However, it is necessary to note that in terms of member recruitment and expanding the cadres of the party, the PKS seems to have a special strategy; that is, encouraging their cadres to have big families. [Artikel mengulas pandangan Partai Keadilan Sejahtera (PKS mengenai demokrasi dan implementasi nilai-nilai demokrasi dalam kehidupan politik. Dalam artikel ini, relasi Islam dan demokrasi serta metode PKS dalam merekrut anggota dan pemimpin partai akan dibahas. PKS sama sekali bukanlah ancaman bagi demokrasi. PKS percaya bahwa prinsip demokrasidapat ditemukan dalam Islam dan konteks Indonesia. Bagi PKS, demokrasi membuka ruang kesempatan bagi partai politik Islam untuk mencapai tujuan politiknya. Selain itu, artikel ini juga mengulas proses rekrutmen anggota dan pemimpin partai. Rekrutmen petinggi PKS memperlihatkan komitmen PKS terhadap penguatan demokrasi di Indonesia. PKS sudah mempraktekkan prinsip demokrasi dalam

  1. Bioinformatics Prediction of Polyketide Synthase Gene Clusters from Mycosphaerella fijiensis.

    Science.gov (United States)

    Noar, Roslyn D; Daub, Margaret E

    2016-01-01

    Mycosphaerella fijiensis, causal agent of black Sigatoka disease of banana, is a Dothideomycete fungus closely related to fungi that produce polyketides important for plant pathogenicity. We utilized the M. fijiensis genome sequence to predict PKS genes and their gene clusters and make bioinformatics predictions about the types of compounds produced by these clusters. Eight PKS gene clusters were identified in the M. fijiensis genome, placing M. fijiensis into the 23rd percentile for the number of PKS genes compared to other Dothideomycetes. Analysis of the PKS domains identified three of the PKS enzymes as non-reducing and two as highly reducing. Gene clusters contained types of genes frequently found in PKS clusters including genes encoding transporters, oxidoreductases, methyltransferases, and non-ribosomal peptide synthases. Phylogenetic analysis identified a putative PKS cluster encoding melanin biosynthesis. None of the other clusters were closely aligned with genes encoding known polyketides, however three of the PKS genes fell into clades with clusters encoding alternapyrone, fumonisin, and solanapyrone produced by Alternaria and Fusarium species. A search for homologs among available genomic sequences from 103 Dothideomycetes identified close homologs (>80% similarity) for six of the PKS sequences. One of the PKS sequences was not similar (< 60% similarity) to sequences in any of the 103 genomes, suggesting that it encodes a unique compound. Comparison of the M. fijiensis PKS sequences with those of two other banana pathogens, M. musicola and M. eumusae, showed that these two species have close homologs to five of the M. fijiensis PKS sequences, but three others were not found in either species. RT-PCR and RNA-Seq analysis showed that the melanin PKS cluster was down-regulated in infected banana as compared to growth in culture. Three other clusters, however were strongly upregulated during disease development in banana, suggesting that they may encode

  2. Bioinformatics Prediction of Polyketide Synthase Gene Clusters from Mycosphaerella fijiensis.

    Directory of Open Access Journals (Sweden)

    Roslyn D Noar

    Full Text Available Mycosphaerella fijiensis, causal agent of black Sigatoka disease of banana, is a Dothideomycete fungus closely related to fungi that produce polyketides important for plant pathogenicity. We utilized the M. fijiensis genome sequence to predict PKS genes and their gene clusters and make bioinformatics predictions about the types of compounds produced by these clusters. Eight PKS gene clusters were identified in the M. fijiensis genome, placing M. fijiensis into the 23rd percentile for the number of PKS genes compared to other Dothideomycetes. Analysis of the PKS domains identified three of the PKS enzymes as non-reducing and two as highly reducing. Gene clusters contained types of genes frequently found in PKS clusters including genes encoding transporters, oxidoreductases, methyltransferases, and non-ribosomal peptide synthases. Phylogenetic analysis identified a putative PKS cluster encoding melanin biosynthesis. None of the other clusters were closely aligned with genes encoding known polyketides, however three of the PKS genes fell into clades with clusters encoding alternapyrone, fumonisin, and solanapyrone produced by Alternaria and Fusarium species. A search for homologs among available genomic sequences from 103 Dothideomycetes identified close homologs (>80% similarity for six of the PKS sequences. One of the PKS sequences was not similar (< 60% similarity to sequences in any of the 103 genomes, suggesting that it encodes a unique compound. Comparison of the M. fijiensis PKS sequences with those of two other banana pathogens, M. musicola and M. eumusae, showed that these two species have close homologs to five of the M. fijiensis PKS sequences, but three others were not found in either species. RT-PCR and RNA-Seq analysis showed that the melanin PKS cluster was down-regulated in infected banana as compared to growth in culture. Three other clusters, however were strongly upregulated during disease development in banana, suggesting that

  3. Hybrid polyketide synthases

    Energy Technology Data Exchange (ETDEWEB)

    Fortman, Jeffrey L.; Hagen, Andrew; Katz, Leonard; Keasling, Jay D.; Poust, Sean; Zhang, Jingwei; Zotchev, Sergey

    2016-05-10

    The present invention provides for a polyketide synthase (PKS) capable of synthesizing an even-chain or odd-chain diacid or lactam or diamine. The present invention also provides for a host cell comprising the PKS and when cultured produces the even-chain diacid, odd-chain diacid, or KAPA. The present invention also provides for a host cell comprising the PKS capable of synthesizing a pimelic acid or KAPA, and when cultured produces biotin.

  4. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available HTH-type ... transcriptional regulator pksA ... Length = 182 ... Query: 8 ... EKRRKQIAEATWRVILERGME...GASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 67 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAM...KLVQEK Sbjct: 1 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 60

  5. The lignin pyrolysis composition and pyrolysis products of palm kernel shell, wheat straw, and pine sawdust

    International Nuclear Information System (INIS)

    Chang, Guozhang; Huang, Yanqin; Xie, Jianjun; Yang, Huikai; Liu, Huacai; Yin, Xiuli; Wu, Chuangzhi

    2016-01-01

    Highlights: • The primarily pyrolysis composition of PKS lignin was p-hydroxyphenyl unit. • Higher phenol yield and lower gas energy yield were obtained from PKS pyrolysis. • PKS produced more bio-oil and biochar than WS and PS from pyrolysis at 650–850 °C. • PKS-char had poorer gasification reactivity due to higher ordering carbon degree. - Abstract: The lignin monomer composition of palm kernel shell (PKS) was characterized using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), and the characteristics and distributions of products obtained from PKS pyrolysis were investigated using Py-GC/MS, GC, and a specially designed pyrolysis apparatus. The gasification reactivity of PKS biochar was also characterized using thermogravimetry (TG) and Raman spectroscopy. All the results were compared with those obtained from wheat straw (WS) and pine sawdust (PS). The results showed that PKS lignin is primarily composed of p-hydroxyphenyl structural units, while WS and PS lignins are mainly made up of guaiacyl units. Both the mass and energy yields of non-condensable gases from PKS pyrolysis were lower than those obtained from WS and PS pyrolysis at 650–850 °C, owing to the lower volatile content (75.21%) and lack of methoxy groups in PKS. Compared with WS and PS, higher bio-oil productivity was observed during PKS pyrolysis. Phenols were the main component of PKS bio-oil from pyrolysis at 500 °C, and the phenol content of PKS bio-oil (13.49%) was higher than in WS bio-oil (1.62%) and PS bio-oil (0.55%). A higher yield of biochar (on an ash-free basis) was also obtained from PKS pyrolysis. Because of its greater relative degree of ordered carbon, PKS biochar exhibited lower in situ reactivity during CO_2 or H_2O gasification than WS and PS biochars. A longer residence time and addition of steam were found to be beneficial during PKS biochar gasification.

  6. Comparative analysis of the kinomes of three pathogenic trypanosomatids: Leishmania major, Trypanosoma brucei and Trypanosoma cruzi

    Directory of Open Access Journals (Sweden)

    Ward Pauline N

    2005-09-01

    Full Text Available Abstract Background The trypanosomatids Leishmania major, Trypanosoma brucei and Trypanosoma cruzi cause some of the most debilitating diseases of humankind: cutaneous leishmaniasis, African sleeping sickness, and Chagas disease. These protozoa possess complex life cycles that involve development in mammalian and insect hosts, and a tightly coordinated cell cycle ensures propagation of the highly polarized cells. However, the ways in which the parasites respond to their environment and coordinate intracellular processes are poorly understood. As a part of an effort to understand parasite signaling functions, we report the results of a genome-wide analysis of protein kinases (PKs of these three trypanosomatids. Results Bioinformatic searches of the trypanosomatid genomes for eukaryotic PKs (ePKs and atypical PKs (aPKs revealed a total of 176 PKs in T. brucei, 190 in T. cruzi and 199 in L. major, most of which are orthologous across the three species. This is approximately 30% of the number in the human host and double that of the malaria parasite, Plasmodium falciparum. The representation of various groups of ePKs differs significantly as compared to humans: trypanosomatids lack receptor-linked tyrosine and tyrosine kinase-like kinases, although they do possess dual-specificity kinases. A relative expansion of the CMGC, STE and NEK groups has occurred. A large number of unique ePKs show no strong affinity to any known group. The trypanosomatids possess few ePKs with predicted transmembrane domains, suggesting that receptor ePKs are rare. Accessory Pfam domains, which are frequently present in human ePKs, are uncommon in trypanosomatid ePKs. Conclusion Trypanosomatids possess a large set of PKs, comprising approximately 2% of each genome, suggesting a key role for phosphorylation in parasite biology. Whilst it was possible to place most of the trypanosomatid ePKs into the seven established groups using bioinformatic analyses, it has not been

  7. ClusterCAD: a computational platform for type I modular polyketide synthase design

    DEFF Research Database (Denmark)

    Eng, Clara H.; Backman, Tyler W. H.; Bailey, Constance B.

    2018-01-01

    barrier to the design of active variants, and identifying strategies to reliably construct functional PKS chimeras remains an active area of research. In this work, we formalize a paradigm for the design of PKS chimeras and introduce ClusterCAD as a computational platform to streamline and simplify...

  8. Isolation and expression of two polyketide synthase genes from Trichoderma harzianum 88 during mycoparasitism.

    Science.gov (United States)

    Yao, Lin; Tan, Chong; Song, Jinzhu; Yang, Qian; Yu, Lijie; Li, Xinling

    2016-01-01

    Metabolites of mycoparasitic fungal species such as Trichoderma harzianum 88 have important biological roles. In this study, two new ketoacyl synthase (KS) fragments were isolated from cultured Trichoderma harzianum 88 mycelia using degenerate primers and analysed using a phylogenetic tree. The gene fragments were determined to be present as single copies in Trichoderma harzianum 88 through southern blot analysis using digoxigenin-labelled KS gene fragments as probes. The complete sequence analysis in formation of pksT-1 (5669bp) and pksT-2 (7901bp) suggests that pksT-1 exhibited features of a non-reducing type I fungal PKS, whereas pksT-2 exhibited features of a highly reducing type I fungal PKS. Reverse transcription polymerase chain reaction indicated that the isolated genes are differentially regulated in Trichoderma harzianum 88 during challenge with three fungal plant pathogens, which suggests that they participate in the response of Trichoderma harzianum 88 to fungal plant pathogens. Furthermore, disruption of the pksT-2 encoding ketosynthase-acyltransferase domains through Agrobacterium-mediated gene transformation indicated that pksT-2 is a key factor for conidial pigmentation in Trichoderma harzianum 88. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  9. Unification of Active Galactic Nuclei at X-rays and soft gamma-rays

    International Nuclear Information System (INIS)

    Beckmann, Volker

    2010-01-01

    . Thus other sources outside the parameter space observable by these missions have to contribute significantly to the cosmic X-ray background. Our work on the luminosity function triggered several other studies on this issue. The subsequent derived luminosity functions by other groups (Sazonov et al. 2007; Tueller et al. 2008; Paltani et al. 2008) are consistent with our findings. This also gave rise to an increased interest in the exact shape of the Cosmic X-ray background around its peak at 30 keV, triggering several attempts to a new measurement. Background studies were presented based on a Earth-occultation observation by INTEGRAL (Churazov et al. 2007, 2008; Turler et al. 2010) and by Swift (Ajello et al. 2008). The understanding of the emission processes in AGN requires knowledge over a wide range of the spectral energy distribution (SED). In studies using CGRO/EGRET and Fermi/LAT data I derived the SED for blazars and non-blazars towards the gamma-ray range (Beckmann 2003; Beckmann et al. 2004b, 2010b). The work on the LAT data not only presented the gamma-ray detection of five gamma-ray blazars (QSO B0836+710, RX J1111.5+3452, H 1426+428, RX J1924.8-2914, and PKS 2149-306) for the first time, but also showed the potential in the combination of INTEGRAL and Fermi data. In the case of Cen A I derived the total energy output of the inverse Compton component based on the combined LAT, ISGRI, and JEM-X data, showing evidence for a spectral break at several hundred keV (Beckmann et al. 2010b). In addition I successfully showed that gamma-ray blazars can be predicted through the study of their synchrotron branch at energies below 2 keV (Beckmann 2003 and this work). (author)

  10. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Radio Variability of First 3-Month Fermi Blazars at 5 GHz: Affected by ... A Visual Method of Time Scale Determination using a PC for Radio Sources .... The analysis tools incorporate different noise models with significant levels for all the ..... Multi-Frequency Observations of Gamma-Ray Blazar 1633+382.

  11. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Blazar Observations in Infrared and Optical. Methods for the Quasi-Periodic Variability Analysis in Blazars ... Astronomy Education for Physics Students · J. H. Fan J. S. Zhang J. Y. Zhang Y. Liu H. G. Wang .... Training in Astronomy for Physics Students · J. H. Fan · More Details Abstract Fulltext PDF.

  12. The Correlation between γ-Ray and Radio Emissions for the Fermi ...

    Indian Academy of Sciences (India)

    Abstract. Based upon the Fermi blazars sample, the radio and γ-ray emissions are compiled for a sample of 74 γ-ray loud blazars to calculate the radio to γ-ray effective spectrum index αRγ . The correlations between. αRγ and γ-ray luminosity, and between radio and γ-ray luminosity are also investigated. Key words.

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    eral methods. The parameters of the binary black hole system OJ 287 are determined. Key words. AGNs—Blazars (BL Lacertae objects-BLs & Flat Spectrum. Radio Quasars)—continuum. 1. Introduction. The term 'blazar' coined by Ed Spiegel refers to BL Lacertae objects (BLs) and flat spectrum radio quasars (FSRQs).

  14. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Any quasi-periodic variations discovered in blazar light curves would contain important information on the location and nature of the processes within the emission regions. In non-blazar active galactic nuclei, particularly Seyfert galaxies, any such fluctuations are very likely to be associated with the ...

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Estimating black hole masses of blazars is still a big challenge. Because of the contamination of jets, using the previously suggested size–continuum luminosity relation can overestimate the broad line region (BLR) size and black hole mass for radio-loud AGNs, including blazars. We propose a new relation ...

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... It is well established that blazars show flux variations in the complete electromagnetic (EM) spectrum on all possible time scales ranging from a few tens of minutes to several years. Here, we report the review of optical flux and spectral variability properties of different classes of blazars on IDV and STV ...

  17. Correlation between Spectral Index and Doppler Factor for a ...

    Indian Academy of Sciences (India)

    Abstract. Relativistic beaming effect is important for blazars. In a very recent work, γ-ray Doppler factors were calculated for a sample of Fermi blazars (Fan et al. 2013). In this work, we investigated the correlation between the Doppler factor and the effective spectral index, αOX, and found an anticorrelation between them.

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. J. Tao. Articles written in Journal of Astrophysics and Astronomy. Volume 32 Issue 1-2 March-June 2011 pp 67-71 Part 2. Blazar Observations in Infrared and Optical. Variability of Blazars · J. H. Fan Y. Liu Y. Li Q. F. Zhang J. Tao O. Kurtanidze.

  19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Relativistic beaming effect is important for blazars. In a very recent work, -ray Doppler factors were calculated for a sample of Fermi blazars (Fan et al. 2013). In this work, we investigated the correlation between the Doppler factor and the effective spectral index, 4OX, and found an anticorrelation ...

  20. SOS2-LIKE PROTEIN KINASE5, an SNF1-RELATED PROTEIN KINASE3-Type Protein Kinase, Is Important for Abscisic Acid Responses in Arabidopsis through Phosphorylation of ABSCISIC ACID-INSENSITIVE51[OPEN

    Science.gov (United States)

    Zhou, Xiaona; Hao, Hongmei; Zhang, Yuguo; Bai, Yili; Zhu, Wenbo; Qin, Yunxia; Yuan, Feifei; Zhao, Feiyi; Wang, Mengyao; Hu, Jingjiang; Xu, Hong; Guo, Aiguang; Zhao, Huixian; Zhao, Yang; Cao, Cuiling; Yang, Yongqing; Schumaker, Karen S.; Guo, Yan; Xie, Chang Gen

    2015-01-01

    Abscisic acid (ABA) plays an essential role in seed germination. In this study, we demonstrate that one SNF1-RELATED PROTEIN KINASE3-type protein kinase, SOS2-LIKE PROTEIN KINASE5 (PKS5), is involved in ABA signal transduction via the phosphorylation of an interacting protein, ABSCISIC ACID-INSENSITIVE5 (ABI5). We found that pks5-3 and pks5-4, two previously identified PKS5 superactive kinase mutants with point mutations in the PKS5 FISL/NAF (a conserved peptide that is necessary for interaction with SOS3 or SOS3-LIKE CALCIUM BINDING PROTEINs) motif and the kinase domain, respectively, are hypersensitive to ABA during seed germination. PKS5 was found to interact with ABI5 in yeast (Saccharomyces cerevisiae), and this interaction was further confirmed in planta using bimolecular fluorescence complementation. Genetic studies revealed that ABI5 is epistatic to PKS5. PKS5 phosphorylates a serine (Ser) residue at position 42 in ABI5 and regulates ABA-responsive gene expression. This phosphorylation was induced by ABA in vivo and transactivated ABI5. Expression of ABI5, in which Ser-42 was mutated to alanine, could not fully rescue the ABA-insensitive phenotypes of the abi5-8 and pks5-4abi5-8 mutants. In contrast, mutating Ser-42 to aspartate rescued the ABA insensitivity of these mutants. These data demonstrate that PKS5-mediated phosphorylation of ABI5 at Ser-42 is critical for the ABA regulation of seed germination and gene expression in Arabidopsis (Arabidopsis thaliana). PMID:25858916

  1. Structural and evolutionary relationships of "AT-less" type I polyketide synthase ketosynthases.

    Science.gov (United States)

    Lohman, Jeremy R; Ma, Ming; Osipiuk, Jerzy; Nocek, Boguslaw; Kim, Youngchang; Chang, Changsoo; Cuff, Marianne; Mack, Jamey; Bigelow, Lance; Li, Hui; Endres, Michael; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N; Shen, Ben

    2015-10-13

    Acyltransferase (AT)-less type I polyketide synthases (PKSs) break the type I PKS paradigm. They lack the integrated AT domains within their modules and instead use a discrete AT that acts in trans, whereas a type I PKS module minimally contains AT, acyl carrier protein (ACP), and ketosynthase (KS) domains. Structures of canonical type I PKS KS-AT didomains reveal structured linkers that connect the two domains. AT-less type I PKS KSs have remnants of these linkers, which have been hypothesized to be AT docking domains. Natural products produced by AT-less type I PKSs are very complex because of an increased representation of unique modifying domains. AT-less type I PKS KSs possess substrate specificity and fall into phylogenetic clades that correlate with their substrates, whereas canonical type I PKS KSs are monophyletic. We have solved crystal structures of seven AT-less type I PKS KS domains that represent various sequence clusters, revealing insight into the large structural and subtle amino acid residue differences that lead to unique active site topologies and substrate specificities. One set of structures represents a larger group of KS domains from both canonical and AT-less type I PKSs that accept amino acid-containing substrates. One structure has a partial AT-domain, revealing the structural consequences of a type I PKS KS evolving into an AT-less type I PKS KS. These structures highlight the structural diversity within the AT-less type I PKS KS family, and most important, provide a unique opportunity to study the molecular evolution of substrate specificity within the type I PKSs.

  2. Structural and evolutionary relationships of “AT-less” type I polyketide synthase ketosynthases

    Science.gov (United States)

    Lohman, Jeremy R.; Ma, Ming; Osipiuk, Jerzy; Nocek, Boguslaw; Kim, Youngchang; Chang, Changsoo; Cuff, Marianne; Mack, Jamey; Bigelow, Lance; Li, Hui; Endres, Michael; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N.; Shen, Ben

    2015-01-01

    Acyltransferase (AT)-less type I polyketide synthases (PKSs) break the type I PKS paradigm. They lack the integrated AT domains within their modules and instead use a discrete AT that acts in trans, whereas a type I PKS module minimally contains AT, acyl carrier protein (ACP), and ketosynthase (KS) domains. Structures of canonical type I PKS KS-AT didomains reveal structured linkers that connect the two domains. AT-less type I PKS KSs have remnants of these linkers, which have been hypothesized to be AT docking domains. Natural products produced by AT-less type I PKSs are very complex because of an increased representation of unique modifying domains. AT-less type I PKS KSs possess substrate specificity and fall into phylogenetic clades that correlate with their substrates, whereas canonical type I PKS KSs are monophyletic. We have solved crystal structures of seven AT-less type I PKS KS domains that represent various sequence clusters, revealing insight into the large structural and subtle amino acid residue differences that lead to unique active site topologies and substrate specificities. One set of structures represents a larger group of KS domains from both canonical and AT-less type I PKSs that accept amino acid-containing substrates. One structure has a partial AT-domain, revealing the structural consequences of a type I PKS KS evolving into an AT-less type I PKS KS. These structures highlight the structural diversity within the AT-less type I PKS KS family, and most important, provide a unique opportunity to study the molecular evolution of substrate specificity within the type I PKSs. PMID:26420866

  3. Structural and evolutionary relationships of "AT-less" type I polyketide synthase ketosynthases

    Energy Technology Data Exchange (ETDEWEB)

    Lohman, Jeremy; Ma, Ming; Osipiuk, Jerzy; Nocek, Boguslaw; Kim, Youngchang; Chang, Changsoo; Cuff, Marianne E.; Mack, Jamey; Bigelow, Lance; Li, Hui; Endres, Michael; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N.; Shen, B G

    2015-10-13

    Acyltransferase (AT)-less type I polyketide synthases (PKSs) break the type I PKS paradigm. They lack the integrated AT domains within their modules and instead use a discrete AT that acts in trans, whereas a type I PKS module minimally contains AT, acyl carrier protein (ACP), and ketosynthase (KS) domains. Structures of canonical type I PKS KS-AT didomains reveal structured linkers that connect the two domains. AT-less type I PKS KSs have remnants of these linkers, which have been hypothesized to be AT docking domains. Natural products produced by AT-less type I PKSs are very complex because of an increased representation of unique modifying domains. AT-less type I PKS KSs possess substrate specificity and fall into phylogenetic clades that correlate with their substrates, whereas canonical type I PKS KSs are monophyletic. We have solved crystal structures of seven AT-less type I PKS KS domains that represent various sequence clusters, revealing insight into the large structural and subtle amino acid residue differences that lead to unique active site topologies and substrate specificities. One set of structures represents a larger group of KS domains from both canonical and AT-less type I PKSs that accept amino acid-containing substrates. One structure has a partial AT-domain, revealing the structural consequences of a type I PKS KS evolving into an AT-less type I PKS KS. These structures highlight the structural diversity within the AT-less type I PKS KS family, and most important, provide a unique opportunity to study the molecular evolution of substrate specificity within the type I PKSs.

  4. The partial replacement of palm kernel shell by carbon black and halloysite nanotubes as fillers in natural rubber composites

    Science.gov (United States)

    Daud, Shuhairiah; Ismail, Hanafi; Bakar, Azhar Abu

    2017-07-01

    The effect of partial replacement of palm kernel shell powder by carbon black (CB) and halloysite nanotube (HNT) on the tensile properties, rubber-filler interaction, thermal properties and morphological studies of natural rubber (NR) composites were investigated. Four different compositions of NR/PKS/CB and NR/PKS/HNT composites i.e 20/0, 15/5, 10/10,5/15 and 0/20 parts per hundred rubber (phr) were prepared on a two roll mill. The results showed that the tensile strength and modulus at 100% elongation (M100) and 300% elongation (M300) were higher for NR/PKS/CB compared to NR/PKS/HNT composites. NR/PKS/CB composites had the lowest elongation at break (Eb). The effect of commercial fillers in NR/PKS composites on tensile properties was confirmed by the rubber-filler interaction and scanning electron microscopy (SEM) study. The thermal stability of PKS filled NR composites with partially replaced by commercial fillers also determined by Thermo gravimetric Analysis (TGA).

  5. Algal carbohydrates affect polyketide synthesis of the lichen-forming fungus Cladonia rangiferina.

    Science.gov (United States)

    Elshobary, Mostafa E; Osman, Mohamed E; Abo-Shady, Atef M; Komatsu, Emy; Perreault, Hélène; Sorensen, John; Piercey-Normore, Michele D

    2016-01-01

    Lichen secondary metabolites (polyketides) are produced by the fungal partner, but the role of algal carbohydrates in polyketide biosynthesis is not clear. This study examined whether the type and concentration of algal carbohydrate explained differences in polyketide production and gene transcription by a lichen fungus (Cladonia rangiferina). The carbohydrates identified from a free-living cyanobacterium (Spirulina platensis; glucose), a lichen-forming alga (Diplosphaera chodatii; sorbitol) and the lichen alga that associates with C. rangiferina (Asterochloris sp.; ribitol) were used in each of 1%, 5% and 10% concentrations to enrich malt yeast extract media for culturing the mycobiont. Polyketides were determined by high performance liquid chromatography (HPLC), and polyketide synthase (PKS) gene transcription was measured by quantitative PCR of the ketosynthase domain of four PKS genes. The lower concentrations of carbohydrates induced the PKS gene expression where ribitol up-regulated CrPKS1 and CrPKS16 gene transcription and sorbitol up-regulated CrPKS3 and CrPKS7 gene transcription. The HPLC results revealed that lower concentrations of carbon sources increased polyketide production for three carbohydrates. One polyketide from the natural lichen thallus (fumarprotocetraric acid) also was produced by the fungal culture in ribitol supplemented media only. This study provides a better understanding of the role of the type and concentration of the carbon source in fungal polyketide biosynthesis in the lichen Cladonia rangiferina. © 2016 by The Mycological Society of America.

  6. EKPD: a hierarchical database of eukaryotic protein kinases and protein phosphatases.

    Science.gov (United States)

    Wang, Yongbo; Liu, Zexian; Cheng, Han; Gao, Tianshun; Pan, Zhicheng; Yang, Qing; Guo, Anyuan; Xue, Yu

    2014-01-01

    We present here EKPD (http://ekpd.biocuckoo.org), a hierarchical database of eukaryotic protein kinases (PKs) and protein phosphatases (PPs), the key molecules responsible for the reversible phosphorylation of proteins that are involved in almost all aspects of biological processes. As extensive experimental and computational efforts have been carried out to identify PKs and PPs, an integrative resource with detailed classification and annotation information would be of great value for both experimentalists and computational biologists. In this work, we first collected 1855 PKs and 347 PPs from the scientific literature and various public databases. Based on previously established rationales, we classified all of the known PKs and PPs into a hierarchical structure with three levels, i.e. group, family and individual PK/PP. There are 10 groups with 149 families for the PKs and 10 groups with 33 families for the PPs. We constructed 139 and 27 Hidden Markov Model profiles for PK and PP families, respectively. Then we systematically characterized ∼50,000 PKs and >10,000 PPs in eukaryotes. In addition, >500 PKs and >400 PPs were computationally identified by ortholog search. Finally, the online service of the EKPD database was implemented in PHP + MySQL + JavaScript.

  7. Insights into natural products biosynthesis from analysis of 490 polyketide synthases from Fusarium.

    Science.gov (United States)

    Brown, Daren W; Proctor, Robert H

    2016-04-01

    Species of the fungus Fusarium collectively cause disease on almost all crop plants and produce numerous natural products (NPs), including some of the mycotoxins of greatest concern to agriculture. Many Fusarium NPs are derived from polyketide synthases (PKSs), large multi-domain enzymes that catalyze sequential condensation of simple carboxylic acids to form polyketides. To gain insight into the biosynthesis of polyketide-derived NPs in Fusarium, we retrieved 488 PKS gene sequences from genome sequences of 31 species of the fungus. In addition to these apparently functional PKS genes, the genomes collectively included 81 pseudogenized PKS genes. Phylogenetic analysis resolved the PKS genes into 67 clades, and based on multiple lines of evidence, we propose that homologs in each clade are responsible for synthesis of a polyketide that is distinct from those synthesized by PKSs in other clades. The presence and absence of PKS genes among the species examined indicated marked differences in distribution of PKS homologs. Comparisons of Fusarium PKS genes and genes flanking them to those from other Ascomycetes provided evidence that Fusarium has the genetic potential to synthesize multiple NPs that are the same or similar to those reported in other fungi, but that have not yet been reported in Fusarium. The results also highlight ways in which such analyses can help guide identification of novel Fusarium NPs and differences in NP biosynthetic capabilities that exist among fungi. Published by Elsevier Inc.

  8. The Kinome of Edible and Medicinal Fungus Wolfiporia cocos

    Directory of Open Access Journals (Sweden)

    Wei Wei

    2016-09-01

    Full Text Available Wolfiporia cocos is an edible and medicinal fungus that grows in association with pine trees, and its dried sclerotium, known as Fuling in China, has been used as a traditional medicine in East Asian countries for centuries. Nearly 10% of the traditional Chinese medicinal preparations contain W. cocos. Currently, the commercial production of Fuling is limited because of the lack of pine-based substrate and paucity of knowledge about the sclerotial development of the fungus. Since protein kinase (PKs play significant roles in the regulation of growth, development, reproduction and environmental responses in filamentous fungi, the kinome of W. cocos was analyzed by identifying the PKs genes, studying transcript profiles and assigning PKs to orthologous groups. Of the 10 putative PKs, 11 encode atypical PKs, and 13, 10, 2, 22, and 11 could encoded PKs from the AGC, CAMK, CK, CMGC, STE and TLK Groups, respectively. The level of transcripts from PK genes associated with sclerotia formation in the mycelium and sclerotium stages were analyzed by qRT-PCR. Based on the functions of the orthologues in Sclerotinia sclerotiorum (a sclerotia-formation fungus and Saccharomyces cerevisiae, the potential roles of these W. cocos PKs were assigned. To the best of our knowledge, our study is the first identification and functional discussion of the kinome in the edible and medicinal fungus W. cocos. Our study systematically suggests potential roles of W. cocos PKs and provide comprehensive and novel insights into W. cocos sclerotial development and other economically important traits. Additionally, based on our result, genetic engineering can be employed for over expression or interference of some significant PKs genes to promote sclerotial growth and the accumulation of active compounds.

  9. Genome-wide identification and comprehensive analyses of the kinomes in four pathogenic microsporidia species.

    Directory of Open Access Journals (Sweden)

    Zhi Li

    Full Text Available Microsporidia have attracted considerable attention because they infect a wide range of hosts, from invertebrates to vertebrates, and cause serious human diseases and major economic losses in the livestock industry. There are no prospective drugs to counteract this pathogen. Eukaryotic protein kinases (ePKs play a central role in regulating many essential cellular processes and are therefore potential drug targets. In this study, a comprehensive summary and comparative analysis of the protein kinases in four microsporidia—Enterocytozoon bieneusi, Encephalitozoon cuniculi, Nosema bombycis and Nosema ceranae—was performed. The results show that there are 34 ePKs and 4 atypical protein kinases (aPKs in E. bieneusi, 29 ePKs and 6 aPKs in E. cuniculi, 41 ePKs and 5 aPKs in N. bombycis, and 27 ePKs and 4 aPKs in N. ceranae. These data support the previous conclusion that the microsporidian kinome is the smallest eukaryotic kinome. Microsporidian kinomes contain only serine-threonine kinases and do not contain receptor-like and tyrosine kinases. Many of the kinases related to nutrient and energy signaling and the stress response have been lost in microsporidian kinomes. However, cell cycle-, development- and growth-related kinases, which are important to parasites, are well conserved. This reduction of the microsporidian kinome is in good agreement with genome compaction, but kinome density is negatively correlated with proteome size. Furthermore, the protein kinases in each microsporidian genome are under strong purifying selection pressure. No remarkable differences in kinase family classification, domain features, gain and/or loss, and selective pressure were observed in these four species. Although microsporidia adapt to different host types, the coevolution of microsporidia and their hosts was not clearly reflected in the protein kinases. Overall, this study enriches and updates the microsporidian protein kinase database and may provide

  10. Producing biofuels using polyketide synthases

    Science.gov (United States)

    Katz, Leonard; Fortman, Jeffrey L; Keasling, Jay D

    2013-04-16

    The present invention provides for a non-naturally occurring polyketide synthase (PKS) capable of synthesizing a carboxylic acid or a lactone, and a composition such that a carboxylic acid or lactone is included. The carboxylic acid or lactone, or derivative thereof, is useful as a biofuel. The present invention also provides for a recombinant nucleic acid or vector that encodes such a PKS, and host cells which also have such a recombinant nucleic acid or vector. The present invention also provides for a method of producing such carboxylic acids or lactones using such a PKS.

  11. The Post-polyketide Synthase Steps in iso-Migrastatin Biosynthesis Featuring Tailoring Enzymes with Broad Substrate Specificity

    Science.gov (United States)

    Ma, Ming; Kwong, Thomas; Lim, Si-Kyu; Ju, Jianhua; Lohman, Jeremy R.; Shen, Ben

    2013-01-01

    The iso-migrastatin (iso-MGS) biosynthetic gene cluster from Streptomyces platensis NRRL 18993 consists of 11 genes, featuring an acyltransferase (AT)-less type I polyketide synthase (PKS) and three tailoring enzymes MgsIJK. Systematic inactivation of mgsIJK in S. platensis enabled us to (i) identify two nascent products (10 and 13) of the iso-MGS AT-less type I PKS, establishing an unprecedented novel feature for AT-less type I PKSs, and (ii) account for the formation of all known post-PKS biosynthetic intermediates (10-17) generated by the three tailoring enzymes MgsIJK, which possessed significant substrate promiscuities. PMID:23394593

  12. Partai Keadilan Sejahtera: A Mawdudian-Meliorist Vision of Islamism in Post-New Order Indonesia

    OpenAIRE

    Masdar Hilmy

    2007-01-01

    This article seeks to analyze how one group, that is, the Justice and Welfare Party (PKS), is attempting to clean up politics from within the political party system. This article argues that the existence of PKS has given a new but unique political nuance to the political party system in post-New Order Indonesia. The seemingly sudden rise of PKS has taken many by surprise, and it is for this that the party has become the topic of much discourse amongst scholars of Indonesia.Copyright (c...

  13. A singular enzymatic megacomplex from Bacillus subtilis.

    Science.gov (United States)

    Straight, Paul D; Fischbach, Michael A; Walsh, Christopher T; Rudner, David Z; Kolter, Roberto

    2007-01-02

    Nonribosomal peptide synthetases (NRPS), polyketide synthases (PKS), and hybrid NRPS/PKS are of particular interest, because they produce numerous therapeutic agents, have great potential for engineering novel compounds, and are the largest enzymes known. The predicted masses of known enzymatic assembly lines can reach almost 5 megadaltons, dwarfing even the ribosome (approximately 2.6 megadaltons). Despite their uniqueness and importance, little is known about the organization of these enzymes within the native producer cells. Here we report that an 80-kb gene cluster, which occupies approximately 2% of the Bacillus subtilis genome, encodes the subunits of approximately 2.5 megadalton active hybrid NRPS/PKS. Many copies of the NRPS/PKS assemble into a single organelle-like membrane-associated complex of tens to hundreds of megadaltons. Such an enzymatic megacomplex is unprecedented in bacterial subcellular organization and has important implications for engineering novel NRPS/PKSs.

  14. Reduced clearance of rocuronium and sugammadex in patients with severe to end-stage renal failure: a pharmacokinetic study.

    NARCIS (Netherlands)

    Staals, L.M.; Snoeck, M.M.J.; Driessen, J.J.; Hamersvelt, H.W. van; Flockton, E.A.; Heuvel, M.W. van den; Hunter, J.M.

    2010-01-01

    BACKGROUND: Sugammadex is a selective relaxant binding agent designed to encapsulate the neuromuscular blocking agent, rocuronium. The sugammadex-rocuronium complex is eliminated by the kidneys. This trial investigated the pharmacokinetics (PKs) of sugammadex and rocuronium in patients with renal

  15. In silico exploration of Red Sea Bacillus genomes for natural product biosynthetic gene clusters

    KAUST Repository

    Othoum, Ghofran K; Bougouffa, Salim; Razali, Rozaimi; Bokhari, Ameerah; Alamoudi, Soha; Antunes, André ; Gao, Xin; Hoehndorf, Robert; Arold, Stefan T.; Gojobori, Takashi; Hirt, Heribert; Mijakovic, Ivan; Bajic, Vladimir B.; Lafi, Feras Fawzi; Essack, Magbubah

    2018-01-01

    are better potential sources for novel antibiotics. Moreover, the genome of the Red Sea strain B. paralicheniformis Bac48 is more enriched in modular PKS genes compared to B. licheniformis strains and other B. paralicheniformis strains. This may be linked

  16. Effect of BaTiO3 Nanopowder Concentration on Rheological Behaviour of Ceramic Inkjet Inks

    Science.gov (United States)

    Kyrpal, R.; Dulina, I.; Ragulya, A.

    2015-04-01

    The relationship between rheological properties of ceramic inkjet inks based on BaTiO3 nanopowder and solid phase concentration has been investigated. In the ink volume takes place the formation periodic colloidal structures (PCS). The determining factor of structure formation is powder-dispersant ratio. Structural constitution of in the system with the low pigment concentration represented as PCS2, that contains solid particles in deflocculated that stabilized by the presence of adsorption-solvate layers. Dilatant structure formation for such inks explained by constrained conditions of the interaction. Samples with high BaTiO3 concentration have been classified as PKS1. Dilatant properties of the PKS1 resulted in particles rearrangement under the influence of the flow. In the region of some values powder-dispersant ratio take place conversation PKS2 to PKS1 and ink structure transformation from monodisperse to aggregate state.

  17. Multi-wavelength studies of TeV γ-ray emitting BL Lac objects

    Energy Technology Data Exchange (ETDEWEB)

    Kaufmann, Sarah Sabine

    2012-12-21

    The discovery of TeV γ-ray emission of BL Lac objects gave new insights in the particle acceleration and the emission processes of the highly relativistic jets. To shed light on the conditions in the high energetic jets of the TeV γ-ray emitting BL Lac objects, I have studied in great detail the spectral energy distribution (SED) of sources with different characteristics. BL Lac objects with exceptional very high energy spectra (soft and hard spectra) and with large differences in the emission peak frequencies, to cover the different classes of BL Lac objects, have been chosen. The basic aim of this thesis was, to study with new, simultaneous multi- avelength (MWL) observations, if the emission processes of these extreme cases of TeV BL Lac objects can be explained by the synchrotron Self-Compton (SSC) model which is well established for the class of BL Lac objects at lower energies. We proposed MWL observations in the optical, UV and X-ray regime, to be conducted simultaneous to very high energy observations with the H.E.S.S. experiment, to study the emission processes. Simultaneous observations are crucial, since BL Lac objects are variable at all wavebands. I have analysed the MWL observations and conducted detailed variability and spectral studies in each wavelength range. The different kind of absorption at each wavelength as well as the influence of the host galaxy of the AGN has been considered to obtain the intrinsic jet spectrum. I have then applied the commonly used theoretical jet model, the SSC model, to the SED. I conducted a MWL campaign on a BL Lac object with the softest TeV spectrum, PKS 2005-489, during which it was observed in a very bright X-ray state. The good spectral coverage of the emission peaks allowed a detailed study of the SSC model. The extreme BL Lac object 1ES 0229+200 exhibits a hard intrinsic TeV spectrum. With my MWL campaign I found a clear cut-off in the optical range and therefore a high minimum Lorentz factor is needed to

  18. Multi-wavelength studies of TeV γ-ray emitting BL Lac objects

    International Nuclear Information System (INIS)

    Kaufmann, Sarah Sabine

    2012-01-01

    The discovery of TeV γ-ray emission of BL Lac objects gave new insights in the particle acceleration and the emission processes of the highly relativistic jets. To shed light on the conditions in the high energetic jets of the TeV γ-ray emitting BL Lac objects, I have studied in great detail the spectral energy distribution (SED) of sources with different characteristics. BL Lac objects with exceptional very high energy spectra (soft and hard spectra) and with large differences in the emission peak frequencies, to cover the different classes of BL Lac objects, have been chosen. The basic aim of this thesis was, to study with new, simultaneous multi- avelength (MWL) observations, if the emission processes of these extreme cases of TeV BL Lac objects can be explained by the synchrotron Self-Compton (SSC) model which is well established for the class of BL Lac objects at lower energies. We proposed MWL observations in the optical, UV and X-ray regime, to be conducted simultaneous to very high energy observations with the H.E.S.S. experiment, to study the emission processes. Simultaneous observations are crucial, since BL Lac objects are variable at all wavebands. I have analysed the MWL observations and conducted detailed variability and spectral studies in each wavelength range. The different kind of absorption at each wavelength as well as the influence of the host galaxy of the AGN has been considered to obtain the intrinsic jet spectrum. I have then applied the commonly used theoretical jet model, the SSC model, to the SED. I conducted a MWL campaign on a BL Lac object with the softest TeV spectrum, PKS 2005-489, during which it was observed in a very bright X-ray state. The good spectral coverage of the emission peaks allowed a detailed study of the SSC model. The extreme BL Lac object 1ES 0229+200 exhibits a hard intrinsic TeV spectrum. With my MWL campaign I found a clear cut-off in the optical range and therefore a high minimum Lorentz factor is needed to

  19. Magnetic Field Strength Evaluation Yu. S. Yefimov

    Indian Academy of Sciences (India)

    physical task is to evaluate the strength and topology of magnetic field in blazars and related ... polarization, spectral index of radiation, ratio of apparent velocity of the motion of matter along .... A detailed analysis of the evaluation of physical.

  20. FROM NEARBY LOW LUMINOSITY AGN TO HIGH REDSHIFT ...

    Indian Academy of Sciences (India)

    44

    6Amity Institute of Applied Sciences, Amity University Uttar Pradesh, Sector 125, Noida ... We present detailed science cases that a large fraction of the Indian AGN ..... kiloparsec-scale radio study of the MOJAVE6 blazar sample. Kharb et al.

  1. Determination of pyrolysis characteristics and kinetics of palm kernel shell using TGA–FTIR and model-free integral methods

    International Nuclear Information System (INIS)

    Ma, Zhongqing; Chen, Dengyu; Gu, Jie; Bao, Binfu; Zhang, Qisheng

    2015-01-01

    Highlights: • Model-free integral kinetics method and analytical TGA–FTIR were conducted on pyrolysis process of PKS. • The pyrolysis mechanism of PKS was elaborated. • Thermal stability was established: lignin > cellulose > xylan. • Detailed compositions in the volatiles of PKS pyrolysis were determinated. • The interaction of biomass three components led to the fluctuation of activation energy in PKS pyrolysis. - Abstract: Palm kernel shell (PKS) from palm oil production is a potential biomass source for bio-energy production. A fundamental understanding of PKS pyrolysis behavior and kinetics is essential to its efficient thermochemical conversion. The thermal degradation profile in derivative thermogravimetry (DTG) analysis shown two significant mass-loss peaks mainly related to the decomposition of hemicellulose and cellulose respectively. This characteristic differentiated with other biomass (e.g. wheat straw and corn stover) presented just one peak or accompanied with an extra “shoulder” peak (e.g. wheat straw). According to the Fourier transform infrared spectrometry (FTIR) analysis, the prominent volatile components generated by the pyrolysis of PKS were CO 2 (2400–2250 cm −1 and 586–726 cm −1 ), aldehydes, ketones, organic acids (1900–1650 cm −1 ), and alkanes, phenols (1475–1000 cm −1 ). The activation energy dependent on the conversion rate was estimated by two model-free integral methods: Flynn–Wall–Ozawa (FWO) and Kissinger–Akahira–Sunose (KAS) method at different heating rates. The fluctuation of activation energy can be interpreted as a result of interactive reactions related to cellulose, hemicellulose and lignin degradation, occurred in the pyrolysis process. Based on TGA–FTIR analysis and model free integral kinetics method, the pyrolysis mechanism of PKS was elaborated in this paper

  2. Biosynthesis of fusarielins in Fusarium graminearum

    DEFF Research Database (Denmark)

    Saei, Wagma; Søndergaard, Teis; Giese, Henriette

    Polyketide synthase 9 (PKS9) is one of the 15 identified polyketide synthase (PKS) genes in Fusarium graminearum. The gene is coregulated along with five neighboring genes by a single transcription factor (TF). An overexpression of the transcription factor led to production of three novel...... by this cluster in Fusarium graminearum., deletion mutant of each gene was created in the overexpressed mutant by targeted gene replacemen...

  3. Physical Properties of Biomass Fuel Briquette from Oil Palm Residues

    African Journals Online (AJOL)

    Palm Kernel Shell (PKS) and Mesocarp Fibre (MF) were used for the production of fuel briquettes in this study in order to supplement the energy mix of the nation. PKS was pulverized and then sieved into different grain particles of 350 μm, 250 μm and 150 μm, before mixing with MF in the ratios: 90:10, 80:20 and 70:30 ...

  4. Towards prediction of metabolic products of polyketide synthases: an in silico analysis.

    Directory of Open Access Journals (Sweden)

    Gitanjali Yadav

    2009-04-01

    Full Text Available Sequence data arising from an increasing number of partial and complete genome projects is revealing the presence of the polyketide synthase (PKS family of genes not only in microbes and fungi but also in plants and other eukaryotes. PKSs are huge multifunctional megasynthases that use a variety of biosynthetic paradigms to generate enormously diverse arrays of polyketide products that posses several pharmaceutically important properties. The remarkable conservation of these gene clusters across organisms offers abundant scope for obtaining novel insights into PKS biosynthetic code by computational analysis. We have carried out a comprehensive in silico analysis of modular and iterative gene clusters to test whether chemical structures of the secondary metabolites can be predicted from PKS protein sequences. Here, we report the success of our method and demonstrate the feasibility of deciphering the putative metabolic products of uncharacterized PKS clusters found in newly sequenced genomes. Profile Hidden Markov Model analysis has revealed distinct sequence features that can distinguish modular PKS proteins from their iterative counterparts. For iterative PKS proteins, structural models of iterative ketosynthase (KS domains have revealed novel correlations between the size of the polyketide products and volume of the active site pocket. Furthermore, we have identified key residues in the substrate binding pocket that control the number of chain extensions in iterative PKSs. For modular PKS proteins, we describe for the first time an automated method based on crucial intermolecular contacts that can distinguish the correct biosynthetic order of substrate channeling from a large number of non-cognate combinatorial possibilities. Taken together, our in silico analysis provides valuable clues for formulating rules for predicting polyketide products of iterative as well as modular PKS clusters. These results have promising potential for discovery of

  5. The systematic functional analysis of plasmodium protein kinases identifies essential regulators of mosquito transmission

    KAUST Repository

    Tewari, Rita; Straschil, Ursula; Bateman, Alex; Bö hme, Ulrike; Cherevach, Inna; Gong, Peng; Pain, Arnab; Billker, Oliver

    2010-01-01

    Although eukaryotic protein kinases (ePKs) contribute to many cellular processes, only three Plasmodium falciparum ePKs have thus far been identified as essential for parasite asexual blood stage development. To identify pathways essential for parasite transmission between their mammalian host and mosquito vector, we undertook a systematic functional analysis of ePKs in the genetically tractable rodent parasite Plasmodium berghei. Modeling domain signatures of conventional ePKs identified 66 putative Plasmodium ePKs. Kinomes are highly conserved between Plasmodium species. Using reverse genetics, we show that 23 ePKs are redundant for asexual erythrocytic parasite development in mice. Phenotyping mutants at four life cycle stages in Anopheles stephensi mosquitoes revealed functional clusters of kinases required for sexual development and sporogony. Roles for a putative SR protein kinase (SRPK) in microgamete formation, a conserved regulator of clathrin uncoating (GAK) in ookinete formation, and a likely regulator of energy metabolism (SNF1/KIN) in sporozoite development were identified. 2010 Elsevier Inc.

  6. Hydrogen Production from Gasification of Palm Kernel Shell in the Presence of Fe/ CeO_2 Catalysts

    International Nuclear Information System (INIS)

    Anita Ramli; Mas Fatiha Mohamad; Suzana Yusup; Taufiq, Y.Y.H.

    2016-01-01

    Bio hydrogen is a renewable source of clean fuel and energy which can be derived from biomass. One of the suitable candidate as a source of biomass is palm kernel shell (PKS). Our initial work shows that bio hydrogen may be produced from PKS in the presence of zeolite supported catalysts. The potential of using cerium oxide (CeO_2) supported catalysts for the production of bio hydrogen from PKS is explored in this work using 2.5 - 10 % Fe loading. The catalysts were prepared by incipient wetness impregnation method and calcined at 500 degree Celsius for 16 h. The physicochemical properties of these catalysts were characterized using BET and XRD. The catalysts were tested in dry and steam gasification of PKS at 700 degree Celsius using PKS feeding rate of 2 g h"-"1 under N_2 atmosphere with biomass to catalyst ratio of 3:1 (wt/ wt). Steam to biomass ratio of 3.5:1 (wt/ wt) was used in steam gasification reaction. The gaseous products were analyzed using an on-line gas chromatography equipped with thermal conductivity detectors (TCD) and fitted with Molsieve 5A and Hayesep Q columns. Result shows that 2.5 % Fe/ CeO_2 gave the highest hydrogen production in both the dry and steam gasification of PKS. (author)

  7. The systematic functional analysis of plasmodium protein kinases identifies essential regulators of mosquito transmission

    KAUST Repository

    Tewari, Rita

    2010-10-21

    Although eukaryotic protein kinases (ePKs) contribute to many cellular processes, only three Plasmodium falciparum ePKs have thus far been identified as essential for parasite asexual blood stage development. To identify pathways essential for parasite transmission between their mammalian host and mosquito vector, we undertook a systematic functional analysis of ePKs in the genetically tractable rodent parasite Plasmodium berghei. Modeling domain signatures of conventional ePKs identified 66 putative Plasmodium ePKs. Kinomes are highly conserved between Plasmodium species. Using reverse genetics, we show that 23 ePKs are redundant for asexual erythrocytic parasite development in mice. Phenotyping mutants at four life cycle stages in Anopheles stephensi mosquitoes revealed functional clusters of kinases required for sexual development and sporogony. Roles for a putative SR protein kinase (SRPK) in microgamete formation, a conserved regulator of clathrin uncoating (GAK) in ookinete formation, and a likely regulator of energy metabolism (SNF1/KIN) in sporozoite development were identified. 2010 Elsevier Inc.

  8. Kernel based machine learning algorithm for the efficient prediction of type III polyketide synthase family of proteins

    Directory of Open Access Journals (Sweden)

    Mallika V

    2010-03-01

    Full Text Available Type III Polyketide synthases (PKS are family of proteins considered to have significant role in the biosynthesis of various polyketides in plants, fungi and bacteria. As these proteins show positive effects to human health, more researches are going on regarding this particular protein. Developing a tool to identify the probability of sequence, being a type III polyketide synthase will minimize the time consumption and manpower efforts. In this approach, we have designed and implemented PKSIIIpred, a high performance prediction server for type III PKS where the classifier is Support Vector Machine (SVM. Based on the limited training dataset, the tool efficiently predicts the type III PKS superfamily of proteins with high sensitivity and specificity. PKSIIIpred is available at http://type3pks.in/prediction/. We expect that this tool may serve as a useful resource for type III PKS researchers. Currently work is being progressed for further betterment of prediction accuracy by including more sequence features in the training dataset.

  9. A dual role for a polyketide synthase in dynemicin enediyne and anthraquinone biosynthesis

    Science.gov (United States)

    Cohen, Douglas R.; Townsend, Craig A.

    2018-02-01

    Dynemicin A is a member of a subfamily of enediyne antitumour antibiotics characterized by a 10-membered carbocycle fused to an anthraquinone, both of polyketide origin. Sequencing of the dynemicin biosynthetic gene cluster in Micromonospora chersina previously identified an enediyne polyketide synthase (PKS), but no anthraquinone PKS, suggesting gene(s) for biosynthesis of the latter were distant from the core dynemicin cluster. To identify these gene(s), we sequenced and analysed the genome of M. chersina. Sequencing produced a short list of putative PKS candidates, yet CRISPR-Cas9 mutants of each locus retained dynemicin production. Subsequently, deletion of two cytochromes P450 in the dynemicin cluster suggested that the dynemicin enediyne PKS, DynE8, may biosynthesize the anthraquinone. Together with 18O-labelling studies, we now present evidence that DynE8 produces the core scaffolds of both the enediyne and anthraquinone, and provide a working model to account for their formation from the programmed octaketide of the enediyne PKS.

  10. Enhancement and prediction of modulus of elasticity of palm kernel shell concrete

    International Nuclear Information System (INIS)

    Alengaram, U. Johnson; Mahmud, Hilmi; Jumaat, Mohd Zamin

    2011-01-01

    Research highlights: → Micro-pores of size 16-24 μm were found on the outer surface of palm kernel shell. → Infilling of pores by mineral admixtures was evident. → Sand content influenced both modulus of elasticity and compressive strength. → Proposed equation predicts modulus of elasticity within ±1.5 kN/mm 2 of test results. -- Abstract: This paper presents results of an investigation conducted to enhance and predict the modulus of elasticity (MOE) of palm kernel shell concrete (PKSC). Scanning electron microscopic (SEM) analysis on palm kernel shell (PKS) was conducted. Further, the effect of varying sand and PKS contents and mineral admixtures (silica fume and fly ash) on compressive strength and MOE was investigated. The variables include water-to-binder (w/b) and sand-to-cement (s/c) ratios. Nine concrete mixes were prepared, and tests on static and dynamic moduli of elasticity and compressive strength were conducted. The SEM result showed presence of large number of micro-pores on PKS. The mineral admixtures uniformly filled the micro-pores on the outer surface of PKS. Further, the increase in sand content coupled with reduction in PKS content enhanced the compressive strength and static MOE: The highest MOE recorded in this investigation, 11 kN/mm 2 , was twice that previously published. Moreover, the proposed equation based on CEB/FIP code formula appears to predict the MOE close to the experimental values.

  11. Role of Modular Polyketide Synthases in the Production of Polyether Ladder Compounds in Ciguatoxin-Producing Gambierdiscus polynesiensis and G. excentricus (Dinophyceae).

    Science.gov (United States)

    Kohli, Gurjeet S; Campbell, Katrina; John, Uwe; Smith, Kirsty F; Fraga, Santiago; Rhodes, Lesley L; Murray, Shauna A

    2017-09-01

    Gambierdiscus, a benthic dinoflagellate, produces ciguatoxins that cause the human illness Ciguatera. Ciguatoxins are polyether ladder compounds that have a polyketide origin, indicating that polyketide synthases (PKS) are involved in their production. We sequenced transcriptomes of Gambierdiscus excentricus and Gambierdiscus polynesiensis and found 264 contigs encoding single domain ketoacyl synthases (KS; G. excentricus: 106, G. polynesiensis: 143) and ketoreductases (KR; G. excentricus: 7, G. polynesiensis: 8) with sequence similarity to type I PKSs, as reported in other dinoflagellates. In addition, 24 contigs (G. excentricus: 3, G. polynesiensis: 21) encoding multiple PKS domains (forming typical type I PKSs modules) were found. The proposed structure produced by one of these megasynthases resembles a partial carbon backbone of a polyether ladder compound. Seventeen contigs encoding single domain KS, KR, s-malonyltransacylase, dehydratase and enoyl reductase with sequence similarity to type II fatty acid synthases (FAS) in plants were found. Type I PKS and type II FAS genes were distinguished based on the arrangement of domains on the contigs and their sequence similarity and phylogenetic clustering with known PKS/FAS genes in other organisms. This differentiation of PKS and FAS pathways in Gambierdiscus is important, as it will facilitate approaches to investigating toxin biosynthesis pathways in dinoflagellates. © 2017 The Author(s) Journal of Eukaryotic Microbiology © 2017 International Society of Protistologists.

  12. Compressive strength, flexural strength and water absorption of concrete containing palm oil kernel shell

    Science.gov (United States)

    Noor, Nurazuwa Md; Xiang-ONG, Jun; Noh, Hamidun Mohd; Hamid, Noor Azlina Abdul; Kuzaiman, Salsabila; Ali, Adiwijaya

    2017-11-01

    Effect of inclusion of palm oil kernel shell (PKS) and palm oil fibre (POF) in concrete was investigated on the compressive strength and flexural strength. In addition, investigation of palm oil kernel shell on concrete water absorption was also conducted. Total of 48 concrete cubes and 24 concrete prisms with the size of 100mm × 100mm × 100mm and 100mm × 100mm × 500mm were prepared, respectively. Four (4) series of concrete mix consists of coarse aggregate was replaced by 0%, 25%, 50% and 75% palm kernel shell and each series were divided into two (2) main group. The first group is without POF, while the second group was mixed with the 5cm length of 0.25% of the POF volume fraction. All specimen were tested after 7 and 28 days of water curing for a compression test, and flexural test at 28 days of curing period. Water absorption test was conducted on concrete cube age 28 days. The results showed that the replacement of PKS achieves lower compressive and flexural strength in comparison with conventional concrete. However, the 25% replacement of PKS concrete showed acceptable compressive strength which within the range of requirement for structural concrete. Meanwhile, the POF which should act as matrix reinforcement showed no enhancement in flexural strength due to the balling effect in concrete. As expected, water absorption was increasing with the increasing of PKS in the concrete cause by the porous characteristics of PKS

  13. Long term monitoring of Gamma-Ray emission from the BL Lacertae object (1ES 2200+420)

    Science.gov (United States)

    Gunawardhana, Isuru; VERITAS Collaboration

    2016-03-01

    Blazars are a class of Active Galactic Nuclei (AGN) that have relativistic jets pointing along the observer line of sight. Blazars exhibit variable emission extending from radio to TeV energies. The variability timescale of the TeV flux is a key component of understanding the location of the very high energy emission zones. Deep observations of the quiescent state measurements are also required to disentangle the flaring state emission from quiescent state emission, a prerequisite for understanding the origin of blazar spectral variability. BL Lacertae (also known as 1ES 2200+420), as the namesake for all BL Lac objects, is a prime example of one such blazar. The VERITAS Observatory, an Imaging Atmospheric Cherenkov Telescope (IACT) array sensitive to gamma rays in the range from 85 GeV to 30 TeV, dedicates approximately 110 hours per year on deep observations of known gamma-ray blazars. In this talk, I will describe the TeV photon flux variability of BL Lacertae measured by VERITAS from 2013 to 2015.

  14. Combustion characteristics of Malaysian oil palm biomass, sub-bituminous coal and their respective blends via thermogravimetric analysis (TGA).

    Science.gov (United States)

    Idris, Siti Shawalliah; Rahman, Norazah Abd; Ismail, Khudzir

    2012-11-01

    The combustion characteristics of Malaysia oil palm biomass (palm kernel shell (PKS), palm mesocarp fibre (PMF) and empty fruit bunches (EFB)), sub-bituminous coal (Mukah Balingian) and coal/biomass blends via thermogravimetric analysis (TGA) were investigated. Six weight ratios of coal/biomass blends were prepared and oxidised under dynamic conditions from temperature 25 to 1100°C at four heating rates. The thermogravimetric analysis demonstrated that the EFB and PKS evolved additional peak besides drying, devolatilisation and char oxidation steps during combustion. Ignition and burn out temperatures of blends were improved in comparison to coal. No interactions were observed between the coal and biomass during combustion. The apparent activation energy during this process was evaluated using iso-conversional model free kinetics which resulted in highest activation energy during combustion of PKS followed by PMF, EFB and MB coal. Blending oil palm biomass with coal reduces the apparent activation energy value. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Broad Substrate Specificity of the Loading Didomain of the Lipomycin Polyketide Synthase

    Energy Technology Data Exchange (ETDEWEB)

    Yuzawa, S; Eng, CH; Katz, L; Keasling, JD

    2013-06-04

    LipPks1, a polyketide synthase subunit of the lipomycin synthase, is believed to catalyze the polyketide chain initiation reaction using isobutyryl-CoA as a substrate, followed by an elongation reaction with methylmalonyl-CoA to start the biosynthesis of antibiotic alpha-lipomycin in Streptomyces aureofaciens Tu117. Recombinant LipPks1, containing the thioesterase domain from the 6-deoxyerythronolide B synthase, was produced in Escherichia coli, and its substrate specificity was investigated in vitro. Surprisingly, several different acyl-CoAs, including isobutyryl-CoA, were accepted as the starter substrates, while no product was observed with acetyl-CoA. These results demonstrate the broad substrate specificity of LipPks1 and may be applied to producing new antibiotics.

  16. Multiwavelength Spectral Variability of Mkn 501 in Outburst

    Science.gov (United States)

    Hempfling, Christina

    2012-10-01

    We propose simultaneous multiwavelength observations of the blazar Mrk501 in flaring state with XMM-Newton, FACT and Swift. Bright TeV gamma-ray flares have been detected repeatedly from Mrk501. Leptonic blazar models predict an simultaneous increase in the gamma-ray and X-ray bands. However, Mrk 501 also showed so-called orphan flares, as well as flares featuring time lags that are hard to explain by current models. Available data lack detailed light curves and hence are not sufficient to make strong statements on the nature of the responsible processes. These observations of a flare of Mrk501 in the gamma-ray and X-ray band with high spectral sensitivity and time resolution will yield a big contribution to the comprehension of blazar emission processes.

  17. Long-term studies of Markarian 421 from 2007 to 2009

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, Sonja; Overkemping, Ann-Kristin [TU Dortmund, Dortmund (Germany); Manganaro, Marina [IAC La Laguna, Teneriffa (Spain); Tescaro, Diego [INFN, Padova (Italy); Collaboration: MAGIC-Collaboration

    2016-07-01

    The MAGIC experiment consists of two Imaging Air shower Cherenkov Telescopes to detect and study gamma-rays from galactic and extragalactic sources. Blazars are a special type of extragalactic sources hosting an Active Galactic Nucleus (AGN) with a jet directed towards earth. The AGN Mrk 421 is one of the strongest and brightest known blazars suitable for very high-energy (VHE) observations. This talk gives an overview over long-term variability and correlation studies of the blazar Mrk 421. For this study a VHE dataset collected by MAGIC-I covering the extensive timespan from February 2007 to June 2009 was examined together with data of different wavelengths from other telescopes. These kind of studies could allow for an increase of knowledge about the possible emission processes inside Mrk 421.

  18. Fermi Non-detections of Four X-Ray Jet Sources and Implications for the IC/CMB Mechanism

    Science.gov (United States)

    Breiding, Peter; Meyer, Eileen T.; Georganopoulos, Markos; Keenan, M. E.; DeNigris, N. S.; Hewitt, Jennifer

    2017-11-01

    Since its launch in 1999, the Chandra X-ray observatory has discovered several dozen X-ray jets associated with powerful quasars. In many cases, the X-ray spectrum is hard and appears to come from a second spectral component. The most popular explanation for the kpc-scale X-ray emission in these cases has been inverse-Compton (IC) scattering of Cosmic Microwave Background (CMB) photons by relativistic electrons in the jet (the IC/CMB model). Requiring the IC/CMB emission to reproduce the observed X-ray flux density inevitably predicts a high level of gamma-ray emission, which should be detectable with the Fermi Large Area Telescope (LAT). In previous work, we found that gamma-ray upper limits from the large-scale jets of 3C 273 and PKS 0637-752 violate the predictions of the IC/CMB model. Here, we present Fermi/LAT flux density upper limits for the X-ray jets of four additional sources: PKS 1136-135, PKS 1229-021, PKS 1354+195, and PKS 2209+080. We show that these limits violate the IC/CMB predictions at a very high significance level. We also present new Hubble Space Telescope observations of the quasar PKS 2209+080 showing a newly detected optical jet, and Atacama Large Millimeter/submillimeter Array band 3 and 6 observations of all four sources, which provide key constraints on the spectral shape that enable us to rule out the IC/CMB model.

  19. Genome-Wide Identification and Evolutionary Analysis of Sarcocystis neurona Protein Kinases.

    Science.gov (United States)

    Murungi, Edwin K; Kariithi, Henry M

    2017-03-21

    The apicomplexan parasite Sarcocystis neurona causes equine protozoal myeloencephalitis (EPM), a degenerative neurological disease of horses. Due to its host range expansion, S. neurona is an emerging threat that requires close monitoring. In apicomplexans, protein kinases (PKs) have been implicated in a myriad of critical functions, such as host cell invasion, cell cycle progression and host immune response evasion. Here, we used various bioinformatics methods to define the kinome of S. neurona and phylogenetic relatedness of its PKs to other apicomplexans. We identified 97 putative PKs clustering within the various eukaryotic kinase groups. Although containing the universally-conserved PKA (AGC group), S. neurona kinome was devoid of PKB and PKC. Moreover, the kinome contains the six-conserved apicomplexan CDPKs (CAMK group). Several OPK atypical kinases, including ROPKs 19A, 27, 30, 33, 35 and 37 were identified. Notably, S. neurona is devoid of the virulence-associated ROPKs 5, 6, 18 and 38, as well as the Alpha and RIO kinases. Two out of the three S. neurona CK1 enzymes had high sequence similarities to Toxoplasma gondii TgCK1-α and TgCK1-β and the Plasmodium PfCK1. Further experimental studies on the S. neurona putative PKs identified in this study are required to validate the functional roles of the PKs and to understand their involvement in mechanisms that regulate various cellular processes and host-parasite interactions. Given the essentiality of apicomplexan PKs in the survival of apicomplexans, the current study offers a platform for future development of novel therapeutics for EPM, for instance via application of PK inhibitors to block parasite invasion and development in their host.

  20. Genome-Wide Identification and Evolutionary Analysis of Sarcocystis neurona Protein Kinases

    Directory of Open Access Journals (Sweden)

    Edwin K. Murungi

    2017-03-01

    Full Text Available The apicomplexan parasite Sarcocystis neurona causes equine protozoal myeloencephalitis (EPM, a degenerative neurological disease of horses. Due to its host range expansion, S. neurona is an emerging threat that requires close monitoring. In apicomplexans, protein kinases (PKs have been implicated in a myriad of critical functions, such as host cell invasion, cell cycle progression and host immune response evasion. Here, we used various bioinformatics methods to define the kinome of S. neurona and phylogenetic relatedness of its PKs to other apicomplexans. We identified 97 putative PKs clustering within the various eukaryotic kinase groups. Although containing the universally-conserved PKA (AGC group, S. neurona kinome was devoid of PKB and PKC. Moreover, the kinome contains the six-conserved apicomplexan CDPKs (CAMK group. Several OPK atypical kinases, including ROPKs 19A, 27, 30, 33, 35 and 37 were identified. Notably, S. neurona is devoid of the virulence-associated ROPKs 5, 6, 18 and 38, as well as the Alpha and RIO kinases. Two out of the three S. neurona CK1 enzymes had high sequence similarities to Toxoplasma gondii TgCK1-α and TgCK1-β and the Plasmodium PfCK1. Further experimental studies on the S. neurona putative PKs identified in this study are required to validate the functional roles of the PKs and to understand their involvement in mechanisms that regulate various cellular processes and host-parasite interactions. Given the essentiality of apicomplexan PKs in the survival of apicomplexans, the current study offers a platform for future development of novel therapeutics for EPM, for instance via application of PK inhibitors to block parasite invasion and development in their host.

  1. Distributed Memory Parallel Computing with SEAWAT

    Science.gov (United States)

    Verkaik, J.; Huizer, S.; van Engelen, J.; Oude Essink, G.; Ram, R.; Vuik, K.

    2017-12-01

    Fresh groundwater reserves in coastal aquifers are threatened by sea-level rise, extreme weather conditions, increasing urbanization and associated groundwater extraction rates. To counteract these threats, accurate high-resolution numerical models are required to optimize the management of these precious reserves. The major model drawbacks are long run times and large memory requirements, limiting the predictive power of these models. Distributed memory parallel computing is an efficient technique for reducing run times and memory requirements, where the problem is divided over multiple processor cores. A new Parallel Krylov Solver (PKS) for SEAWAT is presented. PKS has recently been applied to MODFLOW and includes Conjugate Gradient (CG) and Biconjugate Gradient Stabilized (BiCGSTAB) linear accelerators. Both accelerators are preconditioned by an overlapping additive Schwarz preconditioner in a way that: a) subdomains are partitioned using Recursive Coordinate Bisection (RCB) load balancing, b) each subdomain uses local memory only and communicates with other subdomains by Message Passing Interface (MPI) within the linear accelerator, c) it is fully integrated in SEAWAT. Within SEAWAT, the PKS-CG solver replaces the Preconditioned Conjugate Gradient (PCG) solver for solving the variable-density groundwater flow equation and the PKS-BiCGSTAB solver replaces the Generalized Conjugate Gradient (GCG) solver for solving the advection-diffusion equation. PKS supports the third-order Total Variation Diminishing (TVD) scheme for computing advection. Benchmarks were performed on the Dutch national supercomputer (https://userinfo.surfsara.nl/systems/cartesius) using up to 128 cores, for a synthetic 3D Henry model (100 million cells) and the real-life Sand Engine model ( 10 million cells). The Sand Engine model was used to investigate the potential effect of the long-term morphological evolution of a large sand replenishment and climate change on fresh groundwater resources

  2. Identification of the Biosynthetic Gene Clusters for the Lipopeptides Fusaristatin A and W493 B in Fusarium graminearum and F. pseudograminearum

    DEFF Research Database (Denmark)

    Sørensen, Jens Laurids; Sondergaard, Teis Esben; Covarelli, Lorenzo

    2014-01-01

    The closely related species Fusarium graminearum and Fusarium pseudograminearum differ in that each contains a gene cluster with a polyketide synthase (PKS) and a nonribosomal peptide synthetase (NRPS) that is not present in the other species. To identify their products, we deleted PKS6 and NRPS7...... Fusarium species. On the basis of genes in the putative gene clusters we propose a model for biosynthesis where the polyketide product is shuttled to the NPRS via a CoA ligase and a thioesterase in F. pseudograminearum. In F. graminearum the polyketide is proposed to be directly assimilated by the NRPS....

  3. Production of novel fusarielins by ectopic activation of the polyketide synthase 9 cluster in Fusarium graminearum

    DEFF Research Database (Denmark)

    Sørensen, Jens Laurids; Hansen, Frederik Teilfeldt; Sondergaard, Teis Esben

    2012-01-01

    specific transcription factors. We have developed a system in which an expression cassette containing the transcription factor from the targeted PKS cluster disrupts the production of the red mycelium pigment aurofusarin. This aids with identification of mutants as they appear as white colonies...... and metabolite analyses where aurofusarin and its intermediates are normally among the most abundant compounds. The system was used for constitutive expression of the local transcription factor from the PKS9 cluster (renamed FSL) leading to production of three novel fusarielins, F, G and H. This group...

  4. RADIO-LOUD NARROW-LINE SEYFERT 1 AS A NEW CLASS OF GAMMA-RAY ACTIVE GALACTIC NUCLEI

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Cameron, R. A.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.; Caliandro, G. A.

    2009-01-01

    We report the discovery with Fermi/LAT of γ-ray emission from three radio-loud narrow-line Seyfert 1 galaxies: PKS 1502+036 (z = 0.409), 1H 0323+342 (z = 0.061), and PKS 2004 - 447 (z = 0.24). In addition to PMN J0948+0022 (z = 0.585), the first source of this type to be detected in γ rays, they may form an emerging new class of γ-ray active galactic nuclei (AGNs). These findings can have strong implications on our knowledge about relativistic jets and the unified model of the AGN.

  5. Melanisation of Aspergillus terreus—Is Butyrolactone I Involved in the Regulation of Both DOPA and DHN Types of Pigments in Submerged Culture?

    Directory of Open Access Journals (Sweden)

    Elina K. Palonen

    2017-05-01

    Full Text Available Pigments and melanins of fungal spores have been investigated for decades, revealing important roles in the survival of the fungus in hostile environments. The key genes and the encoded enzymes for pigment and melanin biosynthesis have recently been found in Ascomycota, including Aspergillus spp. In Aspergillus terreus, the pigmentation has remained mysterious with only one class of melanin biogenesis being found. In this study, we examined an intriguing, partially annotated gene cluster of A. terreus strain NIH2624, utilizing previously sequenced transcriptome and improved gene expression data of strain MUCL 38669, under the influence of a suggested quorum sensing inducing metabolite, butyrolactone I. The core polyketide synthase (PKS gene of the cluster was predicted to be significantly longer on the basis of the obtained transcriptional data, and the surrounding cluster was positively regulated by butyrolactone I at the late growth phase of submerged culture, presumably during sporulation. Phylogenetic analysis of the extended PKS revealed remarkable similarity with a group of known pigments of Fusarium spp., indicating a similar function for this PKS. We present a hypothesis of this PKS cluster to biosynthesise a 1,8-dihydroxynaphthalene (DHN-type of pigment during sporulation with the influence of butyrolactone I under submerged culture.

  6. Chemical analysis of a genome wide polyketide synthase gene deletion library in Aspergillus nidulans

    DEFF Research Database (Denmark)

    Larsen, Thomas Ostenfeld; Klejnstrup, Marie Louise; Nielsen, Jakob Blæsbjerg

    . This may reflect that many PKs are either produced in small amounts, under special conditions or in developmental stages that are rarely observed under laboratory conditions. In order to trigger expression of “silent” genes we are currently pursuing several approaches; i) stimulation of A. nidulans wild...

  7. Transcriptional factor influence on OTA production and the quelling ...

    African Journals Online (AJOL)

    This study determined the influence of some transcriptional factors on ochratoxin A production as well as investigates the quelling attributes of some designed siRNA on the OTA producing Aspergillus section Nigri using standard recommended techniques. Results obtained following comparison of the pks gene promoter ...

  8. Devolatilization studies of oil palm biomass for torrefaction process optimization

    International Nuclear Information System (INIS)

    Daud, D; Rahman, A Abd; Shamsuddin, A H

    2013-01-01

    Torrefaction of palm biomass, namely Empty Fruit Bunch (EFB) and Palm Kernel Shell (PKS), was conducted using thermogravimetric analyser (TGA). The experiment was conducted in variation of temperatures of 200 °C, 260 °C and 300 °C at a constant residence time of 30 minutes. During the torrefaction process, the sample went through identifiable drying and devolatilization stages from the TGA mass loss. The percentage of volatile gases released was then derived for each condition referring to proximate analysis results for both biomass. It was observed an average of 96.64% and 87.53 % of the total moisture is released for EFB and PKS respectively. In all cases the volatiles released was observed to increase as the torrefaction temperature was increased with significant variation between EFB and PKS. At 300°C EFB lost almost half of its volatiles matter while PKS lost slightly over one third. Results obtained can be used to optimise condition of torrefaction according to different types of oil palm biomass.

  9. The effect of malnutrition on the pharmacokinetics and virologic outcomes of lopinavir, efavirenz and nevirapine in food insecure HIV-infected children in Tororo, Uganda

    NARCIS (Netherlands)

    Bartelink, Imke H.; Savic, Rada M.; Dorsey, Grant; Ruel, Theodore; Gingrich, David; Scherpbier, Henriette J.; Capparelli, Edmund; Jullien, Vincent; Young, Sera L.; Achan, Jane; Plenty, Albert; Charlebois, Edwin; Kamya, Moses; Havlir, Diane; Aweeka, Francesca

    2015-01-01

    Malnutrition may impact the pharmacokinetics (PKs) of antiretroviral medications and virologic responses in HIV-infected children. The authors therefore evaluated the PK of nevirapine (NVP), efavirenz (EFV) and lopinavir (LPV) in associations with nutritional status in a cohort of HIV-infected

  10. Pallister–Killian syndrome: Cytogenetics and molecular investigations of mosaic tetrasomy 12p in prenatal chorionic villus and in amniocytes. Strategy of prenatal diagnosis

    Directory of Open Access Journals (Sweden)

    Francesco Libotte

    2016-12-01

    Conclusion: New molecular cytogenetic techniques array comparative genomic hybridization and fluorescence in-situ hybridization in association with conventional karyotype are pivotal innovative tools to search for chromosomic anomalies and for a complete prenatal diagnosis, especially in cases such as PKS where array comparative genomic hybridization analysis alone could not show mosaicism of i(12p.

  11. Measurement of the neutral kaon regeneration amplitude in carbon at momenta below 1 GeV/c

    CERN Document Server

    Angelopoulos, Angelos; Aslanides, Elie; Backenstoss, Gerhard; Bargassa, P; Behnke, O; Benelli, A; Bertin, V; Blanc, F; Bloch, P; Carlson, P J; Carroll, M; Carvalho, J; Cawley, E; Charalambous, S; Chardin, G; Chertok, M B; Cody, A; Danielsson, M; Dejardin, M; Derré, J; Ealet, A; Eleftheriadis, C; Evangelou, I; Faravel, L; Ferreira-Marques, R; Fetscher, W; Fidecaro, Maria; Filipcic, A; Francis, D; Fry, J; Gabathuler, Erwin; Gamet, R; Garreta, D; Gerber, H J; Go, A; Haselden, A; Hayman, P J; Henry-Coüannier, F; Hollander, R W; Hubert, E; Jon-And, K; Kettle, P R; Kokkas, P; Kreuger, R; Le Gac, R; Leimgruber, F; Liolios, A; Machado, E; Mandic, I; Manthos, N; Marel, Gérard; Mikuz, M; Miller, J; Montanet, François; Müller, A; Nakada, Tatsuya; Pagels, B; Papadopoulos, I M; Pavlopoulos, P; Pinto da Cunha, J; Policarpo, Armando; Polivka, G; Rickenbach, R; Roberts, B L; Ruf, T; Sakelliou, L; Sanders, P; Schäfer, M; Schaller, L A; Schietinger, T; Schopper, A; Soares, A; Tauscher, Ludwig; Thibault, C; Touchard, F; Touramanis, C; Triantis, F A; Van Beveren, E; van Eijk, C W E; Vlachos, S; Weber, P; Wigger, I; Wolter, M; Yéche, C; Zavrtanik, D; Zimmerman, D

    1997-01-01

    The neutral kaon regeneration amplitude in carbon at momenta between 250 and 750~MeV/$c$ was determined by measuring the interference of inherent and coherently regenerated \\PKS\\ amplitudes. This interference appears in the rates of initially pure (tagged) \\PKz\\ and \\PaKz\\ decaying to \\Pgpp\\Pgpm\\ after crossing a carbon absorber.

  12. Pharmacokinetic profile of voriconazole in a critically ill patient on therapeutic plasma exchange

    NARCIS (Netherlands)

    Spriet, I.; Bruggemann, R.J.M.; Annaert, P.; Meersseman, P.; Wijngaerden, E. van; Lagrou, K.; Willems, L.

    2013-01-01

    BACKGROUND: Extracorporeal removal of drugs during therapeutic plasma exchange (TPE) can lead to decreased efficacy, as shown in several reports discussing altered pharmacokinetics (PKs) of antibiotics during TPE. In particular, drugs with a low volume of distribution or a high protein binding are

  13. Filling the Gaps in the Kirromycin Biosynthesis: Deciphering the Role of Genes Involved in Ethylmalonyl-CoA Supply and Tailoring Reactions

    DEFF Research Database (Denmark)

    Robertsen, Helene L.; Musiol-Kroll, Ewa M.; Ding, Ling

    2018-01-01

    Kirromycin is the main product of the soil-dwelling Streptomyces collinus Tü 365. The elucidation of the biosynthetic pathway revealed that the antibiotic is synthesised via a unique combination of trans-/cis-AT type I polyketide synthases and non-ribosomal peptide synthetases (PKS I/NRPS). This ...

  14. Radiometric well logging instruments

    International Nuclear Information System (INIS)

    Davydov, A.V.

    1975-01-01

    The technical properties of well instruments for radioactive logging used in the radiometric logging complexes PKS-1000-1 (''Sond-1'') and PRKS-2 (''Vitok-2'') are described. The main features of the electric circuit of the measuring channels are given

  15. Polyketide synthases from poison hemlock (Conium maculatum L.).

    Science.gov (United States)

    Hotti, Hannu; Seppänen-Laakso, Tuulikki; Arvas, Mikko; Teeri, Teemu H; Rischer, Heiko

    2015-11-01

    Coniine is a toxic alkaloid, the biosynthesis of which is not well understood. A possible route, supported by evidence from labelling experiments, involves a polyketide formed by the condensation of one acetyl-CoA and three malonyl-CoAs catalysed by a polyketide synthase (PKS). We isolated PKS genes or their fragments from poison hemlock (Conium maculatum L.) by using random amplification of cDNA ends (RACE) and transcriptome analysis, and characterized three full-length enzymes by feeding different starter-CoAs in vitro. On the basis of our in vitro experiments, two of the three characterized PKS genes in poison hemlock encode chalcone synthases (CPKS1 and CPKS2), and one encodes a novel type of PKS (CPKS5). We show that CPKS5 kinetically favours butyryl-CoA as a starter-CoA in vitro. Our results suggest that CPKS5 is responsible for the initiation of coniine biosynthesis by catalysing the synthesis of the carbon backbone from one butyryl-CoA and two malonyl-CoAs. © 2015 FEBS.

  16. Ability of secondary metabolites from trichoderma virens to mediate communication during mutualistic or pathogenic interactions

    Science.gov (United States)

    A bioinformatic study was conducted to identify the putative genes in the biocontrol agent Trichoderma virens that encode for non-ribosomal peptide synthetases (NRPS). Gene expression analysis of 22 putative NRPSs and 4 NRPS/PKS (polyketide synthase) hybrid enzymes was conducted in the presence and...

  17. Two novel classes of enzymes are required for the biosynthesis of aurofusarin in Fusarium graminearum

    DEFF Research Database (Denmark)

    Frandsen, Rasmus John Normand; Schütt, Claes; Lund, Birgitte W.

    2011-01-01

    genes, aurZ and aurS. Targeted gene replacement of aurZ resulted in the discovery that the compound YWA1, rather than nor-rubrofusarin, is the primary product of F. graminearum polyketide synthase 12 (FgPKS12). AurZ is the first representative of a novel class of dehydratases that act on hydroxylated γ...

  18. Cloning and Sequencing of Protein Kinase cDNA from Harbor Seal (Phoca vitulina Lymphocytes

    Directory of Open Access Journals (Sweden)

    Jennifer C. C. Neale

    2004-01-01

    Full Text Available Protein kinases (PKs play critical roles in signal transduction and activation of lymphocytes. The identification of PK genes provides a tool for understanding mechanisms of immunotoxic xenobiotics. As part of a larger study investigating persistent organic pollutants in the harbor seal and their possible immunomodulatory actions, we sequenced harbor seal cDNA fragments encoding PKs. The procedure, using degenerate primers based on conserved motifs of human protein tyrosine kinases (PTKs, successfully amplified nine phocid PK gene fragments with high homology to human and rodent orthologs. We identified eight PTKs and one dual (serine/threonine and tyrosine kinase. Among these were several PKs important in early signaling events through the B- and T-cell receptors (FYN, LYN, ITK and SYK and a MAP kinase involved in downstream signal transduction. V-FGR, RET and DDR2 were also expressed. Sequential activation of protein kinases ultimately induces gene transcription leading to the proliferation and differentiation of lymphocytes critical to adaptive immunity. PKs are potential targets of bioactive xenobiotics, including persistent organic pollutants of the marine environment; characterization of these molecules in the harbor seal provides a foundation for further research illuminating mechanisms of action of contaminants speculated to contribute to large-scale die-offs of marine mammals via immunosuppression.

  19. Curved Walking Rehabilitation with a Rotating Treadmill in Patients with Parkinson’s Disease: A Proof of Concept

    Science.gov (United States)

    Godi, Marco; Giardini, Marica; Nardone, Antonio; Turcato, Anna Maria; Caligari, Marco; Pisano, Fabrizio; Schieppati, Marco

    2017-01-01

    Training subjects to step-in-place eyes open on a rotating platform while maintaining a fixed body orientation in space [podokinetic stimulation (PKS)] produces a posteffect consisting in inadvertent turning around while stepping-in-place eyes closed [podokinetic after-rotation (PKAR)]. Since the rationale for rehabilitation of curved walking in Parkinson’s disease is not fully known, we tested the hypothesis that repeated PKS favors the production of curved walking in these patients, who are uneasy with turning, even when straight walking is little affected. Fifteen patients participated in 10 training sessions distributed in 3 weeks. Both counterclockwise and clockwise PKS were randomly administered in each session. PKS velocity and duration were gradually increased over sessions. The velocity and duration of the following PKAR were assessed. All patients showed PKAR, which increased progressively in peak velocity and duration. In addition, before and at the end of the treatment, all patients walked overground along linear and circular trajectories. Post-training, the velocity of walking bouts increased, more so for the circular than the linear trajectory. Cadence was not affected. This study has shown that parkinsonian patients learn to produce turning while stepping when faced with appropriate training and that this capacity translates into improved overground curved walking. PMID:28293213

  20. Physical Properties of Biomass Fuel Briquette from Oil Palm ...

    African Journals Online (AJOL)

    ADOWIE PERE

    of fuel briquettes in this study in order to supplement the energy mix of the nation. PKS was pulverized ... fossil fuel in the world market is impacting negatively ... useful products that can be applied in many sectors ... at 350 µm, 250 µm and 150 µm with Octagon digital ... formula is one of the models developed to accurately.