WorldWideScience

Sample records for blastochloris viridis heterodimer

  1. Coexistence of Phases in a Protein Heterodimer

    Science.gov (United States)

    Krokhotin, Andrey; Liwo, Adam; Niemi, Antti J.; Scheraga, Harold A.

    2012-07-01

    A heterodimer consisting of two or more different kinds of proteins can display an enormous number of distinct molecular architectures. The conformational entropy is an essential ingredient in the Helmholtz free energy and, consequently, these heterodimers can have a very complex phase structure. Here, it is proposed that there is a state of proteins, in which the different components of a heterodimer exist in different phases. For this purpose, the structures in the protein data bank (PDB) have been analyzed, with radius of gyration as the order parameter. Two major classes of heterodimers with their protein components coexisting in different phases have been identified. An example is the PDB structure 3DXC. This is a transcriptionally active dimer. One of the components is an isoform of the intra-cellular domain of the Alzheimer-disease related amyloid precursor protein (AICD), and the other is a nuclear multidomain adaptor protein in the Fe65 family. It is concluded from the radius of gyration that neither of the two components in this dimer is in its own collapsed phase, corresponding to a biologically active protein. The UNRES energy function has been utilized to confirm that, if the two components are separated from each other, each of them collapses. The results presented in this work show that heterodimers whose protein components coexist in different phases, can have intriguing physical properties with potentially important biological consequences.

  2. The formation of heterodimers by vancomycin group antibiotics

    DEFF Research Database (Denmark)

    Staroske, T; O'Brien, DP; Jørgensen, Thomas J. D.

    2000-01-01

    The formation of heterodimers in mixtures of glycopeptide antibiotics has been detected by electrospray ionization mass spectrometry (ESI-MS), and dimerization constants have been determined. By using NMR spectroscopy, it has been shown that these heterodimers indeed exist in aqueous solution...

  3. Ontogenetic shift in response to prey-derived chemical cues in prairie rattlesnakes Crotalus viridis viridis

    Directory of Open Access Journals (Sweden)

    Anthony J. SAVIOLA, David CHISZAR, Stephen P. MACKESSY

    2012-08-01

    Full Text Available Snakes often have specialized diets that undergo a shift from one prey type to another depending on the life stage of the snake. Crotalus viridis viridis (prairie rattlesnake takes different prey at different life stages, and neonates typically prey on ectotherms, while adults feed almost entirely on small endotherms. We hypothesized that elevated rates of tongue flicking to chemical stimuli should correlate with particular prey consumed, and that this response shifts from one prey type to another as individuals age. To examine if an ontogenetic shift in response to chemical cues occurred, we recorded the rate of tongue flicking for 25 neonate, 20 subadult, and 20 adult (average SVL = 280.9, 552, 789.5 mm, respectively wild-caught C. v. viridis to chemical stimuli presented on a cotton-tipped applicator; water-soluble cues from two ectotherms (prairie lizard, Sceloporus undulatus, and house gecko, Hemidactylus frenatus, two endotherms (deer mouse, Peromyscus maniculatus and lab mouse, Mus musculus, and water controls were used. Neonates tongue flicked significantly more to chemical cues of their common prey, S. undulatus, than to all other chemical cues; however, the response to this lizard’s chemical cues decreased in adult rattlesnakes. Subadults tongue flicked with a higher rate of tongue flicking to both S. undulatus and P. maniculatus than to all other treatments, and adults tongue flicked significantly more to P. maniculatus than to all other chemical cues. In addition, all three sub-classes demonstrated a greater response for natural prey chemical cues over chemical stimuli of prey not encountered in the wild (M. musculus and H. frenatus. This shift in chemosensory response correlated with the previously described ontogenetic shifts in C. v. viridis diet. Because many vipers show a similar ontogenetic shift in diet and venom composition, we suggest that this shift in prey cue discrimination is likely a general phenomenon among viperid

  4. Biological factors controlling developmental duration, growth and metamorphosis of the larval green toad, Bufo viridis viridis

    Directory of Open Access Journals (Sweden)

    Gamal A. Bekhet

    2014-05-01

    Full Text Available The present study in a controlled laboratory setting provided important insights into both the degree of plasticity and the proximal environmental cues operating in the response of green toad tadpoles to pond drying, food level. It was concluded that timing of metamorphosis and size at metamorphosis were highly affected by pond duration. The effects of pond desiccation are reflected by shorter developmental duration and smaller size at metamorphosis as a result of increased crowding in the shallow tanks than tadpoles in the deep tanks. Bufo viridis raised on high food supplements grew faster than those raised on low food in low or high population density. In the tanks with decreased water and food levels, the tadpoles accelerate development and metamorphose earlier than tadpoles in higher food and water levels. The obtained data revealed that tadpoles grew faster under conditions of high population density than low one in either high or low food levels. Actual density had limited but significant effects on tadpole size and development. It also suggested that density regulation, acting on the tadpole stage, may be present in the population but was of less short-term importance than abiotic factors. Environmentally induced variation in developmental rates translated to changes in relative hind leg length. Hind leg length plasticity was positively correlated with growth rate plasticity. Finally, documenting the recent results of this study, B. viridis breed in temporary ponds and exhibited plasticity in developmental duration and growth rate in response to a change in water level.

  5. Genetic characterization of Perna viridis L. in peninsular Malaysia ...

    Indian Academy of Sciences (India)

    Mendelian inheritance and selective neutrality. Therefore, the objective of this paper is to validate whether local popula- tions of P. viridis collected from ...... between commercial and heritage turkeys (Meleagris gallopavo). Poultry Sci. 86, 46–49. Kimura M. and Crow J. F. 1964 The number of alleles that can be maintained in ...

  6. Genetic characterization of Perna viridis L. in peninsular Malaysia

    Indian Academy of Sciences (India)

    A total of 19 polymorphic microsatellite loci were used to analyse levels of genetic variation for 10 populations of Perna viridis L. collected from all over peninsular Malaysia. The populations involved in this study included Pulau Aman in Penang, Tanjung Rhu in Kedah, Bagan Tiang in Perak, Pulau Ketam in Selangor, Muar, ...

  7. Intoxication of sheep exposed to ozark milkweed (Asclepias viridis Walter).

    Science.gov (United States)

    Smith, R A; Scharko, P; Bolin, D; Hong, C B

    2000-12-01

    Some 20 sheep died 1 at a time on a farm in Fleming County, KY, in late July of 1999 after consumption of Asclepias viridis Walter. Major histological lesions were mild multifocal nonsuppurative myocarditis. Gross pathology revealed wet and heavy lungs. Many affected animals had a hunched appearance, and marked posterior paresis was also observed.

  8. Tolerance of High Inorganic Mercury of Perna viridis: Laboratory ...

    African Journals Online (AJOL)

    MICHAEL

    interesting. In this study, we looked into the metal accumulation by P. viridis exposed to a 'very' high level of inorganic Hg from the dissolved solution phase of seawater since the bioavailability of ... of the Straits of Malacca ranged from 0.8 to 41 ng/L. We used .... dominance of the gill as a site of Hg uptake (George,. 1982 ...

  9. Resonance coupling in plasmonic nanomatryoshka homo- and heterodimers

    Directory of Open Access Journals (Sweden)

    Arash Ahmadivand

    2016-06-01

    Full Text Available Here, we examine the electromagnetic (EM energy coupling and hybridization of plasmon resonances between closely spaced concentric nanoshells known as “nanomatryoshka” (NM units in symmetric and antisymmetric compositions using the Finite Difference Time Domain (FDTD analysis. Utilizing plasmon hybridization model, we calculated the energy level diagrams and verified that, in the symmetric dimer (in-phase mode in a homodimer, plasmonic bonding modes are dominant and tunable within the considered bandwidth. In contrast, in the antisymmetric dimer (out-of-phase mode in a heterodimer, due to the lack of the geometrical symmetry, new antibonding modes appear in the extinction profile, and this condition gives rise to repeal of dipolar field coupling. We also studied the extinction spectra and positions of the antibonding and bonding modes excited due to the energy coupling between silver and gold NM units in a heterodimer structure. Our analysis suggest abnormal shifts in the higher energy modes. We propose a method to analyze the behavior of multilayer concentric nanoshell particles in an antisymmetric orientation employing full dielectric function calculations and the Drude model based on interband transitions in metallic components. This study provides a method to predict the behavior of the higher energy plasmon resonant modes in entirely antisymmetric structures such as compositional heterodimers.

  10. Breeding phenology of Bufo viridis Laurenti, 1768 in Sicily

    Directory of Open Access Journals (Sweden)

    Alessandra Sicilia

    2006-11-01

    Full Text Available Bufo viridis Laurenti, 1768 is a common species that inhabits a wide variety of habitats. The different climates characterising its broad range lead to a high degree of variability in its seasonal activity and reproductive cycle. This paper reports some observations carried out on the breeding phenology of this species over a two year period in Mediterranean temporary ponds in Sicily. The reproductive period of Sicilian green toads extends into the autumn months, making it longer than that of other Italian populations. This behaviour seems due to the impact of xeric environmental conditions on the seasonal activity of the studied populations. The present study confirms that B. viridis is an opportunistic breeder with a wide margin of variability in annual reproductive cycle patterns, as would be expected of an ecologically variable species. The duration of the reproductive season varied between populations in the same year and between different years for the same population.

  11. Taxsonomical States of Lacerta viridis (LACERTIDAE) Populations from Turkey

    OpenAIRE

    ÇEVİK, İ. Ethem

    2014-01-01

    In this research, , A total of 64 MM and 37 VV adult specimens from Turkish Thrace and 158 MM and 188 VV adult specimens from Anatolia were investigated comparatively as two separate populations groups to determine the subspecific status of the species in Turkey. No significant differences are discernible between the two population groups from the viewpoints of pholidosis, morphometrical measurements and rations and pattern and coloration characteıistics. So the Turkish L. viridis populations...

  12. The complete mitochondrial genome of the green lizard Lacerta viridis viridis (Reptilia: Lacertidae) and its phylogenetic position within squamate reptiles.

    Science.gov (United States)

    Böhme, M U; Fritzsch, G; Tippmann, A; Schlegel, M; Berendonk, T U

    2007-06-01

    For the first time the complete mitochondrial genome was sequenced for a member of Lacertidae. Lacerta viridis viridis was sequenced in order to compare the phylogenetic relationships of this family to other reptilian lineages. Using the long-polymerase chain reaction (long PCR) we characterized a mitochondrial genome, 17,156 bp long showing a typical vertebrate pattern with 13 protein coding genes, 22 transfer RNAs (tRNA), two ribosomal RNAs (rRNA) and one major noncoding region. The noncoding region of L. v. viridis was characterized by a conspicuous 35 bp tandem repeat at its 5' terminus. A phylogenetic study including all currently available squamate mitochondrial sequences demonstrates the position of Lacertidae within a monophyletic squamate group. We obtained a narrow relationship of Lacertidae to Scincidae, Iguanidae, Varanidae, Anguidae, and Cordylidae. Although, the internal relationships within this group yielded only a weak resolution and low bootstrap support, the revealed relationships were more congruent with morphological studies than with recent molecular analyses.

  13. The greening of the coasts: review of the Perna viridis success story.

    NARCIS (Netherlands)

    Rajagopal, S.; Venugopalan, V.P.; Velde, G. van der; Jenner, H.A.

    2006-01-01

    The green mussel Perna viridis has been receiving a lot of attention from workers working in the research areas of intertidal ecology, aquaculture, pollution monitoring, biofouling, zoogeography and invasion biology. P. viridis is a remarkable species in terms of its ability to reach very high

  14. A Serological Investigation of Lacerta viridis (Laurenti, 1768) (Sauria: Lacertidae) Populations in Turkey

    OpenAIRE

    ARIKAN, Hüseyin; ATATÜR, Mehmet K.; ÇEVIK, I. Ethem

    1999-01-01

    A total of 58 (24 MM , 34 VV ) Lacerta viridis specimens, which were collected from Turkish Thrace and the Black Sea region of Anatolia, were evaluated serologically. The analyses support the view that a single race of L. viridis (L. v. meridionalis) inhabits Turkey.

  15. Parasites of prairie rattlesnakes (Crotalus viridis viridis) and gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico.

    Science.gov (United States)

    Pfaffenberger, G S; Jorgensen, N M; Woody, D D

    1989-04-01

    Three prairie rattlesnakes (Crotalus viridis viridis) and two gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico (USA) were examined for parasites. One cestode (Oochoristica osheroffi), and two nematode (Kalicephalus inermis and Physoloptera retusa) species were recovered from two infected rattlesnakes. One female gopher snake was infected with two nematode (K. inermis and Rhabdias spp.) and one mite (Entonyssus halli) species.

  16. Recyclable magnetite-silver heterodimer nanocomposites with durable antibacterial performance

    Directory of Open Access Journals (Sweden)

    Chunyan Yong

    2018-03-01

    Full Text Available There is a significant need for magnetite-silver nanocomposites that exhibit durable and recyclable antimicrobial activity. In this study, magnetic iron oxide nanoparticles (Fe3O4 NPs coated with ethylenediamine-modified chitosan/polyacrylic acid copolymeric layer (Fe3O4@ECS/PAA were fabricated. Subsequently, directly deposited silver (Ag NPs procedure was carried out to form the antibacterial heterodimers of Fe3O4@ECS/PAA-Ag NPs. The composition and morphology of the resultant nanostructures were confirmed by FT-IR, XRD, TEM and TGA. The overall length of the heterodimers was approximately 45 nm, in which the mean diameter of Fe3O4@ECS/PAA NPs reached up to 35 nm, and that of Ag NPs was around 15 nm. The mass fraction of silver NPs in the nanocomposites was about 63.1%. The obtained Fe3O4@ECS/PAA NPs exhibited good colloidal stability, and excellent response to additional magnetic field, making the NPs easy to recover after antibacterial tests. In particular, the Fe3O4@ECS/PAA-Ag NPs retained nearly 100% biocidal efficiency (106–107 CFU/mg nanoparticles for both Gram-negative bacteria E. coli and Gram-positive bacteria S. aureus throughout ten cycles without washing with any solvents or water, exhibiting potent and durable antibacterial activity.

  17. Oxygen consumption under copper and zinc stress in Perna viridis

    OpenAIRE

    Prabhudeva, K.N.; Menon, N.R.

    1986-01-01

    The rate of oxygen consumption by Perna viridis pre-exposed to copper and zinc was studied. Those test individuals pre-exposed to various zinc concentrations showed variability in oxygen consumption irrespective of concentrations and pre-exposure period. While those animals pre-exposed to various copper concentrations registered decrease in oxygen consumption at concentrations above 0.06 p.p.m. copper, pre-exposure to concentrations below 0.02 p.p.m. copper did not result in any clear cut cha...

  18. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis

    Directory of Open Access Journals (Sweden)

    Deleury Emeline

    2009-07-01

    Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest

  19. Taxonomy of Nephroselmis viridis sp. nov. (Nephroselmidophyceae, Chlorophyta), a sister marine species to freshwater N. olivacea.

    Science.gov (United States)

    Yamaguchi, Haruyo; Suda, Shoichiro; Nakayama, Takeshi; Pienaar, Richard N; Chihara, Mitsuo; Inouye, Isao

    2011-01-01

    The genus Nephroselmis (Nephroselmidophyceae), which had been placed in the Prasinophyceae, is one of the primitive green flagellates that are important to our understanding of the early evolution of green plants. We studied a new species of Nephroselmis isolated from Japan, Fiji and South Africa. This species has been known for a long time as undescribed species 'N. viridis.' N. viridis possesses some ultrastructural characters shared with only the freshwater type species N. olivacea, including a disc-like structure beneath the pyrenoid and bipolar spiny body scales with 1-5-8-5-1 spines. Molecular phylogenetic analysis based on 18S rDNA also supports a sister relationship between N. viridis and N. olivacea. However, N. viridis is distinguishable from N. olivacea by the shape of its starch sheath, its scales, its pigment composition and its habitat. In this paper, we designate the formal description of N. viridis sp. nov. We also describe variability in the 18S rDNA introns of various N. viridis strains. This detailed study of N. viridis provides some insights into the evolution of Nephroselmis.

  20. Quantification of Cooperativity in Heterodimer-DNA Binding Improves the Accuracy of Binding Specificity Models*

    Science.gov (United States)

    Isakova, Alina; Berset, Yves; Hatzimanikatis, Vassily; Deplancke, Bart

    2016-01-01

    Many transcription factors (TFs) have the ability to cooperate on DNA elements as heterodimers. Despite the significance of TF heterodimerization for gene regulation, a quantitative understanding of cooperativity between various TF dimer partners and its impact on heterodimer DNA binding specificity models is still lacking. Here, we used a novel integrative approach, combining microfluidics-steered measurements of dimer-DNA assembly with mechanistic modeling of the implicated protein-protein-DNA interactions to quantitatively interrogate the cooperative DNA binding behavior of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ):retinoid X receptor α (RXRα) heterodimer. Using the high throughput MITOMI (mechanically induced trapping of molecular interactions) platform, we derived equilibrium DNA binding data for PPARγ, RXRα, as well as the PPARγ:RXRα heterodimer to more than 300 target DNA sites and variants thereof. We then quantified cooperativity underlying heterodimer-DNA binding and derived an integrative heterodimer DNA binding constant. Using this cooperativity-inclusive constant, we were able to build a heterodimer-DNA binding specificity model that has superior predictive power than the one based on a regular one-site equilibrium. Our data further revealed that individual nucleotide substitutions within the target site affect the extent of cooperativity in PPARγ:RXRα-DNA binding. Our study therefore emphasizes the importance of assessing cooperativity when generating DNA binding specificity models for heterodimers. PMID:26912662

  1. Quantification of Cooperativity in Heterodimer-DNA Binding Improves the Accuracy of Binding Specificity Models.

    Science.gov (United States)

    Isakova, Alina; Berset, Yves; Hatzimanikatis, Vassily; Deplancke, Bart

    2016-05-06

    Many transcription factors (TFs) have the ability to cooperate on DNA elements as heterodimers. Despite the significance of TF heterodimerization for gene regulation, a quantitative understanding of cooperativity between various TF dimer partners and its impact on heterodimer DNA binding specificity models is still lacking. Here, we used a novel integrative approach, combining microfluidics-steered measurements of dimer-DNA assembly with mechanistic modeling of the implicated protein-protein-DNA interactions to quantitatively interrogate the cooperative DNA binding behavior of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ):retinoid X receptor α (RXRα) heterodimer. Using the high throughput MITOMI (mechanically induced trapping of molecular interactions) platform, we derived equilibrium DNA binding data for PPARγ, RXRα, as well as the PPARγ:RXRα heterodimer to more than 300 target DNA sites and variants thereof. We then quantified cooperativity underlying heterodimer-DNA binding and derived an integrative heterodimer DNA binding constant. Using this cooperativity-inclusive constant, we were able to build a heterodimer-DNA binding specificity model that has superior predictive power than the one based on a regular one-site equilibrium. Our data further revealed that individual nucleotide substitutions within the target site affect the extent of cooperativity in PPARγ:RXRα-DNA binding. Our study therefore emphasizes the importance of assessing cooperativity when generating DNA binding specificity models for heterodimers. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  2. A serine protease inhibitor from hemolymph of green mussel, Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Goswami, U.; Rojatkar, S.R.; Khan, M.I.

    Bioactivity guided fractions of cell-free hemolymph of bacterially challenged marine mussel, Perna viridis led to the isolation of a novel quaternary alkaloid 1, which was identified by its spectral data. The isolated molecule 1 has been found...

  3. Application of oxidative stress indices in natural populations of Perna viridis as biomarker of environmental pollution

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Verlecar, X.N.; Chainy, G.B.N.

    Oxidative stress indices were measured in gills and digestive glands of Perna viridis collected from three coastal locations in Goa i.e., Bambolim, Marmugao Harbour and Malim. In addition to lipid peroxidation, the activities of antioxidant enzymes...

  4. The complete mitochondrial genome of Lacerta bilineata and comparison with its closely related congener L. Viridis.

    Science.gov (United States)

    Kolora, Sree Rohit; Faria, Rui; Weigert, Anne; Schaffer, Stefan; Grimm, Annegret; Henle, Klaus; Sahyoun, Abdullah H; Stadler, Peter F; Nowick, Katja; Bleidorn, Christoph; Schlegel, Martin

    2017-01-01

    We sequenced the mitochondrial genome of the Western green lizard (Lacerta bilineata) using Illumina technology and additional Sanger sequencing. The assembled 17 086 bp mitogenome had a GC content of 40.32% and consisted of 13 protein-coding genes, 22 tRNA genes, two rRNA genes, and one control region (CR), with a gene order identical to the chordate consensus. In addition, we re-sequenced the mitogenome of the closely related Eastern green lizard L. viridis using the same techniques as for L. bilineata. The mitogenomes of L. bilineata and L. viridis showed a sequence identity of 94.4% and 99.9%, respectively, relative to the previously published L. viridis mitogenome. The phylogenetic reconstruction based on 17 Lacertinae mitogenomes using Anolis carolinensis as the outgroup supported L. bilineata and its sister species L. viridis as distinct lineages.

  5. Borrelia lusitaniae and green lizards (Lacerta viridis), Karst Region, Slovakia.

    Science.gov (United States)

    Majláthová, Viktória; Majláth, Igor; Derdáková, Marketa; Víchová, Bronislava; Pet'ko, Branislav

    2006-12-01

    In Europe, spirochetes within the Borrelia burgdorferi sensu lato complex are transmitted by Ixodes ricinus ticks. Specific associations are described between reservoir hosts and individual genospecies. We focused on green lizard (Lacerta viridis) as a host for ticks and potential host for borreliae. In 2004 and 2005, a total of 146 green lizards infested by ticks were captured, and 469 I. ricinus ticks were removed. Borrelial infection was detected in 16.6% of ticks from lizards. Of 102 skin biopsy specimens collected from lizards, 18.6% tested positive. The most frequently detected genospecies was B. lusitaniae (77.9%-94.7%). More than 19% of questing I. ricinus collected in areas where lizards were sampled tested positive for borreliae. B. garinii was the dominant species, and B. lusitaniae represented 11.1%. The presence of B. lusitaniae in skin biopsy specimens and in ticks that had fed on green lizards implicates this species in the transmission cycle of B. lusitaniae.

  6. Psychotria viridis: Chemical constituents from leaves and biological properties

    Directory of Open Access Journals (Sweden)

    DÉBORA B.S. SOARES

    Full Text Available ABSTRACT The phytochemical study of hexane, chloroform and methanol extracts from leaves of Psychotria viridis resulted in the identification of: the pentacyclic triterpenes, ursolic and oleanolic acid; the steroids, 24-methylene-cycloartanol, stigmasterol and β-sitosterol; the glycosylated steroids 3-O-β-D-glucosyl-β-sitosterol and 3-O-β-D-glucosyl-stigmasterol; a polyunsaturated triterpene, squalene; the esters of glycerol, 1-palmitoylglycerol and triacylglycerol; a mixture of long chain hydrocarbons; the aldehyde nonacosanal; the long chain fat acids hentriacontanoic, hexadecanoic and heptadenoic acid; the ester methyl heptadecanoate; the 4-methyl-epi-quinate and two indole alkaloids, N,N-dimethyltryptamine (DMT and N-methyltryptamine. The chemical structures were determined by means of spectroscopic (IR, 1H and 13C NMR, HSQC, HMBC and NOESY and spectrometric (CG-MS and LCMS-ESI-ITTOF methods. The study of biologic properties of P. viridis consisted in the evaluation of the acetylcholinesterase inhibition and cytotoxic activities. The hexane, chloroform, ethyl acetate and methanol extracts, the substances 24-methylene-cycloartanol, DMT and a mixture of 3-O-β-D-glucosyl-β-sitosterol and 3-O-β-D-glucosyl-stigmasterol showed cholinesterase inhibiting activity. This activity induced by chloroform and ethyl acetate extracts was higher than 90%. The methanol and ethyl acetate extracts inhibit the growth and/or induce the death of the tumor cells strains B16F10 and 4T1, without damaging the integrity of the normal cells BHK and CHO. DMT also demonstrated a marked activity against tumor cell strains B16F10 and 4T1.

  7. Mapping of HABs Contaminated In Green Shells (Perna viridis) in Semarang Bay

    Science.gov (United States)

    A'in, Churun; Suryanti, Suryanti; Haeruddin, Haeruddin

    2018-02-01

    The existence of Harmful Algae Blooms (HABs) can adversely affect the water like a mass death of fish and oxygen depletion. Some types of HABs can be contaminated with seafood and contain biotoxins that are detrimental to the health of humans who consume them. Green mussels (Perna viridis) has the properties of filter feeders so vulnerable to contamination HABs. This research was conducted to produce spatially thematic maps contaminated HABs in P. viridis so providing information about risk prediction P. viridis when consumed by humans. Sampling was done purposively in three (3) stations that represent the Bay Semarang namely western boundary waters (Kendal), middle (Semarang) and the eastern boundary (Demak). Sampling done two (2) times, namely East season (June -July) and the second transitional season (September) 2016. Analysis of HABs done either in water or body tissues of P. viridis through the analysis of food habit. The results shows that P. viridis genus positive contaminated HABs phytoplankton Tricodesmium and Ceratium. Spatial distribution and abundance of Tricodesmium genus Fitoplankton is wider and taller than the HABs Phytoplankton genus Ceratium. Group HABs are found in the tissues of P. viridis no potential as biotoxin that does not cause adverse health risks.

  8. Interferência interespecífica entre Amaranthus hybridus L. e Amaranthus viridis L. Interspecific interference between Amaranthus hybridus L. and Amaranthus viridis L.

    Directory of Open Access Journals (Sweden)

    Angela Maria Maluf

    1999-05-01

    Full Text Available O objetivo deste trabalho foi estudar a interferência interespecífica entre duas espécies de Amaranthus -- A. viridis e A. hybridus ¾, esta última com dois biótipos distintos (verde e roxo; ambas ocorriam associadas em dois locais. Nas populações de cada local foram feitos ensaios de substituição independentes, em vasos, nos quais observou-se que as populações que germinam mais prontamente são as que vencem em competição, ou seja, se estabelecem e produzem maior número de sementes. Houve tendência de A. hybridus (tipo verde dominar tanto A. hybridus (tipo roxo como A. viridis, e de A. hybridus (tipo roxo dominar A. viridis. Em cultivo misto, houve casos em que as espécies estavam competindo pelos mesmos recursos, ou explorando recursos diferentes do ambiente, ou mesmo com antagonismo mútuo.The objective of this paper was to study the interspecific interference between two Amaranthus species -- A. viridis and A. hybridus --, the latter with two distinct biotypes (green and purple; both species ocurred in two localities. In the populations of each of the locations, some independent substitution trials were made in pots, and it could be concluded that the populations that germinate more readily are those which are superior in competition i.e., those that establish themselves and produce the largest number of seeds. There was a tendency for A. hybridus (green biotype to dominate both A. hybridus (purple biotype and A. viridis, and for A. hybridus (purple biotype to dominate A. viridis. In mixed stands, there were cases where the species were competing for the same resources, cases where they were exploiting different environmental resources, and even cases of mutual antagonism.

  9. Al-Pd Nanodisk Heterodimers as Antenna-Reactor Photocatalysts.

    Science.gov (United States)

    Zhang, Chao; Zhao, Hangqi; Zhou, Linan; Schlather, Andrea E; Dong, Liangliang; McClain, Michael J; Swearer, Dayne F; Nordlander, Peter; Halas, Naomi J

    2016-10-12

    Photocatalysis uses light energy to drive chemical reactions. Conventional industrial catalysts are made of transition metal nanoparticles that interact only weakly with light, while metals such as Au, Ag, and Al that support surface plasmons interact strongly with light but are poor catalysts. By combining plasmonic and catalytic metal nanoparticles, the plasmonic "antenna" can couple light into the catalytic "reactor". This interaction induces an optical polarization in the reactor nanoparticle, forcing a plasmonic response. When this "forced plasmon" decays it can generate hot carriers, converting the catalyst into a photocatalyst. Here we show that precisely oriented, strongly coupled Al-Pd nanodisk heterodimers fabricated using nanoscale lithography can function as directional antenna-reactor photocatalyst complexes. The light-induced hydrogen dissociation rate on these structures is strongly dependent upon the polarization angle of the incident light with respect to the orientation of the antenna-reactor pair. Their high degree of structural precision allows us to microscopically quantify the photocatalytic activity per heterostructure, providing precise photocatalytic quantum efficiencies. This is the first example of precisely designed heterometallic nanostructure complexes for plasmon-enabled photocatalysis and paves the way for high-efficiency plasmonic photocatalysts by modular design.

  10. Setaria viridis floral-dip: A simple and rapid Agrobacterium-mediated transformation method

    Directory of Open Access Journals (Sweden)

    Polyana Kelly Martins

    2015-06-01

    Full Text Available Setaria viridis was recently described as a new monocotyledonous model species for C4 photosynthesis research and genetic transformation. It has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements that make it suitable for use as a model plant. We report an alternative method of S. viridis transformation using floral dip to circumvent the necessity of tissue culture phase for transgenic plant regeneration. S. viridis spikes at boot stage were selected to be immersed in Agrobacterium suspension. T1 seeds could be identified in 1.5–2 months after floral dipping. We demonstrated through molecular analysis and RFP expression that seeds and resulting plants from dipped inflorescences were transformed. Our results suggest the feasibility of S. viridis floral dip transformation as a time-saving and cost-effective compared with traditional methods. To our knowledge, this is the first report using floral dip in S. viridis as an Agrobacterium-mediated transformation method.

  11. High mortality and poor growth of green mussels, Perna viridis, in high chlorophyll- a environment

    Science.gov (United States)

    Soon, Tan Kar; Denil, Delta Jenetty; Ransangan, Julian

    2016-03-01

    The current study was carried out from May 2014 to April 2015 to estimate the stock status of P. viridis in Marudu Bay. The gonad development was monitored by histological examination, while the population parameters including asymptotic length ( L ∞), growth coefficient ( K), mortality rate ( Z, F and M), exploitation level ( E) and recruitment of P. viridis were estimated using the lengthfrequency data. Results of the current study demonstrated that P. viridis in Marudu Bay spawned throughout the year with two major peaks, one in April to May and another one in October to December. The recruitment pattern was continuous with the peak in May to June 2014, which corresponded to the first spawning peak in April. However, no significant recruitment was observed from the second spawning peak due to the difference in spawning timing between male and female populations. The estimated asymptotic length ( L ∞), growth coefficient ( K), total mortality ( Z), natural mortality ( M), fishing mortality ( F) and growth performance ( φ) of P. viridis in Marudu Bay were estimate to be 117 mm, 0.97 yr-1, 4.39 yr-1, 1.23 yr-1, 3.16 yr-1 and 4.123, respectively. The exponent b of the lengthweight relationship was 2.4 and exploitation level ( E) was 0.72. The high mortality, low condition indices and negative allometric of P. viridis in Marudu Bay is caused by a lack of suitable food in the surrounding water.

  12. Heavy metals concentration relationship with Perna viridis physical properties in Mengkabong Lagoon, Sabah, Malaysia.

    Science.gov (United States)

    Abdullah, Noraini; Tair, Rohana; Abdullah, Mohd Harun

    2014-01-01

    Perna viridis (P. viridis) has been identified as a good biological indicator in identifying environmental pollution, especially when there are various types of Heavy Metals Accumulations (HMA) inside its tissue. Based on the potential of P. viridis to accumulate heavy metals and the data on its physical properties, this study proffers to determine the relationships between both properties. The similarities of the physical properties are used to mathematical model their relationships, which included the size (length, width, height) and weight (wet and dry) of P. viridis, whilst the heavy metals are focused on concentrations of Pb, Cu, Cr, Cd and Zn. The concentrations of metal elements are detected by using Flame Atomic Adsorption Spectrometry. Results show that the mean concentration of Pb, Cu, Cr, Cd, Zn, length, width, height, wet weight and dry weight are: 1.12 +/- 1.00, 2.36 +/- 1.65, 2.12 +/- 2.74, 0.44 +/- 0.41 and 16.52 +/- 10.64 mg kg(-1) (dry weight), 105.08 +/- 14.35, 41.64 +/- 4.64, 28.75 +/- 3.92 mm, 14.56 +/- 3.30 and 2.37 +/- 0.86 g, respectively. It is also found out that the relationships between the Heavy Metals Concentrations (HMA) and the physical properties can be represented using Multiple Linear Regressions (MLR) models, relating that the HMA of Zinc has affected significantly the physical growth properties of P. viridis.

  13. Molecular characterization, ecology, and epidemiology of a novel Tymovirus in Asclepias viridis from Oklahoma.

    Science.gov (United States)

    Min, Byoung-Eun; Feldman, Tracy S; Ali, Akhtar; Wiley, Graham; Muthukumar, Vijay; Roe, Bruce A; Roossinck, Marilyn; Melcher, Ulrich; Palmer, Michael W; Nelson, Richard S

    2012-02-01

    Native virus-plant interactions require more understanding and their study will provide a basis from which to identify potential sources of emerging destructive viruses in crops. A novel tymovirus sequence was detected in Asclepias viridis (green milkweed), a perennial growing in a natural setting in the Tallgrass Prairie Preserve (TGPP) of Oklahoma. It was abundant within and frequent among A. viridis plants and, to varying extents, within other dicotyledonous and one grass (Panicum virgatum) species obtained from the TGPP. Extracts from A. viridis containing the sequence were infectious to a limited number of species. The virus genome was cloned and determined to be closely related to Kennedya yellow mosaic virus. The persistence of the virus within the Oklahoma A. viridis population was monitored for five successive years. Virus was present in a high percentage of plants within representative areas of the TGPP in all years and was spreading to additional plants. Virus was present in regions adjacent to the TGPP but not in plants sampled from central and south-central Oklahoma. Virus was present in the underground caudex of the plant during the winter, suggesting overwintering in this tissue. The RNA sequence encoding the virus coat protein varied considerably between individual plants (≈3%), likely due to drift rather than selection. An infectious clone was constructed and the virus was named Asclepias asymptomatic virus (AsAV) due to the absence of obvious symptoms on A. viridis.

  14. Abscission zone development in Setaria viridis and its domesticated relative, Setaria italica.

    Science.gov (United States)

    Hodge, John G; Kellogg, Elizabeth A

    2016-06-01

    Development of an abscission zone (AZ) is needed for dispersal of seeds, and AZ loss was a critical early step in plant domestication. The AZ forms in different tissues in different species of plants, but whether the AZ is developmentally similar wherever it occurs is unknown. AZ development in Setaria viridis was studied as a representative of the previously uncharacterized subfamily Panicoideae. One accession of the wild species S. viridis and two of its domesticate, S. italica, were studied. Strength of the AZ was measured with a force gauge. Anatomy of the AZ was studied throughout development using bright field and confocal microscopy. The force required to remove a spikelet of S. viridis from the parent plant dropped steadily during development, whereas that required to remove spikelets of S. italica increased initially before stabilizing at a high level. Despite the clear difference in tensile strength of the AZ, anatomical differences between S. viridis and S. italica were subtle, and the position of the AZ was not easy to determine in cross sections of pedicel apices. Staining with DAPI showed that nuclei were present up to and presumably through abscission in S. viridis, and acridine orange staining showed much less lignification than in other cereals. The AZ in Setaria is developmentally and anatomically different from that characterized in rice, barley, and many eudicots. In particular, no set of small, densely cytoplasmic cells is obvious. This difference in anatomy could point to differential genetic control of the structure. © 2016 Botanical Society of America.

  15. Morphological, phylogenetic, and ecological diversity of the new model species Setaria viridis (Poaceae: Paniceae) and its close relatives.

    Science.gov (United States)

    Layton, Daniel J; Kellogg, Elizabeth A

    2014-03-01

    Species limits of the emerging model organism Setaria viridis (tribe Paniceae, subtribe Cenchrinae) are not well defined. It is thought to be related to S. adhaerens, S. faberi, S. verticillata, and S. verticilliformis and in North America occurs with the morphologically similar S. pumila. An integrated approach was taken to evaluate its variation and relationships with the other taxa. Statistical morphology, flow cytometry, molecular phylogenetics, and growth experiments were employed to examine the group's physical variation, polyploidy, evolutionary relationships, and drought ecology, respectively. SETARIA VIRIDIS contributed one genome to the tetraploids S. faberi, S. verticillata, and S. verticilliformis; the other genome of the latter two was contributed by S. adhaerens. Setaria pumila is unrelated. Morphologically, S. viridis is most similar to S. faberi, but all tested accessions of S. viridis were diploid, whereas those of S. faberi were all tetraploid. Principal component analysis of 70 morphological characters consistently separated S. viridis from S. faberi, largely by spikelet characters. The diagnostic morphological characters are not affected by watering. Setaria faberi is far more sensitive to drought, in terms of mortality and morphological stunting, than S. viridis or S. pumila. SETARIA VIRIDIS is a diploid species and has contributed to several polyploid derivatives. The most morphologically similar of the polyploids is S. faberi, which differs in spikelet features, phylogenetics, genome size, and ecological response to drought. Researchers using field-collected S. viridis as a model organism will benefit from the clear delimitation provided in this study.

  16. Assessment of pollution in road runoff using a Bufo viridis biological assay

    International Nuclear Information System (INIS)

    Dorchin, A.; Shanas, U.

    2010-01-01

    Road runoff is a major source of environmental pollution, significantly threatening nearby aquatic habitats. Chemical analyses indicate high pollutant concentrations in the road's 'first flush', but bioassays are more advantageous for addressing the cumulative effects of the numerous pollutants within the runoff. We used Bufo viridis embryos and larvae to assess the toxicity of road runoff from two major highways in Israel. We show, for the first time, that exposure to midseason runoff not only has an adverse effect on growth and development rates of B. viridis larvae but can also lead to increased rates of morphological deformations. Seasonal first flushes, despite having higher metal concentrations, did not adversely affect the toad larvae, apparently due to a counter effect of organic matter that potentially served as a supplementary energy resource. Road runoff can be a major cause for a qualitative decrease in the quality of aquatic habitats threatening amphibians in Israel. - Highway runoff has detrimental effects on the development of B. viridis larvae.

  17. Complete genome sequence of Saccharomonospora viridis type strain (P101T)

    Energy Technology Data Exchange (ETDEWEB)

    Pati, Amrita; Sikorski, Johannes; Nolan, Matt; Lapidus, Alla; Copeland, Alex; Glavina Del Rio, Tijana; Lucas, Susan; Chen, Feng; Tice, Hope; Pitluck, Sam; Cheng, Jan-Fang; Chertkov, Olga; Brettin, Thomas; Han, Cliff; Detter, John C.; Kuske, Cheryl; Bruce, David; Goodwin, Lynne; Chain, Patrick; D' haeseleer, Patrik; Chen, Amy; Palaniappan, Krishna; Ivanova, Natalia; Mavromatis, Konstantinos; Mikhailova, Natalia; Rohde, Manfred; Tindall, Brian J.; Goker, Markus; Bristow, Jim; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Kyrpides1, Nikos C.; Klenk, Hans-Peter

    2009-05-20

    Saccharomonospora viridis (Schuurmans et al. 1956) Nonomurea and Ohara 1971 is the type species of the genus Saccharomonospora which belongs to the family Pseudonocardiaceae. S. viridis is of interest because it is a Gram-negative organism classified amongst the usually Gram-positive actinomycetes. Members of the species are frequently found in hot compost and hay, and its spores can cause farmer?s lung disease, bagassosis, and humidifier fever. Strains of the species S. viridis have been found to metabolize the xenobiotic pentachlorophenol (PCP). The strain described in this study has been isolated from peat-bog in Ireland. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of the family Pseudonocardiaceae, and the 4,308,349 bp long single replicon genome with its 3906 protein-coding and 64 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  18. A simple and highly efficient Agrobacterium-mediated transformation protocol for Setaria viridis

    Directory of Open Access Journals (Sweden)

    Polyana Kelly Martins

    2015-06-01

    Full Text Available The production and use of sugarcane in Brazil is very important for bioenergy production and is recognized as one of the most efficient in the world. In our laboratory, Setaria viridis is being tested as a model plant for sugarcane. S. viridis has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements that make it suitable for use as a model system. We report a highly efficient protocol for Agrobacterium-mediated genetic transformation of S. viridis. The optimization of several steps in tissue culture allowed the rapid regeneration of plants and increased the rate of transformation up to 29%. This protocol could become a powerful tool for functional genomics in sugarcane.

  19. Fibrin Hydrogel Based Bone Substitute Tethered with BMP-2 and BMP-2/7 Heterodimers

    Directory of Open Access Journals (Sweden)

    Lindsay S. Karfeld-Sulzer

    2015-03-01

    Full Text Available Current clinically used delivery methods for bone morphogenetic proteins (BMPs are collagen based and require large concentrations that can lead to dangerous side effects. Fibrin hydrogels can serve as osteoinductive bone substitute materials in non-load bearing bone defects in combination with BMPs. Two strategies to even further optimize such a fibrin based system include employing more potent BMP heterodimers and engineering growth factors that can be covalently tethered to and slowly released from a fibrin matrix. Here we present an engineered BMP-2/BMP-7 heterodimer where an N-terminal transglutaminase substrate domain in the BMP-2 portion provides covalent attachment to fibrin together with a central plasmin substrate domain, a cleavage site for local release of the attached BMP-2/BMP-7 heterodimer under the influence of cell-activated plasmin. In vitro and in vivo results revealed that the engineered BMP-2/BMP-7 heterodimer induces significantly more alkaline phosphatase activity in pluripotent cells and bone formation in a rat calvarial model than the engineered BMP-2 homodimer. Therefore, the engineered BMP-2/BMP-7 heterodimer could be used to reduce the amount of BMP needed for clinical effect.

  20. Heavy Metal Pb Content in the Seawater, Sediment and Green Mussel Tissue Perna Viridis

    OpenAIRE

    Haryono, M. Gandri; Mulyanto,; Kilawati, Yuni

    2017-01-01

    Accumulation of heavy metal Pb into the tissue can proceed through a food chain or environmental exposure. This study was to determine the content of heavy metals Pb in water, sediments and mussels (perna viridis). This research was conducted in March 2016, in the waters of Lekok Pasuruan at the three stations. TPI Station 1, Station 2 at the mouth of the Rejoso river and station 3 nearby PLTU 3. The water, sediments and green mussels (Perna viridis) samples were collected for Pb analysis usi...

  1. The Western Green Lizard Lacerta (viridis) bilineata Daudin, 1804 (Sauria: Lacertidae) in Slovenia and Croatia

    OpenAIRE

    Tvrtković, Nikola; Lazar, Bojan; Tome, Staša; Grbac, Irena

    1998-01-01

    Through a review of egg incubation times and the colour patterns of hatchlings of green lizards from the left side of the Soča (Isonzo) River, and the island of Cres, it has been found that they belong to a recently established species, Lacerta (viridis) bilineata Daudin 1802. It is from now on a member of the list of the herpetofauna of Slovenia and Croatia. At the same time L. viridis (Laurenti 1768) has been confirmed on the sand dunes around Đurđevac (Croatia). On the basis of the known d...

  2. Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis

    International Nuclear Information System (INIS)

    Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.

    1992-01-01

    Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)

  3. Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings.

    Science.gov (United States)

    Rochel, Natacha; Ciesielski, Fabrice; Godet, Julien; Moman, Edelmiro; Roessle, Manfred; Peluso-Iltis, Carole; Moulin, Martine; Haertlein, Michael; Callow, Phil; Mély, Yves; Svergun, Dmitri I; Moras, Dino

    2011-05-01

    Nuclear hormone receptors (NHRs) control numerous physiological processes through the regulation of gene expression. The present study provides a structural basis for understanding the role of DNA in the spatial organization of NHR heterodimers in complexes with coactivators such as Med1 and SRC-1. We have used SAXS, SANS and FRET to determine the solution structures of three heterodimer NHR complexes (RXR-RAR, PPAR-RXR and RXR-VDR) coupled with the NHR interacting domains of coactivators bound to their cognate direct repeat elements. The structures show an extended asymmetric shape and point to the important role played by the hinge domains in establishing and maintaining the integrity of the structures. The results reveal two additional features: the conserved position of the ligand-binding domains at the 5' ends of the target DNAs and the binding of only one coactivator molecule per heterodimer, to RXR's partner.

  4. Synthesis, morphological control, and antibacterial properties of hollow/solid Ag2S/Ag heterodimers

    KAUST Repository

    Pang, Maolin

    2010-08-11

    Ag2S and Ag are important functional materials that have received considerable research interest in recent years. In this work, we develop a solution-based synthetic method to combine these two materials into hollow/solid Ag2S/Ag heterodimers at room temperature. Starting from monodisperse Cu2O solid spheres, CuS hollow spheres can be converted from Cu2O through a modified Kirkendall process, and the obtained CuS can then be used as a solid precursor for preparation of the Ag2S/Ag heterodimers through ion exchange and photo-assisted reduction. We have found that formation of the Ag2S/Ag heterodimers is instantaneous, and the size of Ag nanocrystals on the hollow spheres of Ag2S can be controlled by changing the concentration and power of reducing agents in the synthesis. The growth of Ag nanoparticles on hollow spheres of Ag2S in the dimers is along the [111] direction of the silver crystal; the light absorption properties have also been investigated. Furthermore, coupling or tripling of Ag2S/Ag heterodimers into dumbbell-like trimers ((Ag 2S)2/Ag, linear) and triangular tetramers ((Ag 2S)3/Ag, coplanar) can also be attained at 60°C by adding the bidentate ligand ethylenediamine as a cross-linking agent. To test the applicability of this highly asymmetric dipolar composite, photocatalytic inactivation of Escherichia coli K-12 in the presence of the as-prepared Ag 2S/Ag heterodimers has been carried out under UV irradiation. The added Ag2S/Ag heterodimers show good chemical stability under prolonged UV irradiation, and no appreciable solid dissolution is found. Possible mechanisms regarding the enhanced antibacterial activity have also been addressed. © 2010 American Chemical Society.

  5. Oxygen dynamics and porewater transport in sediments inhabited by the invasive polychaete Marenzelleria viridis

    DEFF Research Database (Denmark)

    Jovanovic, Zeljko; Larsen, Morten; Quintana, Cintia Organo

    2014-01-01

    The polychaete Marenzelleria viridis is an invasive species and often replaces the native Nereis diversicolor. This shift leads to more reduced conditions and changes in the biogeochemical function of the sediments. By combining imaging techniques for O2 (planar optodes) and irrigation patterns...

  6. Kleptoplasts photoacclimation state modulates the photobehaviour of the solar-powered sea slug Elysia viridis.

    Science.gov (United States)

    Cartaxana, Paulo; Morelli, Luca; Quintaneiro, Carla; Calado, Gonçalo; Calado, Ricardo; Cruz, Sónia

    2018-04-30

    Some sacoglossan sea slugs incorporate intracellular functional algal chloroplasts (kleptoplasty) for periods ranging from a few days to several months. Whether this association modulates the photobehaviour of solar-powered sea slugs is unknown. In this study, the long-term retention species Elysia viridis showed avoidance of dark independently of light acclimation state. On the contrary, Placida dendritica , which shows non-functional retention of kleptoplasts, showed no preference over dark, low or high light. High light acclimated (HL ac ) E. viridis showed a higher preference for high light than low light acclimated (LL ac ) conspecifics. The position of the lateral folds (parapodia) was modulated by irradiance, with increasing light levels leading to a closure of parapodia and protection of kleptoplasts from high light exposure. Furthermore, closure of parapodia occurred at higher irradiances in HL ac E. viridis Our results strongly indicate that kleptoplasts photoacclimation state modulates the photobehaviour of the solar-powered sea slug E. viridis . © 2018. Published by The Company of Biologists Ltd.

  7. Setaria viridis floral-dip: A simple and rapid Agrobacterium-medicated transformation method

    Science.gov (United States)

    Setaria viridis was recently described as a new monocotyledonous model species for C4 photosynthesis research and genetic transformation. It has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements) that make it suitable for use as a model plan...

  8. Chloride transport in toad skin (Bufo viridis). The effect of salt adaptation

    DEFF Research Database (Denmark)

    Katz, U; Larsen, Erik Hviid

    1984-01-01

    The steady-state Cl- current across the skin of Bufo viridis adapted to tap water was found to be rectified. In skins bathed with NaCl Ringer on both sides, a large outward current, carried by influx of Cl-, was observed at a clamping voltage (V) of less than -50 mV (outside of the skin negative...

  9. Il rospo smeraldino Bufo viridis in Val d’Ossola (Amphibia: Anura: Bufonidae

    Directory of Open Access Journals (Sweden)

    Franco Zanghellini

    2006-11-01

    Full Text Available Vengono riportate le osservazioni di rospo smeraldino (Bufo viridis compiute tra il 1998 e il 2004 in Val d’Ossola (provincia del Verbano Cusio Ossola, un’area nella quale questa specie non era stata mai precedentemente segnalata.

  10. The invasive Asian green mussel Perna viridis in South Africa: all ...

    African Journals Online (AJOL)

    The Asian green mussel Perna viridis is an invasive Indo-Pacific species recently reported from South African harbours. To verify the invasion, a phylogenetic (and morphological) analysis of green-shelled mussels (n = 39), found in six South African harbours, was conducted using the mitochondrial cytochrome c oxidase ...

  11. A novel DNase like compound that inhibits virus propagation from Asian green mussel, Perna viridis (Linn.)

    Digital Repository Service at National Institute of Oceanography (India)

    Iqbal, A.N.M.Z.; Khan, M.S.

    with activity against bacteria and cancer cells10,17,26. In this study, we have identified potent DNases like bioactivity in CME and PPC from Perna viridis which indiscriminately digested both low molecular weight DNA (pBR 322) and high molecular weight...

  12. Sex determination in Bonellia viridis (Echiura : Bonelliidae): population dynamics and evolution

    Czech Academy of Sciences Publication Activity Database

    Berec, Luděk; Schembri, P. J.; Boukal S., David

    2005-01-01

    Roč. 108, č. 3 (2005), s. 473-484 ISSN 0030-1299 R&D Projects: GA AV ČR(CZ) KSK6005114; GA AV ČR(CZ) IAB1007201 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bonellia viridis Subject RIV: EH - Ecology, Behaviour Impact factor: 3.309, year: 2005

  13. [Cutaneous lesions with papillomatous structure associated with viruses in the green lizard (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1976-10-04

    Numerous papillomata affecting the skin of the dorsal part of the body occur in a population of Lacerta viridis reared in the laboratory. Electron microscopic study of three of these growths revealed the presence of viral particles belonging, from the morphological aspect, to the groups of the viruses of Herpes, Reo and Papova.

  14. Intestinal helminth communities in the green lizard, lacerta viridis, from bulgaria

    Science.gov (United States)

    Biserkov; Kostadinova

    1998-09-01

    A data set comprising individual host/parasite lists from 100 Lacerta viridis (Reptilia: Lacertidae) belonging to four isolated populations in Bulgaria was studied. A total of seven helminth species was recovered (Leptophallus nigrovenosus, Plagiorchis molini, Oswaldocruzia filiformis, Spauligodon extenuatus, Skrjabinelazia hoffmanni, Physaloptera clausa and Mesocestoides sp.). Lacerta viridis is a new host record for the first five of these species. Communities of intestinal helminths of L. viridis consist of a few species which resulted in a low species richness, abundance and diversity of infracommunities, which exhibit substantial homogeneity among the four samples. A similar pattern of dominance of two nematode species leading to a relatively high community similarity at both infra- and component community levels was observed. While intestinal helminth communities in lizards from 'marginal' habitats were dominated by the host generalist, O. filiformis, those in hosts from 'typical' habitats were dominated by the lizard specialist S. extenuatus. The results indicate that the characteristics of the host's habitat are important in determining the composition rather than structure of intestinal helminth communities in L. viridis.

  15. Content Heavy Metal Pb, Cd In Perna viridis And Sediments In Semarang Bay

    Science.gov (United States)

    Suprapto, D.; Suryanti, S.; Latifah, N.

    2018-02-01

    Waste disposal from human activities, generally contain heavy metals such as Pb and Cd which derived from industrial activities. The aims of the study were to know the concentration of Pb and Cd heavy metals contained in Perna viridis tissue, sediment and water at Semarang Bay. This study was conducted in May 2017 at Semarang Bay. - Samples were collected using purposive sampling method. The heavy metal content in the water and clam was observed using- APHA method and was analyzed using AAS (Atomic Absorption Spectrophotometer). The results showed that concentration of heavy metal of Pb in the water was 0.00-50.5mg/L and the Cd content was of 26.9-51.7 mg/L, whereas the concentration of Pb in the sediment is 445.5-2.053.0mg/L and Cd 963.3-2,150.0 mg/L. Pb content in soft tissue of Perna viridis - is 67.1-1.933.9 mg/L and the concentration of Cd was 203.5-5.787.3 mg/L. The analysis of Pb and Cd in seawater, sediment and soft tissue of Perna viridis according to Enviroment Ministerial decree (KepMenLH ) number 51 of 2004 and applied by NOAA 1999 does not exceed the quality standard, that meant that the Perna viridis has been contaminated by metal Pb it is controversial with the above sentence and Cd. It concluded that the metal content of Pb and Cd in Perna viridis tissue exceeds the quality standard, so it is not suitable to be consumed, especially in high quantity

  16. Chemical composition and antimicrobial and antioxidant activities of Mentha (longifolia L. and viridis) essential oils.

    Science.gov (United States)

    Mkaddem, Mounira; Bouajila, Jalloul; Ennajar, Monia; Lebrihi, Ahmed; Mathieu, Florence; Romdhane, Mehrez

    2009-09-01

    The study was aimed to investigate essential oil chemical composition (gas chromatography/flame ionization detection [GC-FID] and gas chromatography/mass spectrometry [GC-MS]) and antioxidant (1,1-diphenyl-2-picrylhydrazyl free radical (DPPH) and 2,2'-azinobis-3-ethylbenzothiazoline-6-sulphonate [ABTS] assays) and antimicrobial (Gram-positive and Gram-negative bacteria, fungi, and yeast) activities of essential oils extracted from leaves of Mentha longifolia L. and Mentha viridis. GC-MS analysis revealed that M. longifolia was constituted by pulegone (54.41%) as a major component followed by isomenthone (12.02%), 1,8-cineole (7.41%), borneol (6.85%), and piperitenone oxide (3.19%). M. viridis was rich in carvone (50.47%), 1,8-cineole (9.14%), and limonene (4.87%). The antioxidant activity by ABTS assay showed IC(50) values of 476.3 +/- 11.7 and 195.1 +/- 4.2 mg/L for M. longifolia and M. viridis, respectively, the DPPH assays have resulted in a moderate IC(50) (>8000 mg/L and 3476.3 +/- 133 mg/L for M. longifolia and M. viridis, respectively). Antimicrobial activity showed that Listeria monocytogenes and Klebsiella pneumoniae bacteria were more inhibited by the 2 essential oils tested. Escherichia coli was least susceptible. A strong activity was also observed on fungi and yeasts. Carvone, thymol, and piperitone oxide have not been detected in Tunisian M. longifolia. Camphor is reported for the 1st time for M. viridis. Antioxidant and antibacterial activities were correlated to chemical composition.

  17. Screened bonding, antibonding and charge transfer plasmon modes in conductively connected nanorod heterodimer

    Science.gov (United States)

    Zhang, Mingsi; Qi, Jiwei; Jiang, Meiling; Li, Yudong; Qian, Jun; Chen, Jing; Chen, Zongqiang; Sun, Qian; Xu, Jingjun

    2018-02-01

    Screened bonding (SB), screened antibonding (SA) and charge transfer plasmon (CTP) modes in the conductively connected nanorod heterodimer are studied in detail by simulation. All of the SB, SA and CTP modes can be observed in the extinction spectra of the conductively connected nanorod heterodimer. Also, the amplitudes of the three modes can be tuned by changing the radius of the cylinder conductive connection. Even the amplitude of the SA mode can be tuned to be higher than that of the SB mode, which is difficult to achieve in an unconnected nanorod heterodimer. Furthermore, the wavelengths of the three plasmon modes can be adjusted with a high degree of freedom, since the wavelength of the SB mode mainly depends on the length of the longer nanorod, the wavelength of the SA mode mainly depends on the length of the shorter nanorod and the wavelength of the CTP mode mainly depends on the total length of the nanorod heterodimer. Our study will be helpful for the design of plasmon enhancement devices, such as surface enhanced Raman scattering (SERS), plasmon enhanced fluorescence, plasmon rulers and so on.

  18. Sinapate dehydrodimers and sinapate−ferulate heterodimers in cereal dietary fiber

    Science.gov (United States)

    Mirko Bunzel; John Ralph; Hoon Kim; Fachuang Lu; Sally A. Ralph; Jane M. Marita; Ronald D. Hatfield; Hans Steinhart

    2003-01-01

    Two 8-8-coupled sinapic acid dehydrodimers and at least three sinapate-ferulate heterodimers have been identified as saponification products from different insoluble and soluble cereal grain dietary fibers. The two 8-8-disinapates were authenticated by comparison of their GC retention times and mass spectra with authentic dehydrodimers synthesized from methyl or ethyl...

  19. Bistable optical response of a nanoparticle heterodimer : Mechanism, phase diagram, and switching time

    NARCIS (Netherlands)

    Nugroho, Bintoro; Iskandar, Alexander; Malyshev, V.A.; Knoester, Jasper

    2013-01-01

    We conduct a theoretical study of the bistable optical response of a nanoparticle heterodimer comprised of a closely spaced semiconductor quantum dot and a metal nanoparticle. The bistable nature of the response results from the interplay between the quantum dot's optical nonlinearity and its

  20. Spectral Sensitization of TiO2 Substrates by Monolayers of Porphyrin Heterodimers

    NARCIS (Netherlands)

    Koehorst, R.B.M.; Boschloo, G.K.; Savenije, T.J.; Goossens, A.; Schaafsma, T.J.

    2000-01-01

    Photoelectrochemical cells have been constructed by depositing monolayers of oriented covalently linked zinc/free base porphyrin heterodimers onto ~30 nm nonporous layers of TiO2 on ITO, deposited by metal-organic chemical vapor deposition (MO-CVD), and onto ~100 nm porous, nanostructured TiO2

  1. Complete mitochondrial genomes of the three brown algae (Heterokonta : Phaeophyceae) Dictyota dichotoma, Fucus vesiculosus and Desmarestia viridis

    NARCIS (Netherlands)

    Secq, MPO; Goer, SL; Stam, WT; Olsen, JL; Oudot-LeSecq, M.-P.

    We report the complete mitochondrial sequences of three brown algae (Dictyota dichotoma, Fucus vesiculosus and Desmarestia viridis) belonging to three phaeophycean lineages. They have circular mapping organization and contain almost the same set of mitochondrial genes, despite their size differences

  2. Response of DNA, proteins, lipids and antioxidant enzymes as measure of toxicity to mercury exposures in green mussel Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    Studies on exposures of gills of green-lipped mussel Perna viridis to sublethal levels of mercury (Hg) indicates that oxidative stress marker like lipids peroxidation and protein carbonyl content increase. With the exception of superoxide dismutase...

  3. PRELIMINARY STUDY ON EUBLEMMA SP. (EUBLEMMINAE: A LEPIDOPTERAN PREDATOR OF COCCUS VIRIDIS (HEMIPTERA: COCCIDAE ON COFFEE PLANTS IN BANDARLAMPUNG, INDONESIA

    Directory of Open Access Journals (Sweden)

    Indriyati .

    2015-03-01

    Full Text Available Preliminary study on Eublemma sp. (Eublemminae: a Lepidopteran predator of Coccus viridis (Hemiptera: Coccidae on coffee plants in Bandarlampung, Indonesia. The objectives of this study were 1 to identify a Lepidopteran predator of the soft green scale Coccus viridis and 2 to present preliminary data on the predator’s feeding rate. Some coffee leaves where eggs of the Lepidopteran predator have been laid in C. viridis colonies were taken from the field and observed in the laboratory. The predator’s growth and development was noted and the specimens were identified up to generic level based on the caterpillar morphology. Ten coffee leaves each with certain number of C. viridis were also collected from the field, transferred to the laboratory, and each was inoculated with one starved caterpillar that had just formed its protective casing. The number of surviving C. viridis was counted daily. This study reveals that the caterpillar, identified as Eublemma sp. Is found to feed obligately on C. viridis. The predation rate of Eublemma sp. in laboratory is 97 + 11 scales / caterpillar.

  4. Perdas causadas por Coccus viridis (Hemiptera: Coccidae em mudas de Coffea arabica L.

    Directory of Open Access Journals (Sweden)

    Flávio Lemes Fernandes

    2009-08-01

    Full Text Available Coccus viridis (Green danifica plantas jovens e adultas de Coffea arabica Linnaeu. No entanto, nada se sabe sobre a magnitude dos danos causados por esta praga. Assim, este trabalho teve por objetivo estudar as relações entre o ataque de C. viridis e as perdas causadas por este inseto a C. arabica. Este trabalho foi conduzido em casa de vegetação na Universidade Federal de Viçosa. Foram utilizadas sementes da linhagem IAC 15 da variedade “Catuaí vermelho” de café (C. arabica. Para a confecção dos tratamentos esta praga foi criada em casa de vegetação separada do experimento. Os tratamentos foram: plantas infestadas e não infestadas por adultos e ninfas da cochonilha verde. As plantas foram nutridas com solução nutritiva. Durante 110 dias foram avaliados: números de adultos e de ninfas de primeiro, segundo e terceiro ínstares, área foliar, diâmetro do caule, altura das plantas em todas repetições. No final do experimento avaliou-se o peso das raízes, caule, folhas e total. Os pesos das raízes, matéria seca total, área foliar e diâmetro do caule de plantas não atacadas por C. viridis superaram em 1,31; 1,41; 1,50 e 8,93 vezes, respectivamente o peso de plantas atacadas. As variáveis selecionadas foram: diâmetro do caule (cm, área foliar (cm², peso de raízes (g, ninfas, adultos e total das cochonilhas. Concluindo que a planta de C. arabica é afetada de forma diferente entre seus órgãos e que a ninfa de terceiro ínstar e adultos são as fases que mais causam danos a C. arabica.Losses Caused by Coccus viridis (Green (Hemiptera: Coccidae on Seedlings of Coffea arabica L.Abstract. Coccus viridis (Green cause losses on seedling and old plants of Coffea arabica (Green. However, nothing is known about of the damages caused by this pest. Thus, the objective of this work was to evaluate the relations between atack of C. viridis and the losses caused by this insect. on C. arabica. This work was conduced in greenhouse at

  5. Proteomic profile in Perna viridis after exposed to Prorocentrum lima, a dinoflagellate producing DSP toxins.

    Science.gov (United States)

    Huang, Lu; Zou, Ying; Weng, Hui-wen; Li, Hong-Ye; Liu, Jie-Sheng; Yang, Wei-Dong

    2015-01-01

    In the current study, we compared protein profiles in gills of Perna viridis after exposure to Prorocentrumlima, a dinoflagellate producing DSP toxins, and identified the differential abundances of protein spots using 2D-electrophoresis. After exposure to P. lima, the level of okadaic acid (a main component of DSP toxins) in gills of P. viridis significantly increased at 6 h, but mussels were all apparently healthy without death. Among the 28 identified protein spots by MALDI TOF/TOF-MS, 12 proteins were up-regulated and 16 were down-regulated in the P. lima-exposed mussels. These identified proteins were involved in various biological activities, such as metabolism, cytoskeleton, signal transduction, response to oxidative stress and detoxification. Taken together, our results indicated that the presence of P. lima caused DSP toxins accumulation in mussel gill, and might consequently induce cytoskeletonal disorganization,oxidative stress, a dysfunction in metabolism and ubiquitination/proteasome activity.

  6. Interactions of a Pop5/Rpp1 heterodimer with the catalytic domain of RNase MRP.

    Science.gov (United States)

    Perederina, Anna; Khanova, Elena; Quan, Chao; Berezin, Igor; Esakova, Olga; Krasilnikov, Andrey S

    2011-10-01

    Ribonuclease (RNase) MRP is a multicomponent ribonucleoprotein complex closely related to RNase P. RNase MRP and eukaryotic RNase P share most of their protein components, as well as multiple features of their catalytic RNA moieties, but have distinct substrate specificities. While RNase P is practically universally found in all three domains of life, RNase MRP is essential in eukaryotes. The structural organizations of eukaryotic RNase P and RNase MRP are poorly understood. Here, we show that Pop5 and Rpp1, protein components found in both RNase P and RNase MRP, form a heterodimer that binds directly to the conserved area of the putative catalytic domain of RNase MRP RNA. The Pop5/Rpp1 binding site corresponds to the protein binding site in bacterial RNase P RNA. Structural and evolutionary roles of the Pop5/Rpp1 heterodimer in RNases P and MRP are discussed.

  7. Disseminated Mycobacterium celatum infection in a white-tailed trogon (Trogon viridis)

    DEFF Research Database (Denmark)

    Bertelsen, M. F.; Grondahl, C.; Giese, Steen Bjørck

    2006-01-01

    An adult female white-tailed trogon (Trogon viridis) was presented with abdominal enlargement and hard subcutaneous masses. Necropsy findings included bony masses extending from skeletal structures, disseminated pale foci in the liver, and a pale mass in the kidney. Histological examination revea...... revealed multifocal to coalescing granulomatous inflammation in the bone, liver, kidney, lung and spleen. Mycobacterium celatum was isolated from the liver and identified by DNA sequencing. This is the first report of M. celatum infection in an avian species....

  8. Comparative performance of the mussels Perna perna and Perna viridis, cultivated at four different depths

    Directory of Open Access Journals (Sweden)

    Marielyn García

    Full Text Available Abstract This study aims to evaluate the effect of environmental variability on the growth and survival of the subtropical and tropical mussels Perna perna and Perna viridis at four different culture depths in the Gulf of Cariaco during an annual cycle. Juveniles of P. perna (39.1±1.88 mm in shell length and P. viridis (36.7±1.87 mm were sown on nylon ropes (3/4" and suspended from a raft at 1, 3, 6 and 9 m depths. Every six weeks, three replicates of each species were sampled (10 individuals per replicate at each depth. Growth parameters were determined: mass and shell length, dry mass of soft tissues as well as fouling and survival rates. Temperature, transparency, chlorophyll a, oxygen, salinity and particulate organic and inorganic matter were recorded at each culture depth for the purpose of relating growth and survival to environmental change. The results show that the growth of both species was linked to the environment, especially with regard to the influence of the food and temperature. A period of stagnant growth of P. perna was associated with the higher temperature and lower phytoplankton biomass that is characteristic of the season with prevalent water column stratification (August-November 2007. By contrast, the growth of P. viridis did not stagnate, although it was gradual and relatively lower. At the end, P. perna achieved higher growth rates than P. viridis. Possible culture strategies to improve the production of both mussel species are discussed.

  9. Identification of lysozyme activity from two edible bivalves - Perna viridis (Linnaeus) and Meretrix casta (Chemnitz)

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, S.; Tanu; Chatterji, A.

    Pertanika J. Trop. Agric. Sci. 32(1): 85 - 90 (2009) ISSN: 1511-3701 ©Universiti Putra Malaysia Press Received: 20 May 2008 Accepted: 8 October 2008 * Corresponding Author Identification of Lysozyme Activity from Two Edible Bivalves - Perna viridis... (Linnaeus) and Meretrix casta (Chemnitz) Sumita Sharma 1* , Tanu 2 and Anil Chatterji 3 1 National Institute of Oceanography, Dona Paula, Goa, India 2 Banasthali Universiti, Rajasthan 3 Institute of Tropical Aquaculture, Universiti Malaysia Terengganu...

  10. Comment on "Engineering coherence among excited states in synthetic heterodimer systems".

    Science.gov (United States)

    Halpin, Alexei; Johnson, Philip J M; Miller, R J Dwayne

    2014-06-06

    Hayes et al. (Reports, 21 June 2013, p. 1431) used two-dimensional (2D) electronic spectroscopy to study molecular heterodimers and reported a general mechanism for the prolongation of electronic coherences, consistent with previous interpretations of 2D spectra for light-harvesting systems. We argue that the dynamics attributed to electronic coherences are inconclusive based on experimental inconsistencies arising from limited sample characterization and insufficient control measurements. Copyright © 2014, American Association for the Advancement of Science.

  11. Proton transfer in histidine-tryptophan heterodimers embedded in helium droplets

    Energy Technology Data Exchange (ETDEWEB)

    Bellina, Bruno; Merthe, Daniel J.; Kresin, Vitaly V. [Department of Physics and Astronomy, University of Southern California, Los Angeles, California 90089-0484 (United States)

    2015-03-21

    We used cold helium droplets as nano-scale reactors to form and ionize, by electron bombardment and charge transfer, aromatic amino acid heterodimers of histidine with tryptophan, methyl-tryptophan, and indole. The molecular interaction occurring through an N–H ⋅ ⋅ ⋅ N hydrogen bond leads to a proton transfer from the indole group of tryptophan to the imidazole group of histidine in a radical cationic environment.

  12. Parasites and pathological condition in Green mussel Perna viridis Linnaeus, 1758 from western Johor Straits, Malaysia

    Science.gov (United States)

    Azmi, Nur-Fauzana; Ghaffar, Mazlan Abd.; Cob, Zaidi Che

    2018-04-01

    This study describes the parasites and pathological condition of infected organ of the green mussel Perna viridis from Merambong Shoal, Western Johor Straits, Malaysia. Samples were collected randomly in November and December 2013. Histopathology techniques using Masson's Trichrome staining protocol were performed and the thin sections were observed under light microscope. Result showed that gonad was the most infected organ followed by the digestive tubule, adductor muscle, intestine and mantle tissue. The parasites (apicomplexa) such as spore-like Nematopsis, macrogamont-like coccidian, mature oocyst-like coccidian, unidentified coccidian and protozoan were found in the adductor muscle, gonad and mantle. Meanwhile, the pathological conditions were found in all infected organs except the gill, such as particular melanin deposits in cytoplasm, Rickettsia-like or Chlamydiae organism and bacteria-like inclusions. Haemocytic infiltrations were found in the surrounding connective tissues of all infected organs. However, these light infections are not causing morbidity and mortalityof the green mussel P.viridis. This study provides baseline information on health profile of the green mussel P.viridis. Further investigations are needed particularly on parasite species identification and their ecology. Understanding of the morphology and pathology of parasites infecting mollusks are very important for management of the resources.

  13. Interaction of Temperature and Photoperiod Increases Growth and Oil Content in the Marine Microalgae Dunaliella viridis.

    Directory of Open Access Journals (Sweden)

    Soundarya Srirangan

    Full Text Available Eukaryotic marine microalgae like Dunaliella spp. have great potential as a feedstock for liquid transportation fuels because they grow fast and can accumulate high levels of triacylgycerides with little need for fresh water or land. Their growth rates vary between species and are dependent on environmental conditions. The cell cycle, starch and triacylglycerol accumulation are controlled by the diurnal light:dark cycle. Storage compounds like starch and triacylglycerol accumulate in the light when CO2 fixation rates exceed the need of assimilated carbon and energy for cell maintenance and division during the dark phase. To delineate environmental effects, we analyzed cell division rates, metabolism and transcriptional regulation in Dunaliella viridis in response to changes in light duration and growth temperatures. Its rate of cell division was increased under continuous light conditions, while a shift in temperature from 25 °C to 35 °C did not significantly affect the cell division rate, but increased the triacylglycerol content per cell several-fold under continuous light. The amount of saturated fatty acids in triacylglycerol fraction was more responsive to an increase in temperature than to a change in the light regime. Detailed fatty acid profiles showed that Dunaliella viridis incorporated lauric acid (C12:0 into triacylglycerol after 24 hours under continuous light. Transcriptome analysis identified potential regulators involved in the light and temperature-induced lipid accumulation in Dunaliella viridis.

  14. Setaria viridis as a model system to advance millet genetics and genomics

    Directory of Open Access Journals (Sweden)

    Pu Huang

    2016-11-01

    Full Text Available Millet is a common name for a group of polyphyletic, small-seeded cereal crops that include pearl, finger and foxtail millet. Millet species are an important source of calories for many societies, often in developing countries. Compared to major cereal crops such as rice and maize, millets are generally better adapted to dry and hot environments. Despite their food security value, the genetic architecture of agronomically important traits in millets, including both morphological traits and climate resilience remains poorly studied. These complex traits have been challenging to dissect in large part because of the lack of sufficient genetic tools and resources. In this article, we review the phylogenetic relationship among various millet species and discuss the value of a genetic model system for millet research. We propose that a broader adoption of green foxtail (Setaria viridis as a model system for millets could greatly accelerate the pace of gene discovery in the millets, and summarize available and emerging resources in S. viridis and its domesticated relative S. italica. These resources have value in forward genetics, reverse genetics and high throughput phenotyping. We describe methods and strategies to best utilize these resources to facilitate the genetic dissection of complex traits. We envision that coupling cutting-edge technologies and the use of S. viridis for gene discovery will accelerate genetic research in millets in general. This will enable strategies and provide opportunities to increase productivity, especially in the semi-arid tropics of Asia and Africa where millets are staple food crop.

  15. Assessment of pollution in road runoff using a Bufo viridis biological assay

    Energy Technology Data Exchange (ETDEWEB)

    Dorchin, A., E-mail: adorchin@campus.haifa.ac.i [Department of Evolutionary and Environmental Biology, Faculty of Natural Sciences, University of Haifa, Mount Carmel, Haifa 31905 (Israel); Shanas, U., E-mail: shanas@research.haifa.ac.i [Department of Evolutionary and Environmental Biology, Faculty of Natural Sciences, University of Haifa, Mount Carmel, Haifa 31905 (Israel); Department of Biology, Faculty of Natural sciences, University of Haifa - Oranim, Tiv' on 36006 (Israel)

    2010-12-15

    Road runoff is a major source of environmental pollution, significantly threatening nearby aquatic habitats. Chemical analyses indicate high pollutant concentrations in the road's 'first flush', but bioassays are more advantageous for addressing the cumulative effects of the numerous pollutants within the runoff. We used Bufo viridis embryos and larvae to assess the toxicity of road runoff from two major highways in Israel. We show, for the first time, that exposure to midseason runoff not only has an adverse effect on growth and development rates of B. viridis larvae but can also lead to increased rates of morphological deformations. Seasonal first flushes, despite having higher metal concentrations, did not adversely affect the toad larvae, apparently due to a counter effect of organic matter that potentially served as a supplementary energy resource. Road runoff can be a major cause for a qualitative decrease in the quality of aquatic habitats threatening amphibians in Israel. - Highway runoff has detrimental effects on the development of B. viridis larvae.

  16. Binary Toxin Subunits of Lysinibacillus sphaericus Are Monomeric and Form Heterodimers after In Vitro Activation.

    Directory of Open Access Journals (Sweden)

    Wahyu Surya

    Full Text Available The binary toxin from Lysinibacillus sphaericus has been successfully used for controlling mosquito-transmitted diseases. An activation step shortens both subunits BinA and BinB before their interaction with membranes and internalization in midgut cells, but the precise role of this activation step is unknown. Herein, we show conclusively using three orthogonal biophysical techniques that protoxin subunits form only monomers in aqueous solution. However, in vitro activated toxins readily form heterodimers. This oligomeric state did not change after incubation of these heterodimers with detergent. These results are consistent with the evidence that maximal toxicity in mosquito larvae is achieved when the two subunits, BinA and BinB, are in a 1:1 molar ratio, and directly link proteolytic activation to heterodimerization. Formation of a heterodimer must thus be necessary for subsequent steps, e.g., interaction with membranes, or with a suitable receptor in susceptible mosquito species. Lastly, despite existing similarities between BinB C-terminal domain with domains 3 and 4 of pore-forming aerolysin, no aerolysin-like SDS-resistant heptameric oligomers were observed when the activated Bin subunits were incubated in the presence of detergents or lipidic membranes.

  17. STUDI BIOAKUMULASI MERKURI DARI JALUR AIR LAUT OLEH KERANG DARAH (ANADARA GRANOSA DAN KERANG HIJAU (PERNA VIRIDIS

    Directory of Open Access Journals (Sweden)

    Heny Suseno

    2016-10-01

    Full Text Available ABSTRACT Blood cockle and green mussel are source of protein that vulnerable to contamination by mercury (Hg through bioaccumulation process. The research of Hg2+ bioaccumulation ability by bloodcockle (Anadara granosa and green mussel (Perna viridis using the radiotracer 203Hg2+ was conducted based on laboratory experiments design. Biokinetic parameters, such as the uptake and depuration rate and Concentration Factor, were determined to obtain predictions of Bioconcentration Factor (BCF and steady state conditions. The results of experiment using non-linear model showed that blood cockle and green mussel have the capability to accumulate Hg2+ by 15429.38 and 6963.68 times higher than its concentration in seawater after 51 days. Based on the BCF value obtained from the experiments, the predicted concentration of mercury in Anadara granosa and Perna viridis from Jakarta Bay was 1.327 and 0.599 mg.Kg-1 respectively. The predicted concentration of Hg2+ in Anadara granosa exceeds those required by ISO 7387:2009. On the other hand, the predicted in Perna viridis still meet the requirements of ISO 7387 2009. Keywords: Bioaccumulation, mercury, Perna viridis, Anadara granosa   ABSTRAK Kerang darah dan kerang hijau merupakan salah satu sumber protein yang rentan terkontaminasi merkuri (Hg melalui proses bioakumulasi. Penelitian kemampuan bioakumulasi Hg2+ oleh kerang darah (Anadara granosa dan kerang hijau (Perna viridis menggunakan radiotracer 203Hg2+ dilakukan dengan desain eksperimen di laboratorium. Parameter biokinetika seperti kecepatan pengambilan, kecepatan pelepasan dan Faktor Konsentrasi ditetapkan untuk memprediksi Faktor Biokonsentrasi dan kondisi steady state proses bioakumulasi. Hasil percobaan yang dimodelkan dalam persamaan non linier menunjukkan bahwa Anadara granosa maupun Perna viridis mampu mengakumulasi Hg2+ masing-masing 15429,38 dan 6963,68 kali dari konsentrasinya di dalam air laut setelah 51 hari. Berdasarkan nilai BCF masing

  18. [Ultrastructure of primordial germ cells of Lacerta muralis and Lacerta viridis. Comparison with Lacerta vivipara (author's transl)].

    Science.gov (United States)

    Hubert, J

    1974-01-01

    The ultrastructure of primordial germ cells migrating through the embryo and situated in genital crests is described in Lacerta viridis and Lacerta muralis. It is compared with the germ cells of Lacerta vivipara previously studied. The cytoplasmic ultrastructure is the same in the three Lacertilians, but several nuclear differences are observed. The outline of the nucleus is regular and his shape is spheric in Lacerta vivipara, but in the two others Lacertilians the nucleus shows a very sinuous outline with deep cytoplasmic invaginations. There are fibrous nuclear bodies in the three Lacertilians but the germ cells of Lacerta muralis have in addition granular bodies. The nucleolus in Lacerta viridis and Lacerta muralis is very different from the annular nucleolus of the germ cells of Lacerta vivipara. It is possible to distinguish three types of nucleoli: a compact nucleolus in Lacerta viridis and Lacerta muralis, a granular cords nucleolus in Lacerta viridis, a vacuolar nucleolus in Lacerta muralis. Each type can be seen during the migration of the gonocytes or during the colonisation of the genital region. Probably there is a relationship between these different architectures and the activity of nucleolus in synthesis and liberation of ribosomal RNA. However the nuclear fibrillar area which we have previosly called "masse para nucléolaire" in Lacerta vivipara, is present in the germ cells of Lacerta viridis and Lacerta muralis.

  19. Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

    Directory of Open Access Journals (Sweden)

    Hye-Ji Choi

    Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

  20. P-glycoprotein expression in Perna viridis after exposure to Prorocentrum lima, a dinoflagellate producing DSP toxins.

    Science.gov (United States)

    Huang, Lu; Wang, Jie; Chen, Wen-Chang; Li, Hong-Ye; Liu, Jie-Sheng; Tao Jiang; Yang, Wei-Dong

    2014-08-01

    Bivalves naturally exposed to toxic algae have mechanisms to prevent from harmful effects of diarrhetic shellfish poisoning (DSP) toxins. However, quite few studies have examined the mechanisms associated, and the information currently available is still insufficient. Multixenobiotic resistance (MXR) is ubiquitous in aquatic invertebrates and plays an important role in defense against xenobiotics. Here, to explore the roles of P-glycoprotein (P-gp) in the DSP toxins resistance in shellfish, complete cDNA of P-gp gene in the mussel Perna viridis was cloned and analyzed. The accumulation of okadaic acid (OA), a main component of DSP toxins, MXR activity and expression of P-gp in gills of P. viridis were detected after exposure to Prorocentrum lima, a dinoflagellate producing DSP toxins in the presence or absence of P-gp inhibitors PGP-4008, verapamil (VER) and cyclosporin A (CsA). The mussel P. viridis P-gp closely matches MDR/P-gp/ABCB protein from various organisms, having a typical sequence organization as full transporters from the ABCB family. After exposure to P. lima, OA accumulation, MXR activity and P-gp expression significantly increased in gills of P. viridis. The addition of P-gp-specific inhibitors PGP-4008 and VER decreased MXR activity induced by P. lima, but had no effect on the OA accumulation in gills of P. viridis. However, CsA, a broad-spectrum inhibitor of ABC transporter not only decreased MXR activity, but also increased OA accumulation in gills of P. viridis. Together with the ubiquitous presence of other ABC transporters such as MRP/ABCC in bivalves and potential compensatory mechanism in P-gp and MRP-mediated resistance, we speculated that besides P-gp, other ABC transporters, especially MRP might be involved in the resistance mechanisms to DSP toxins. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. The relationship of heavy metals and condition indices of green-lipped mussel perna viridis from contaminated and uncontaminated environments

    International Nuclear Information System (INIS)

    Ahmad Ismail; Yap Chee Kong

    1999-01-01

    Heavy metal concentrations and condition indices of green-fipped mussel Perna viridis were detemiined at two different sites of Peninsular Malaysia. Significant negative correlations (p< 0.001) between condition indices and heavy metals were observed. Samples from Kuala Perlis which relatively showed high heavy metals concentrations in mussels exhibited lower condition index while Kg. Tg. Batu with lower heavy metal levels, showed higher condition index. The environmental stress is believed to be responsible for the different physiological index in green-fipped mussel P. viridis. (author)

  2. Nidovirus-Associated Proliferative Pneumonia in the Green Tree Python (Morelia viridis).

    Science.gov (United States)

    Dervas, Eva; Hepojoki, Jussi; Laimbacher, Andrea; Romero-Palomo, Fernando; Jelinek, Christine; Keller, Saskia; Smura, Teemu; Hepojoki, Satu; Kipar, Anja; Hetzel, Udo

    2017-08-09

    In 2014 we observed a noticeable increase in sudden deaths of green tree pythons ( Morelia viridis ). Pathological examination revealed accumulation of mucoid material within airways and lung, associated with enlargement of the entire lung. We performed full necropsy and histological examination on 12 affected green tree pythons from 7 different breeders to characterise the pathogenesis of this "mucinous" pneumonia. By histology we could show a marked hyperplasia of the airway epithelium and of faveolar type II pneumocytes. Since routine microbiological tests failed to identify a causative agent, we studied lung samples of a few diseased snakes by next-generation sequencing (NGS). From the NGS data we could assemble a piece of RNA genome <85% identical to nidoviruses previously identified in ball pythons and Indian pythons. We then employed RT-PCR to demonstrate the presence of the novel nidovirus in all diseased snakes. To attempt virus isolation, we established primary cell cultures of Morelia viridis liver and brain, which we inoculated with lung homogenates of infected individuals. Ultrastructural examination of concentrated cell culture supernatants showed the presence of nidovirus particles, and subsequent NGS analysis yielded the full genome of the novel virus, Morelia viridis nidovirus (MVNV). We then generated an antibody against MVNV nucleoprotein, which we used alongside RNA in situ hybridisation to demonstrate viral antigen and RNA in the affected lungs. This suggests that in natural infection MVNV damages the respiratory tract epithelium which then results in epithelial hyperplasia, most likely as an exaggerated regenerative attempt in association with increased epithelial turnover. Importance Fairly recently novel nidoviruses associated with severe respiratory disease were identified in ball pythons and Indian pythons. Herein we report isolation and identification of a further nidovirus from green tree pythons ( Morelia viridis ) with fatal pneumonia

  3. Peucetia viridis (Blackwall, 1858), caracteres y discusión (Aranae, Oxyopidae)

    OpenAIRE

    Barrientos Alfageme, José Antonio

    1991-01-01

    New records of the type-species of the genus Peucetia from the south of the Iberian Peninsula, near the Mediterranean Sea, confirm its presence in Europe. P. viridis has been recently the subject of taxonomical confussion. In this paper a more complete description of the species is proposed, illustraded with drawings of its general aspect and genital organs. Algunas citas nuevas de la banda mediterránea, en el sur de la Península Ibérica, confirman la presencia en Europa de la especie-tipo...

  4. Karyological and flow cytometric evidence of triploid specimens in Bufo viridis (Amphibia Anura

    Directory of Open Access Journals (Sweden)

    D Cavallo

    2010-01-01

    Full Text Available Karyological and flow cytometric (FCM analyses were performed on a group of 14 green toads of the Bufo viridis species from seven Eurasian populations. Both approaches gave concordant results concerning the DNA ploidy level. All the populations examined were represented exclusively by diploid or tetraploid specimens, except one, where triploids were found. Results evidenced an interpopulation variability in DNA content against the same ploidy level, as well as an unusually high number of triploids in a particular reproductive place. The origin of polyploidy and the presence and persistence of a high number of triploids in a particular population are discussed.

  5. Propagação Assexuada de Chacrona (Psychotria viridis Ruiz & Pavon) Via Estaquia Foliar

    OpenAIRE

    Salgado, Moisés Pereira Galvão; Universidade de Taubaté - UNITAU; Furlan, Marcos Roberto; Universidade de Taubaté; Aoyama, Elisa Mitsuko; Universidade Federal do Espírito Santo - UFES; Rodrigues, Eliana; Universidade Federal de São Paulo; Cruz, Lilian Pereira; Universidade Estadual de Campinas - UNICAMP

    2011-01-01

    This study aimed to assess the asexual propagation of Psychotria viridis by leaf cuttings. The treatments were: A - Whole leaf cuttings, B - leaf cuttings with the top third cut off; C - with the lower third of the cuttings removed; D - with cuts on the primary vein of leaf cuttings, and E - poles with cuts on the leaf ’s secondary veins. The cuttings were immersed in distilled water for a period of 70 days. In all the treatments, the rooting was observed to occur in the region of the cut, or...

  6. High speed translocation of /sup 86/Rb in the phloem of Tradescantia viridis

    Energy Technology Data Exchange (ETDEWEB)

    Penot, M.

    1976-01-01

    An autoradiographic study of the rooted shoots of Tradescantia viridis showed a high speed translocation of /sup 86/Rb applied to a leaf for short periods of time (5 to 2.5 min). The speed of this translocation (between 840 and 1.440 cm h/sup -1/) speaks for the existence of a very rapid phloem component translocating ions to an active sink, represented here by the growing roots. Pretreatment with cycloheximide (48 h, 50 mg 1/sup -1/) decreases the quantity of this long distance transport but not the velocity.

  7. Response of the regenerating telencephalon of Lacerta viridis to nerve growth factor.

    Science.gov (United States)

    Del Grande, P; Minelli, G

    1980-01-01

    To identify the nature of the dividing cells during the regenerative process of the telencephalon, the authors administered nerve growth factor (NGF) to Lacerta viridis with a wedge of telencephalon removed. Some known centers of cell proliferation were unresponsive to the treatment, whereas the ventral end of the telencephalic ventricle underwent an increase of up to 200% in proliferation rate. On the basis of this observation and data in the literature, the authors propose that the cell proliferation beginning in the medial area during the regeneration of the telencephalic ventricle is due to catecholaminergic neuroblasts still present in the adult.

  8. Heterodimers of NF-kappaB transcription factors DIF and Relish regulate antimicrobial peptide genes in Drosophila.

    Science.gov (United States)

    Tanji, Takahiro; Yun, Eun-Young; Ip, Y Tony

    2010-08-17

    The innate immune response in Drosophila involves the inducible expression of antimicrobial peptide genes mediated by the Toll and IMD signaling pathways. Dorsal and DIF act downstream of Toll, whereas Relish acts downstream of IMD to regulate target gene expression. Dorsal, DIF, and Relish are NF-kappaB-related transcription factors and function as obligate dimers, but it is not clear how the various dimer combinations contribute to the innate immune response. We systematically examined the dimerization tendency of these proteins through the use of transgenic assays. The results show that all combinations of homo- and heterodimers are formed, but with varying degrees of efficiency. The formation of the DIF-Relish heterodimer is particularly interesting because it may mediate signaling for the seemingly independent Toll and IMD pathways. By incorporating a flexible peptide linker, we specifically tested the functions of the DIF;Relish (a ; sign represents the peptide linker) linked heterodimer. Our results demonstrate that the linked heterodimer can activate target genes of both the Toll and IMD pathways. The DIF and Relish complex is detectable in whole animal extracts, suggesting that this heterodimer may function in vivo to increase the spectrum and level of antimicrobial peptide production in response to different infections.

  9. Characterization of the UV-crosslinked heterodimer of histones H2B and H4

    International Nuclear Information System (INIS)

    Johnson, E.R.; Brown, D.M.; DeLange, R.J.

    1986-01-01

    At relatively high salt concentrations (1.2 M), histone 2B (H2B) and histone 4 (H4) can be covalently crosslinked by irradiation with ultraviolet light to yield a mixture of the three possible dimers: H2B-H2B, H4-H4, and H2B-H4. The formation of the H2B-H4 heterodimer was found to be favored at lower histone concentrations (> 90% H2B-H4 at 0.1 mg/ml total histone protein). CNBr cleavage of the H2B-H4 dimer produced three fragments which were separated by reverse phase HPLC. These fragments were identified by amino acid compositional analysis to be H4(85-102), H2B(62-125), and the crosslinked N-terminal regions H2B(1-59)-H4(1-84). Amino acid sequence analysis of the crosslinked fragment indicated that tyrosine-40 of H2B is likely involved in the covalent crosslinkage which joins the histone monomers to form the heterodimer

  10. Differences in solution dynamics between lens β-crystallin homodimers and heterodimers probed by hydrogen-deuterium exchange and deamidation.

    Science.gov (United States)

    Lampi, Kirsten J; Murray, Matthew R; Peterson, Matthew P; Eng, Bryce S; Yue, Eileen; Clark, Alice R; Barbar, Elisar; David, Larry L

    2016-01-01

    Lens transparency is due to the ordered arrangement of the major structural proteins, called crystallins. βB2 crystallin in the lens of the eye readily forms dimers with other β-crystallin subunits, but the resulting heterodimer structures are not known and were investigated in this study. Structures of βA3 and βB2 crystallin homodimers and the βA3/βB2 crystallin heterodimers were probed by measuring changes in solvent accessibility using hydrogen-deuterium exchange with mass spectrometry. We further mimicked deamidation in βB2 and probed the effect on the βA3/βB2 heterodimer. Results were confirmed with chemical crosslinking and NMR. Both βA3 and βB2 had significantly decreased deuterium levels in the heterodimer compared to their respective homodimers, suggesting that they had less solvent accessibility and were more compact in the heterodimer. The compact structure of βB2 was supported by the identification of chemical crosslinks between lysines in βB2 within the heterodimer that were inconsistent with βB2's extended homodimeric structure. The compact structure of βA3 was supported by an overall decrease in mobility of βA3 in the heterodimer detected by NMR. In βB2, peptides 70-84 and 121-134 were exposed in the homodimer, but buried in the heterodimer with ≥50% decreases in deuterium levels. Homologous peptides in βA3, 97-109 and 134-149, had 25-50% decreases in deuterium levels in the heterodimer. These peptides are probable sites of interaction between βB2 and βA3 and are located at the predicted interface between subunits with bent linkers. Deamidation at Q184 in βB2 at this predicted interface led to a less compact βB2 in the heterodimer. The more compact structure of the βA3/βB2 heterodimer was also more heat stable than either of the homodimers. The major structural proteins in the lens, the β-crystallins, are not static, but dynamic in solution, with differences in accessibility between the homo-and hetero-dimers. This

  11. Spontaneous formation of wurzite-CdS/zinc blende-CdTe heterodimers through a partial anion exchange reaction.

    Science.gov (United States)

    Saruyama, Masaki; So, Yeong-Gi; Kimoto, Koji; Taguchi, Seiji; Kanemitsu, Yoshihiko; Teranishi, Toshiharu

    2011-11-09

    Ion exchange of ionic semiconductor nanoparticles (NPs) is a facile method for the synthesis of type-II semiconductor heterostructured NPs with staggered alignment of band edges for photoelectric applications. Through consideration of the crystallographic orientation and strain at the heterointerface, well-designed heterostructures can be constructed through ion exchange reactions. Here we report the selective synthesis of anisotropically phase-segregated cadmium sulfide (CdS)/ cadmium telluride (CdTe) heterodimers via a novel anion exchange reaction of CdS NPs with an organic telluride precursor. The wurtzite-CdS/zinc blende-CdTe heterodimers in this study resulted from spontaneous phase segregation induced by the differences in the crystal structures of the two phases, accompanying a centrosymmetry breaking of the spherical CdS NPs. The CdS/CdTe heterodimers exhibited photoinduced spatial charge separation because of their staggered band-edge alignment.

  12. Anti-HMG-CoA Reductase, Antioxidant, and Anti-Inflammatory Activities of Amaranthus viridis Leaf Extract as a Potential Treatment for Hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Shamala Salvamani

    2016-01-01

    Full Text Available Inflammation and oxidative stress are believed to contribute to the pathology of several chronic diseases including hypercholesterolemia (elevated levels of cholesterol in blood and atherosclerosis. HMG-CoA reductase inhibitors of plant origin are needed as synthetic drugs, such as statins, which are known to cause adverse effects on the liver and muscles. Amaranthus viridis (A. viridis has been used from ancient times for its supposedly medically beneficial properties. In the current study, different parts of A. viridis (leaf, stem, and seed were evaluated for potential anti-HMG-CoA reductase, antioxidant, and anti-inflammatory activities. The putative HMG-CoA reductase inhibitory activity of A. viridis extracts at different concentrations was determined spectrophotometrically by NADPH oxidation, using HMG-CoA as substrate. A. viridis leaf extract revealed the highest HMG-CoA reductase inhibitory effect at about 71%, with noncompetitive inhibition in Lineweaver-Burk plot analysis. The leaf extract showed good inhibition of hydroperoxides, 2,2-diphenyl-1-picrylhydrazyl (DPPH, nitric oxide (NO, and ferric ion radicals in various concentrations. A. viridis leaf extract was proven to be an effective inhibitor of hyaluronidase, lipoxygenase, and xanthine oxidase enzymes. The experimental data suggest that A. viridis leaf extract is a source of potent antioxidant and anti-inflammatory agent and may modulate cholesterol metabolism by inhibition of HMG-CoA reductase.

  13. Review of the genus Qinshuiacris (Orthoptera: Acrididae) from China with proposal of Caryanda viridis-species group and description of a new species.

    Science.gov (United States)

    Mao, Ben-Yong; Niu, Yao; Zheng, Zhe-Min; Scott, Matthew B

    2015-07-07

    Based on an examination of type and additional material, Qinshuiacris viridis Zheng & Mao, 1996 and some allied species in the genus Caryanda are reviewed. Q. viridis Zheng & Mao, 1996 is transferred to Caryanda as a new combination: C. viridis (Zheng & Mao, 1996) comb. nov.. The female of C. viridis is described for the first time and sixty-two topotypes are designated. The genus Qinshuiacris Zheng & Mao, 1996 is synonymized with Caryanda Stål, 1878 because of the transfer of the type species. C. yini Mao & Ren, 2006 is proposed as a new junior synonym of C. dehongensis Mao, Xu & Yang, 2003. A new species, C. eshana Mao sp. nov., is also described and illustrated. Additionally, the conception of the Caryanda viridis-species group is proposed to contain the four allied species with falciform cerci: C. albomaculata Mao, Ren & Ou, 2007, C. dehongensis Mao, Xu & Yang, 2003, C. eshana Mao sp. nov., and C. viridis (Zheng & Mao, 1996) comb. nov.. A key to the species of C. viridis-species group is provided. Type specimens are deposited in the Biological Science Museum, Dali University (BMDU), Yunnan Province, China, in the Institute of Zoology, Shaanxi Normal University (IZSNU), Shaanxi Province, China and in the Institute of Zoology, Chinese Academy of Sciences, Beijing, China (IZCAS).

  14. In vitro visualization and characterization of wild type and mutant IDH homo- and heterodimers using Bimolecular Fluorescence Complementation.

    Science.gov (United States)

    Robinson, Gemma L; Philip, Beatrice; Guthrie, Matthew R; Cox, James E; Robinson, James P; VanBrocklin, Matthew W; Holmen, Sheri L

    2016-05-01

    Mutations in the metabolic enzyme isocitrate dehydrogenase (IDH) were recently found in ~80% of WHO grade II-III gliomas and secondary glioblastomas. These mutations reduce the enzyme's ability to convert isocitrate to α-ketoglutarate and, instead, confer a novel gain-of-function resulting in the conversion of α-ketoglutarate to 2-hydroxglutarate (2-HG). However, IDH mutations exist in a heterozygous state such that a functional wild type allele is retained. Recent data suggest that the ability of mutant IDH1, but not mutant IDH2, to produce 2-HG is dependent on the activity of the retained wild type allele. In this study, we aimed to further our understanding of the interaction and function of wild type and mutant IDH heterodimers utilizing Bimolecular Fluorescence Complementation (BiFC). Dimerization of wild type and mutant IDH monomers conjugated to the N- and C-terminus of Venus protein, respectively, is directly proportional to the amount of fluorescence emitted and can be used as an approach to visualize and assess IDH dimerization. Thus, we utilized this method to visualize IDH homo- and heterodimers and to examine their cellular physiology based on subcellular localization, NADPH production, and 2-HG levels. Our results demonstrate that wild type and mutant IDH1 or IDH2 heterodimers display similar physiological characteristics to that of mutant IDH1 or IDH2 homodimers with the exception of their ability to generate NADPH. IDH1 heterodimers consistently generate NADPH whereas IDH2 heterodimers do not. However, the presence of mutant IDH1 or IDH2 in homo- or heterodimer configurations consistently generates equivalent levels of 2-HG. Our data suggest that the wild type protein is not required for the generation of 2-HG.

  15. Comparative venomics of the Prairie Rattlesnake (Crotalus viridis viridis) from Colorado: Identification of a novel pattern of ontogenetic changes in venom composition and assessment of the immunoreactivity of the commercial antivenom CroFab®.

    Science.gov (United States)

    Saviola, Anthony J; Pla, Davinia; Sanz, Libia; Castoe, Todd A; Calvete, Juan J; Mackessy, Stephen P

    2015-05-21

    Here we describe and compare the venomic and antivenomic characteristics of both neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) venoms. Although both neonate and adult venoms contain unique components, similarities among protein family content were seen. Both neonate and adult venoms consisted of myotoxin, bradykinin-potentiating peptide (BPP), phospholipase A2 (PLA2), Zn(2+)-dependent metalloproteinase (SVMP), serine proteinase, L-amino acid oxidase (LAAO), cysteine-rich secretory protein (CRISP) and disintegrin families. Quantitative differences, however, were observed, with venoms of adults containing significantly higher concentrations of the non-enzymatic toxic compounds and venoms of neonates containing higher concentrations of pre-digestive enzymatic proteins such as SVMPs. To assess the relevance of this venom variation in the context of snakebite and snakebite treatment, we tested the efficacy of the common antivenom CroFab® for recognition of both adult and neonate venoms in vitro. This comparison revealed that many of the major protein families (SVMPs, CRISP, PLA2, serine proteases, and LAAO) in both neonate and adult venoms were immunodepleted by the antivenom, whereas myotoxins, one of the major toxic components of C. v. viridis venom, in addition to many of the small peptides, were not efficiently depleted by CroFab®. These results therefore provide a comprehensive catalog of the venom compounds present in C. v. viridis venom and new molecular insight into the potential efficacy of CroFab® against human envenomations by one of the most widely distributed rattlesnake species in North America. Comparative proteomic analysis of venoms of neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) from a discrete population in Colorado revealed a novel pattern of ontogenetic shifts in toxin composition for viperid snakes. The observed stage-dependent decrease of the relative content of disintegrins, catalytically active D49-PLA2s

  16. Brassinosteroids Modulate Meristem Fate and Differentiation of Unique Inflorescence Morphology in Setaria viridis[OPEN

    Science.gov (United States)

    Thames, Shuiyi; Jiang, Hui

    2018-01-01

    Inflorescence architecture is a key determinant of yield potential in many crops and is patterned by the organization and developmental fate of axillary meristems. In cereals, flowers and grain are borne from spikelets, which differentiate in the final iteration of axillary meristem branching. In Setaria spp, inflorescence branches terminate in either a spikelet or a sterile bristle, and these structures appear to be paired. In this work, we leverage Setaria viridis to investigate a role for the phytohormones brassinosteroids (BRs) in specifying bristle identity and maintaining spikelet meristem determinacy. We report the molecular identification and characterization of the Bristleless1 (Bsl1) locus in S. viridis, which encodes a rate-limiting enzyme in BR biosynthesis. Loss-of-function bsl1 mutants fail to initiate a bristle identity program, resulting in homeotic conversion of bristles to spikelets. In addition, spikelet meristem determinacy is altered in the mutants, which produce two florets per spikelet instead of one. Both of these phenotypes provide avenues for enhanced grain production in cereal crops. Our results indicate that the spatiotemporal restriction of BR biosynthesis at boundary domains influences meristem fate decisions during inflorescence development. The bsl1 mutants provide insight into the molecular basis underlying morphological variation in inflorescence architecture. PMID:29263085

  17. Acquired phototrophy through retention of functional chloroplasts increases growth efficiency of the sea slug Elysia viridis.

    Directory of Open Access Journals (Sweden)

    Finn A Baumgartner

    Full Text Available Photosynthesis is a fundamental process sustaining heterotrophic organisms at all trophic levels. Some mixotrophs can retain functional chloroplasts from food (kleptoplasty, and it is hypothesized that carbon acquired through kleptoplasty may enhance trophic energy transfer through increased host growth efficiency. Sacoglossan sea slugs are the only known metazoans capable of kleptoplasty, but the relative fitness contributions of heterotrophy through grazing, and phototrophy via kleptoplasts, are not well understood. Fitness benefits (i.e. increased survival or growth of kleptoplasty in sacoglossans are commonly studied in ecologically unrealistic conditions under extended periods of complete darkness and/or starvation. We compared the growth efficiency of the sacoglossan Elysia viridis with access to algal diets providing kleptoplasts of differing functionality under ecologically relevant light conditions. Individuals fed Codium fragile, which provide highly functional kleptoplasts, nearly doubled their growth efficiency under high compared to low light. In contrast, individuals fed Cladophora rupestris, which provided kleptoplasts of limited functionality, showed no difference in growth efficiency between light treatments. Slugs feeding on Codium, but not on Cladophora, showed higher relative electron transport rates (rETR in high compared to low light. Furthermore, there were no differences in the consumption rates of the slugs between different light treatments, and only small differences in nutritional traits of algal diets, indicating that the increased growth efficiency of E. viridis feeding on Codium was due to retention of functional kleptoplasts. Our results show that functional kleptoplasts from Codium can provide sacoglossan sea slugs with fitness advantages through photosynthesis.

  18. A taxonomic review of the Dark-winged Trumpeter Psophia viridis (Aves: Gruiformes: Psophiidae

    Directory of Open Access Journals (Sweden)

    Marina Oppenheimer

    2009-01-01

    Full Text Available The Dark-winged Trumpeter, Psophia viridis (Gruiformes, Psophiidae is a Brazilian endemic species and includes three subspecies: Psophia viridis viridis Spix, 1825; Psophia v. dextralis Conover, 1934, and Psophia v. obscura Pelzeln, 1857, as well as P. v. interjecta Griscom & Greenway, 1937, whose validity has been questioned by several authors. These taxa are allopatric in distribution along the south of the Amazon River, although the precise limits of their distribution still remain unknown. This complex has never been taxonomically reviewed and this work aims to test the validity of its taxa based on the Phylogenetic Species Concept. Morphometrical characters and plumage colour patterns were analyzed, and the distribution of the taxa was also revised. In this study, 108 specimens from 41 localities were examined (all types included, with each reliable literature-based locality being included in order to delimit the geographical distribution of the complex. Morphometrical data did not point out significant differences between the taxa, also showing no sexual dimorphism among them. Meanwhile, plumage characters showed consistent and distinct patterns for each of the taxa, except for P. v. interjecta, whose features indicated by authors as diagnosable are the result of individual variation. No clinal variation or intergradation were observed, even at regions close to the rivers headwaters, where supposedly populations could be in contact. It is suggested that the currently accepted subspecies be elevated to the species level, such as: Psophia viridis Spix, 1825, distributed in the Madeira-Tapajós interfluvium, P. dextralis, found in the Tapajós-Tocantins interfluvium, and P. obscura, which occurs from the right bank of the Tocantins River to the west of the State of Maranhão.Os jacamins-de-costas-verdes, Psophia viridis (Gruiformes, Psophiidae são endêmicos da Amazônia brasileira e contam, atualmente, com três subespécies reconhecidas

  19. First documentation and molecular confirmation of three trematode species (Platyhelminthes: Trematoda) infecting the polychaete Marenzelleria viridis (Annelida: Spionidae).

    Science.gov (United States)

    Phelan, Krystin; Blakeslee, April M H; Krause, Maureen; Williams, Jason D

    2016-01-01

    Polychaete worms are hosts to a wide range of marine parasites; yet, studies on trematodes using these ecologically important species as intermediate hosts are lacking. During examination of the spionid polychaete Marenzelleria viridis collected on the north shore of Long Island, New York, putative trematode cysts were discovered in the body cavity of these polychaetes. In order to verify these cysts as metacercariae of trematodes, specimens of the eastern mudsnail Ilyanassa obsoleta (a very common first intermediate host of trematodes in the region) were collected for molecular comparison. DNA barcoding using cytochrome C oxidase I regions confirmed the presence of three species of trematodes (Himasthla quissetensis, Lepocreadium setiferoides, and Zoogonus lasius) in both M. viridis and I. obsoleta hosts. Brown bodies were also recovered from polychaetes, and molecular testing confirmed the presence of L. setiferoides and Z. lasius, indicating an immune response of the polychaete leading to encapsulation of the cysts. From the 125 specimens of M. viridis collected in 2014, 95 (76.8 %) were infected with trematodes; of these 95 infected polychaetes, 86 (90.5 %) contained brown bodies. This is the first confirmation that trematodes use M. viridis as a second intermediate host and that this intermediate host demonstrates a clear immune response to metacercarial infection. Future research should explore the role of these polychaetes in trematode life cycles, the effectiveness of the immune response, and transmission pathways to vertebrate definitive hosts.

  20. Cultivation of green mussel, Perna viridis L., on a floating raft in an estuary along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Ansari, Z.A.; Parulekar, A.H.

    Total production of green mussels, Perna viridis, grown on a raft (16 m sup(2)) for 1 year was 2144.64 kg and biomass (meat weight) was 1040.00 kg. Annual production (P) and biomass (B) estimated were 33.51 and 16.25 kg m sup(-1) respectively...

  1. Modulation of antioxidant and biotransformation enzymes in the gills of Perna viridis (L.) exposed to water accomodate fraction of diesel

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Verlecar, X.N.; Chainy, G.B.N.

    Investigations on the effect of oils on the oxidative stress and antioxidant molecules in gills of Perna viridis were carried out under controlled laboratory conditions. For this purpose water accommodate fraction of diesel oil at 0.5 arid 5% were...

  2. The quaternary architecture of RARβ–RXRα heterodimer facilitates domain–domain signal transmission

    Energy Technology Data Exchange (ETDEWEB)

    Chandra, Vikas; Wu, Dalei; Li, Sheng; Potluri, Nalini; Kim, Youngchang; Rastinejad, Fraydoon

    2017-10-11

    Assessing the physical connections and allosteric communications in multi-domain nuclear receptor (NR) polypeptides has remained challenging, with few crystal structures available to show their overall structural organizations. Here we report the quaternary architecture of multi-domain retinoic acid receptor beta-retinoic X receptor alpha (RAR beta-RXR alpha) heterodimer bound to DNA, ligands and coactivator peptides, examined through crystallographic, hydrogen-deuterium exchange mass spectrometry, mutagenesis and functional studies. The RAR beta ligand-binding domain (LBD) and DNA-binding domain (DBD) are physically connected to foster allosteric signal transmission between them. Direct comparisons among all the multi-domain NRs studied crystallographically to date show significant variations within their quaternary architectures, rather than a common architecture adhering to strict rules. RXR remains flexible and adaptive by maintaining loosely organized domains, while its hetero-dimerization partners use a surface patch on their LBDs to form domain-domain interactions with DBDs.

  3. Heterodimer Binding Scaffolds Recognition via the Analysis of Kinetically Hot Residues.

    Science.gov (United States)

    Perišić, Ognjen

    2018-03-16

    Physical interactions between proteins are often difficult to decipher. The aim of this paper is to present an algorithm that is designed to recognize binding patches and supporting structural scaffolds of interacting heterodimer proteins using the Gaussian Network Model (GNM). The recognition is based on the (self) adjustable identification of kinetically hot residues and their connection to possible binding scaffolds. The kinetically hot residues are residues with the lowest entropy, i.e., the highest contribution to the weighted sum of the fastest modes per chain extracted via GNM. The algorithm adjusts the number of fast modes in the GNM's weighted sum calculation using the ratio of predicted and expected numbers of target residues (contact and the neighboring first-layer residues). This approach produces very good results when applied to dimers with high protein sequence length ratios. The protocol's ability to recognize near native decoys was compared to the ability of the residue-level statistical potential of Lu and Skolnick using the Sternberg and Vakser decoy dimers sets. The statistical potential produced better overall results, but in a number of cases its predicting ability was comparable, or even inferior, to the prediction ability of the adjustable GNM approach. The results presented in this paper suggest that in heterodimers at least one protein has interacting scaffold determined by the immovable, kinetically hot residues. In many cases, interacting proteins (especially if being of noticeably different sizes) either behave as a rigid lock and key or, presumably, exhibit the opposite dynamic behavior. While the binding surface of one protein is rigid and stable, its partner's interacting scaffold is more flexible and adaptable.

  4. TLR1/TLR2 heterodimers play an important role in the recognition of Borrelia spirochetes.

    Directory of Open Access Journals (Sweden)

    Marije Oosting

    Full Text Available After infection with Borrelia species, the risk for developing Lyme disease varies significantly between individuals. Recognition of Borrelia by the immune system is mediated by pattern recognition receptors (PRRs, such as TLRs. While TLR2 is the main recognition receptor for Borrelia spp., little is known about the role of TLR1 and TLR6, which both can form functionally active heterodimers with TLR2. Here we investigated the recognition of Borrelia by both murine and human TLR1 and TLR6. Peritoneal macrophages from TLR1- and TLR6- gene deficient mice were isolated and exposed to Borrelia. Human PBMCs were stimulated with Borrelia with or without specific TLR1 and TLR6 blocking using specific antibodies. Finally, the functional consequences of TLR polymorphisms on Borrelia-induced cytokine production were assessed. Splenocytes isolated from both TLR1-/- and TLR6-/- mice displayed a distorted Th1/Th2 cytokine balance after stimulation with B.burgdorferi, while no differences in pro-inflammatory cytokine production were observed. In contrast, blockade of TLR1 with specific neutralizing antibodies led to decreased cytokine production by human PBMCs after exposure to B.burgdorferi. Blockade of human TLR6 did not lead to suppression of cytokine production. When PBMCs from healthy individuals bearing polymorphisms in TLR1 were exposed to B.burgdorferi, a remarkably decreased in vitro cytokine production was observed in comparison to wild-type controls. TLR6 polymorphisms lead to a minor modified cytokine production. This study indicates a dominant role for TLR1/TLR2 heterodimers in the induction of the early inflammatory response by Borrelia spirochetes in humans.

  5. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent.

    Science.gov (United States)

    Horwitz, Rael; Borell, Esther M; Fine, Maoz; Shaked, Yeala

    2014-01-01

    Ocean acidification (OA) is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy) also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments-the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone's tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data suggests that A. viridis

  6. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent

    Directory of Open Access Journals (Sweden)

    Rael Horwitz

    2014-09-01

    Full Text Available Ocean acidification (OA is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments—the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone’s tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data

  7. A heterodimer of human 3'-phospho-adenosine-5'-phosphosulphate (PAPS) synthases is a new sulphate activating complex

    International Nuclear Information System (INIS)

    Grum, Daniel; Boom, Johannes van den; Neumann, Daniel; Matena, Anja; Link, Nina M.; Mueller, Jonathan W.

    2010-01-01

    3'-Phospho-adenosine-5'-phosphosulphate (PAPS) synthases are fundamental to mammalian sulphate metabolism. These enzymes have recently been linked to a rising number of human diseases. Despite many studies, it is not yet understood how the mammalian PAPS synthases 1 and 2 interact with each other. We provide first evidence for heterodimerisation of these two enzymes by pull-down assays and Foerster resonance energy transfer (FRET) measurements. Kinetics of dimer dissociation/association indicates that these heterodimers form as soon as PAPSS1 and -S2 encounter each other in solution. Affinity of the homo- and heterodimers were found to be in the low nanomolar range using anisotropy measurements employing proteins labelled with the fluorescent dye IAEDANS that - in spite of its low quantum yield - is well suited for anisotropy due to its large Stokes shift. Within its kinase domain, the PAPS synthase heterodimer displays similar substrate inhibition by adenosine-5'-phosphosulphate (APS) as the homodimers. Due to divergent catalytic efficacies of PAPSS1 and -S2, the heterodimer might be a way of regulating PAPS synthase function within mammalian cells.

  8. Microsporidia in a woodland pool I. Lanatospora costata sp. n. (Opisthosporidia, Microsporidia), parasite of Megacyclops viridis (Crustacea, Copepoda): fine structure and molecular phylogeny

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Hyliš, M.; Fiala, Ivan; Refardt, D.; Larsson, J.I.R.

    2016-01-01

    Roč. 55, č. 4 (2016), s. 269-280 ISSN 0065-1583 Institutional support: RVO:60077344 Keywords : microsporidian parasite * Megacyclops viridis * SSU rRNA Subject RIV: EE - Microbiology, Virology Impact factor: 1.481, year: 2016

  9. Chloride transport in toad skin (Bufo viridis). The effect of salt adaptation

    DEFF Research Database (Denmark)

    Katz, U; Larsen, Erik Hviid

    1984-01-01

    The steady-state Cl- current across the skin of Bufo viridis adapted to tap water was found to be rectified. In skins bathed with NaCl Ringer on both sides, a large outward current, carried by influx of Cl-, was observed at a clamping voltage (V) of less than -50 mV (outside of the skin negative......, and apparent leakage conductance was reduced. Application of the phosphodiesterase inhibitor 3-isobutyl-1-methyl-xanthine to skin of fully salt-adapted toads increased the transepithelial Cl- conductance, and the time courses of voltage clamp currents became more like those of water-adapted toads. Apparent...... leakage conductance was increased.(ABSTRACT TRUNCATED AT 400 WORDS)...

  10. Pemanfaatan Limbah Cangkang Kerang Hijau (Perna Viridis Menjadi Kitin Sebagai Biokoagulan Air Sungai

    Directory of Open Access Journals (Sweden)

    Syamsidar HS

    2017-06-01

    Full Text Available This study aims to determine the optimum weight of chitin that used as biocoagulant of river water. The water sample is taken from Kajenjeng river and the chitin used for research are isolated from green mussels (Perna viridis shell powder through three steps such as deproteination by NaOH 3%, demineralization by HCl 1,25 N and depigmentation by NaOCl 4%. Then, the obtained chitin are contacted into water with variation of 0,25 gram; 0,5 gram; 0,75 gram and 1 gram in an hour. The result showed that optimum weight of chitin for COD determination, total hardness, calcium and turbidity is 0,75 gram, while optimum weight of chitin for magnesium determination is 0,5 gram.

  11. Lipophilic compounds from the femoral gland secretions of male Hungarian green lizards, Lacerta viridis.

    Science.gov (United States)

    Kopena, Renata; López, Pilar; Martín, José

    2009-01-01

    In spite of the importance of chemical signals (pheromones) in the reproductive behaviour of lizards, only a few studies have examined the role of specific chemical compounds as sexual signals. The secreted chemicals vary widely between species but whether this variation reflects phylogenetic or environmental differences remains unclear. Based on mass spectra, obtained by GC-MS, we found 40 lipophilic compounds in femoral gland secretions of male green lizards (Lacerta viridis), including several steroids, alpha-tocopherol, and esters of n-C16 to n-C20 carboxylic acids, and minor components such as alcohols between C12 and C20, squalene, three lactones and one ketone. We compared these chemicals with those previously found in other closely related green lizard species, and discussed how phylogenetical differences and/or environmental conditions could be responsible for the differential presence of chemicals in different lizard species.

  12. Preliminary study of the regenerative processes of the dorsal cortex of the telencephalon of Lacerta viridis.

    Science.gov (United States)

    Minelli, G; del Grande, P; Mambelli, M C

    1977-01-01

    The authors removed from Lacerta viridis specimens part of the dorsal hippocampus of one telencephalic hemisphere. The animals were sacrificed 110 and 260 days after the operation; 24 hours before the operation on the encephalon, each was dosed with 6--3H thymidine. An examination of the historadiographic slides showed a clear remedial process in the operated area which, 260 days after has renewed in thickness but was still minus its characteristic cellular layer. The area of the telencephalon affected by the remedial process was examined by the authors and they have put forward the hypothesis that in relation to the type of operation performed, said area is localized prevalently in the dorsal hippocampus of the caudal half of the telencephalic hemispherg. The authors have also shown that the remedial procress, though attenuated is still in progress. 260 days after the operation.

  13. Functional anatomy of the lungs of the green lizard, Lacerta viridis.

    Science.gov (United States)

    Meban, C

    1978-02-01

    The gas-exchange area in the lung of Lacerta viridis has been studied by light microscopy and electron microscopy. The interior of the lung in this species is partitioned into air sacs by radially disposed septa. The surfaces of each septum are covered by a continuous epithelium, the cells of which are termed 'pneumonocytes'. Deep to the epithelium there is a close-meshed plexus of capillaries. The middle layer of the septum contains smooth muscle and fibrous tissue. Two varieties of pneumonocytes can be identified. The type I cells are squamous and give off attenuated sheets of cytoplasm which spread widely over the septal surface; these sheets contain few organelles. The type II cells are more compact and possess many organelles; their osmiophilic inclusion bodies are especially conspicuous. The pulmonary capillaries of Lacerta are evaginated into the air sacs and often display marked attenuation of their endothelium. The possible functional significance of these features is discussed.

  14. An hypothesis on the influence of the temperature on the telencephalic reparative processes in Lacerta viridis.

    Science.gov (United States)

    Minelli, G; Del Grande, P

    1980-01-01

    The authors removed a simple plug from the dorsal hippocampus, or from the dorsal hippocampus and part of the medial hippocampus in a telencephalic hemisphere in specimens of Lacerta viridis. The specimens were sacrificed some time after the operation after administration of 6-3 H thymidina. The examination of the emulsified slides showed that in these experimental condition no reparative process is observed, except for an impressive proliferation of cells and fibres which, from the meninx, bridges the cortical gap and, penetrating the telencephalic ventricle, attaches itself to the surrounding nerve tissue. The authors also described a limited cellular proliferation in the ependima of the telencephalic ventricles as a result of resection of the medial hippocampus; this observation is interpreted as a phenomenum connected to compensatory hypertrophy.

  15. Development of fibre and parenchyma cells in the bamboo Phyllostachys viridi-glaucescens

    CERN Document Server

    Crow, E

    2000-01-01

    The development of the shoot apex and the ontogeny of fibre and parenchyma cells in elongating shoots of the bamboo Phyllostachys viridi-glaucescens (Carr.) Riv. and Riv., seen under the light microscope is described. Fibre cells differentiated from cells of the procambium, whilst the parenchyma cells differentiated from cells of the primary thickening meristem which surround the procambium strands. Three stages of early fibre and parenchyma cell development were identified and these are referred to in subsequent studies of cell wall development. The cytology of developing internodal fibre and parenchyma cells seen under the transmission electron microscope (TEM) is described. There were few ultrastructural features to distinguish the two cell types. Thiery's PATAg test was performed to identify organelles which may be associated with the synthesis of polysaccharides destined for the cell wall. The ultrastructural results are discussed in terms of the process of cell wall deposition. Observations were made of...

  16. Identification of Listeria monocytogenes on Green Mussels (Perna viridis and Cockle Shell (Anadara granosa

    Directory of Open Access Journals (Sweden)

    Winiati Puji Rahayu

    2016-12-01

    Full Text Available Green mussel (Perna viridis and cockle shell (Anadara granosa are one of many sources of animalprotein which is many cultivated in Indonesia because their price is relatively affordable. This study wasconducted to identify the presence of Listeria monocytogenes in 27 samples of green mussels and 3 samplesof cockle shells using real-time Polymerase Chain Reaction (real-time PCR and biochemical methods. Thetarget gene for amplification in real-time PCR was an hlyA gene because this gene was a determinant ofvirulence genes that produce listeriolysin O. Primers used in this study were forward primer DG69 (GTGCCG GGT AAA AGA CCA TA and reverse primer DG74 (CGC CAC TGA GAT ACT AT and fluorescencesignals indicator using SYBR Green I. The results of analysis using real-time PCR were negative Listeriamonocytogenes in all samples, while using biochemical methods there was one of 30 samples contaminatedby Listeria welshimeri.

  17. Active urea transport by the skin of Bufo viridis: Amiloride- and phloretin-sensitive transport sites

    Energy Technology Data Exchange (ETDEWEB)

    Rapoport, J.; Abuful, A.; Chaimovitz, C.; Noeh, Z.; Hays, R.M. (Soroka Medical Center, Beersheva (Israel) Albert Einstein College of Medicine, New York, NY (USA))

    1988-09-01

    Urea is actively transported inwardly (J{sub i}) across the skin of the green toad Bufo viridis. J{sub i} is markedly enhanced in toads adapted to hypertonic saline. The authors studied urea transport across the skin of Bufo viridis under a variety of experimental conditions, including treatment with amiloride and phloretin, agents that inhibit urea permeability in the bladder of Bufo marinus. Amiloride (10{sup {minus}4} M) significantly inhibited J{sub i} in both adapted and unadapted animals and was unaffected by removal of sodium from the external medium. Phloretin (10{sup {minus}4} M) significantly inhibited J{sub i} in adapted animals by 23-46%; there was also a reduction in J{sub i} in unadapted toads at 10{sup {minus}4} and 5 {times} 10{sup {minus}4} M phloretin. A dose-response study revealed that the concentration of phloretin causing half-maximal inhibition (K{sub {1/2}}) was 5 {times} 10{sup {minus}4} M for adapted animals. J{sub i} was unaffected by the substitution of sucrose for Ringer solution or by ouabain. They conclude (1) the process of adaptation appears to involve an increase in the number of amiloride- and phloretin-inhibitable urea transport sites in the skin, with a possible increase in the affinity of the sites for phloretin; (2) the adapted skin resembles the Bufo marinus urinary bladder with respect to amiloride and phloretin-inhibitable sites; (3) they confirm earlier observations that J{sub i} is independent of sodium transport.

  18. Morphological, behavioral and biological aspects of Azya luteipes Mulsant fed on Coccus viridis (Green

    Directory of Open Access Journals (Sweden)

    Juliana Nais

    2012-02-01

    Full Text Available One of the major pests of nursery seedlings of coffee (Coffea arabica L. is the green scale, Coccus viridis (Green (Hemiptera: Coccidae. The main predators of this species are beetles of the family Coccinellidae, especially Azya luteipes Mulsant. Morphological, behavioral and biological aspects of A. luteipes feeding on C. viridis on coffee plants were examined under laboratory conditions. Tests were conducted in room temperature at 28 ± 2 ºC. A. luteipes oviposits on the underside of the scale's body, laying two to four eggs per insect. The eggs have a subelliptical form and a white-clear color, and the incubation period is 8.3 ± 1.2 days. The number of eggs laid per female per day varies between eight and ten. A. luteipes undergoes four larval instars with durations of 2.0 ± 0, 3.2 ± 0.5, 3.6 ± 0.5 and 4.6 ± 0 days for the 1st, 2nd, 3rd and 4th instars, respectively. The average durations of the prepupal and pupal stages were 2.0 ± 0 and 10.9 ± 1.3 days, respectively. The viability of the larvae during each instar was 91.9, 89.3, 90.2 and 96.4 %, respectively, and the viabilities of prepupae and pupae were 99.1 and 98.2 %. The average duration of the egg-adult cycle was 34.3 ± 2.6 days, and the sex ratio was 0.52 %. Females presented a gray-colored head, while males presented a yellow head.

  19. Physicochemical properties, immunomodulation and antitumor activities of polysaccharide from Pavlova viridis.

    Science.gov (United States)

    Sun, Liqin; Chu, Jinling; Sun, Zhongliang; Chen, Lihong

    2016-01-01

    Polysaccharides synthesized by microalgae can be used as the functional ingredients of food or drugs. Here, we investigated the physicochemical properties and bioactivities of the polysaccharide from microalgae Pavlova viridis, and indicated the structure-activity relationship. The polysaccharides (PPS0) were degraded with H2O2-vitamin C assisted by ultrasonic waves. The functional group content, monosaccharide composition, and average molecular weight (avg-MW) were detected by chemical or chromatographic method. The immunomodulatory activities were evaluated in vitro by detecting nitric oxide (NO) emission, neutral red uptake and macrophage proliferation. Antitumor activities of degraded fragments were detected using S180-tumor-bearing mouse model by intragastric administration. Degraded polysaccharides PPS1 and PPS2 were obtained at avg-MW of 386.96 and 54.99 kDa. The sulfate group content of polysaccharide was 16%, and the uronic acid content was 5.88 and 8.48%. PPS mainly consisted of fructose, glucose and mannose. All the degraded PPSs could increase phagocytosis and proliferation of macrophages, and stimulated NO emission in a dose-dependently way. PPS2 in Low-MW fragments had the strongest immunoenhancing activities. Different doses of PPS all could inhibit the growth of implanted S180 tumor. At dose of 200 mg/kg/day, the tumor inhibition rate of PPS2 was 57.06%, about 23.6% less than that of CTX-treated group. Different-MW PPS significantly increased lymphocyte proliferation. At 200 mg/L, the proliferation index of PPS2 was 1.37, 2.03 times higher than that of CTX-treated group. The polysaccharides of Pavlova viridis had potential antitumor activities by improving immune response. Moreover, the bioactivities depend on their molecular weight. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. MODULACIÓN DE LA SINTESIS DE METALOTIONINAS EN Perna viridis PREEXPUESTOS A COBRE Y EXPUESTOS A CADMIO | MODULATION OF METALLOTHIONEIN SYNTHESIS IN Perna viridis PRE EXPOSED TO COPPER AND EXPOSED TO CADMIUM

    Directory of Open Access Journals (Sweden)

    Marín Lemus,

    2014-02-01

    Full Text Available The metallothioneins (Mts have been used as biomarkers because toxic metals such as Hg, Cd, Cu can induce their synthesis; however, environmental factors and the presence of other xenobiotics can determine the magnitude of the response in future exposures to metal ions. Metallothionein concentration was determinate in the soft tissue of Perna viridis juveniles pre-exposed to Cu and exposed to Cd (Cu/Cd for 21 days. For this, three experimental groups were established: exposed to Cd, pre-exposed to Cu and exposed to Cd and the control group (no metal. Cadmium accumulation in tissues of P. viridis was significantly higher in pre-exposed organisms to Cu, with an average value of 6.6 ± 1.9 mg/g, while in those exposed to Cd, was 4.7 ± 2.4 mg/g. Mts concentrations were also higher in the Cu/Cd experimental group, with a value of 1.36 ± 0.52 mg/g in relation to those exposed to Cd which had a value of 0.79 ± 0.47 mg/g. The relationship between Mts and bioaccumulation of Cd was significant in the group exposed to Cd, but not in the exposed Cu/Cd. These results suggest that Cu possibly acted as an inducer of Mts in the body, which led to increased accumulation of Cd in P. viridis and increase in Mts concentration. Tolerance and bioaccumulation of Cd in P. viridis was determined by previous exposure of the organism and hence its response on levels of MTs also depends on it.

  1. Selective Assembly of Na,K-ATPase α2β2 Heterodimers in the Heart

    Science.gov (United States)

    Habeck, Michael; Tokhtaeva, Elmira; Nadav, Yotam; Ben Zeev, Efrat; Ferris, Sean P.; Kaufman, Randal J.; Bab-Dinitz, Elizabeta; Kaplan, Jack H.; Dada, Laura A.; Farfel, Zvi; Tal, Daniel M.; Katz, Adriana; Sachs, George; Vagin, Olga; Karlish, Steven J. D.

    2016-01-01

    The Na,K-ATPase α2 subunit plays a key role in cardiac muscle contraction by regulating intracellular Ca2+, whereas α1 has a more conventional role of maintaining ion homeostasis. The β subunit differentially regulates maturation, trafficking, and activity of α-β heterodimers. It is not known whether the distinct role of α2 in the heart is related to selective assembly with a particular one of the three β isoforms. We show here by immunofluorescence and co-immunoprecipitation that α2 is preferentially expressed with β2 in T-tubules of cardiac myocytes, forming α2β2 heterodimers. We have expressed human α1β1, α2β1, α2β2, and α2β3 in Pichia pastoris, purified the complexes, and compared their functional properties. α2β2 and α2β3 differ significantly from both α2β1 and α1β1 in having a higher K0.5K+ and lower K0.5Na+ for activating Na,K-ATPase. These features are the result of a large reduction in binding affinity for extracellular K+ and shift of the E1P-E2P conformational equilibrium toward E1P. A screen of perhydro-1,4-oxazepine derivatives of digoxin identified several derivatives (e.g. cyclobutyl) with strongly increased selectivity for inhibition of α2β2 and α2β3 over α1β1 (range 22–33-fold). Molecular modeling suggests a possible basis for isoform selectivity. The preferential assembly, specific T-tubular localization, and low K+ affinity of α2β2 could allow an acute response to raised ambient K+ concentrations in physiological conditions and explain the importance of α2β2 for cardiac muscle contractility. The high sensitivity of α2β2 to digoxin derivatives explains beneficial effects of cardiac glycosides for treatment of heart failure and potential of α2β2-selective digoxin derivatives for reducing cardiotoxicity. PMID:27624940

  2. Bases débiles minoritarias de la raíz de Rauvolfia viridis Roem. et Schult.

    Directory of Open Access Journals (Sweden)

    Jorge A Martínez Pérez

    1997-12-01

    Full Text Available Se realizó un estudio químico de la raíz de la especie Rauvolfia viridis Roem. et Schult. que crece en Cuba, con el objetivo de profundizar en este tema. Se aislaron, purificaron y caracterizaron diferentes alcaloides correspondientes a las bases débiles, entre los que se encuentran la ajmalidina, la a-yohimbina, la quebrachidina, la reserpinina y la yohimbina. Se descarta la presencia de reserpina.It was conducted a chemical study of the root of the species Rauwolfia viridis Roem. et Schult. that grows in Cuba aimed at depening in this topic. Different alkaloids corresponding to the weak bases, such as ajmaline, a-yohimbin, quebrachidine, reserpine and yohimbin, were isolated, purified and characterized. The presence of reserpine is discarded.

  3. Mortalities of the Green Toad (Epidalea viridis (Laurenti, 1768) in Urban Environment: A Case Study from the City of Plovdiv

    OpenAIRE

    Miglena V. Valkanova; Ivelin A. Mollov; Bogdan N. Nikolov

    2009-01-01

    The current study analyzes the types of mortalities of the green toad (Epidalea viridis) in the city of Plovdiv. Among all recorded mortalities (n=42), the road kill was the most common cause of death (65 % of the cases), followed by killing by humans (usually children) – 31%. Killing of green toads by dogs (2%) and domestic cats (2%) has the lowest impact. Both most significant factors (road kill and killing by humans) affect mainly the adult specimens. No statistically significant differenc...

  4. The role of photo-osmotic adaptation in semi-continuous culture and lipid particle release from Dunaliella viridis

    OpenAIRE

    Davis, Ryan W.; Carvalho, Benjamin J.; Jones, Howland D. T.; Singh, Seema

    2014-01-01

    Although great efforts have been made to elucidate the phenotypic responses of alga to varying levels of nutrients, osmotic environments, and photosynthetically active radiation intensities, the role of interactions among these variables is largely nebulous. Here, we describe a general method for establishing and maintaining semi-continuous cultures of the halophilic microalgal production strain, Dunaliella viridis, that is independent of variations in salinity and illumination intensity. Usi...

  5. Ecology,ethology and variability of european green lizard Lacerta viridis in Natural reservation Tiché údolí

    OpenAIRE

    Chmelař, Jan

    2014-01-01

    The european green lizard, Lacerta viridis is a critically endangered reptile species which is in the region of Bohemia present only in relict isolated populations. These populations are closely linked to slopes with a southern exposition in deeply engorged river valleys. These valleys exhibit a unique climatic effect also known as the river phenomenon which allows numerous animal and plant species to survive far beyond their standard northern range. The chosen locality in Tiché údolí is a su...

  6. Characterization of Translationally Controlled Tumour Protein from the Sea Anemone Anemonia viridis and Transcriptome Wide Identification of Cnidarian Homologues

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    2018-01-01

    Full Text Available Gene family encoding translationally controlled tumour protein (TCTP is defined as highly conserved among organisms; however, there is limited knowledge of non-bilateria. In this study, the first TCTP homologue from anthozoan was characterised in the Mediterranean Sea anemone, Anemonia viridis. The release of the genome sequence of Acropora digitifera, Exaiptasia pallida, Nematostella vectensis and Hydra vulgaris enabled a comprehensive study of the molecular evolution of TCTP family among cnidarians. A comparison among TCTP members from Cnidaria and Bilateria showed conserved intron exon organization, evolutionary conserved TCTP signatures and 3D protein structure. The pattern of mRNA expression profile was also defined in A. viridis. These analyses revealed a constitutive mRNA expression especially in tissues with active proliferation. Additionally, the transcriptional profile of A. viridis TCTP (AvTCTP after challenges with different abiotic/biotic stresses showed induction by extreme temperatures, heavy metals exposure and immune stimulation. These results suggest the involvement of AvTCTP in the sea anemone defensome taking part in environmental stress and immune responses.

  7. Comparative feedstock analysis in Setaria viridis L. as a model for C4 bioenergy grasses and Panicoid crop species

    Directory of Open Access Journals (Sweden)

    Carloalberto ePetti

    2013-06-01

    Full Text Available Second generation feedstocks for bioethanol will likely include a sizable proportion of perennial C4 grasses, principally in the Panicoideae clade. The Panicoideae contain agronomically important annual grasses including Zea mays L. (maize, Sorghum bicolor (L. Moench (sorghum, and Saccharum officinarum L. (sugar cane as well as promising second generation perennial feedstocks including Miscanthus x giganteus and Panicum virgatum L. (switchgrass. The underlying complexity of these polyploid grass genomes is a major limitation for their direct manipulation and thus driving a need for rapidly cycling comparative model. Setaria viridis (green millet is a rapid cycling C4 Panicoid grass with a relatively small and sequenced diploid genome and abundant seed production. Stable, transient and protoplast transformation technologies have also been developed for S. viridis making it a potentially excellent model for other C4 bioenergy grasses. Here, the lignocellulosic feedstock composition, cellulose biosynthesis inhibitor (CBI response and saccharification dynamics of S. viridis are compared with the annual s00orghum and maize and the perennial switchgrass bioenergy crops as a baseline study into the applicability for translational research. A genome-wide systematic investigation of the cellulose synthase-A (CesA genes was performed identifying eight candidate sequences. Two-developmental stages; a metabolically active young tissue and b metabolically plateaued (mature material are examined to compare biomass performance metrics.

  8. MutLα heterodimers modify the molecular phenotype of Friedreich ataxia.

    Directory of Open Access Journals (Sweden)

    Vahid Ezzatizadeh

    Full Text Available Friedreich ataxia (FRDA, the most common autosomal recessive ataxia disorder, is caused by a dynamic GAA repeat expansion mutation within intron 1 of FXN gene, resulting in down-regulation of frataxin expression. Studies of cell and mouse models have revealed a role for the mismatch repair (MMR MutS-heterodimer complexes and the PMS2 component of the MutLα complex in the dynamics of intergenerational and somatic GAA repeat expansions: MSH2, MSH3 and MSH6 promote GAA repeat expansions, while PMS2 inhibits GAA repeat expansions.To determine the potential role of the other component of the MutLα complex, MLH1, in GAA repeat instability in FRDA, we have analyzed intergenerational and somatic GAA repeat expansions from FXN transgenic mice that have been crossed with Mlh1 deficient mice. We find that loss of Mlh1 activity reduces both intergenerational and somatic GAA repeat expansions. However, we also find that loss of either Mlh1 or Pms2 reduces FXN transcription, suggesting different mechanisms of action for Mlh1 and Pms2 on GAA repeat expansion dynamics and regulation of FXN transcription.Both MutLα components, PMS2 and MLH1, have now been shown to modify the molecular phenotype of FRDA. We propose that upregulation of MLH1 or PMS2 could be potential FRDA therapeutic approaches to increase FXN transcription.

  9. Unveiling hidden features of orphan nuclear receptors: the case of the small heterodimer partner (SHP).

    Science.gov (United States)

    Macchiarulo, Antonio; Rizzo, Giovanni; Costantino, Gabriele; Fiorucci, Stefano; Pellicciari, Roberto

    2006-03-01

    The small heterodimer partner (SHP) is an atypical nuclear receptor lacking the N-terminal ligand-independent activation domain and the DNA binding domain. SHP acts as transcriptional inhibitor of a large set of nuclear receptors, among which ER, AR, CAR, RXR, GR, LXR and ERRgamma. The repression mechanism of SHP involves several actions including competition with coactivators binding on the AF-2 of nuclear receptors and recruitment of transcriptional inhibitors such as EID-1. The investigation of the structure and repression mechanism of SHP is a challenging task for a full understanding of nuclear receptor interaction pathways and functions. So far, mutational analyses in multiple populations identified loss of function mutants of SHP gene involved in mild obesity, increased birth weight and insulin levels. Furthermore, experimental mutagenesis has been exploited to characterize the interactions between SHP and the transcriptional inhibitor EID-1. With the aim of gaining insight into the structural basis of SHP repression mechanism, we modelled SHP and EID-1 structures. Docking experiments were carried out to identify the EID-1 binding surface on SHP structure. The results obtained in this study allow for the first time a unique interpretation of many experimental data available from the published literature. In addition, a fascinating hypothesis raises from the inspection of the proposed SHP structure: the presence of a potential unexpected ligand binding site, supported by recently available experimental data that may represent a breakthrough in the design and development of synthetic modulators of SHP functions.

  10. Absence of Intramolecular Singlet Fission in Pentacene-Perylenediimide Heterodimers: The Role of Charge Transfer State.

    Science.gov (United States)

    Wang, Long; Wu, Yishi; Chen, Jianwei; Wang, Lanfen; Liu, Yanping; Yu, Zhenyi; Yao, Jiannian; Fu, Hongbing

    2017-11-16

    A new class of donor-acceptor heterodimers based on two singlet fission (SF)-active chromophores, i.e., pentacene (Pc) and perylenediimide (PDI), was developed to investigate the role of charge transfer (CT) state on the excitonic dynamics. The CT state is efficiently generated upon photoexcitation. However, the resulting CT state decays to different energy states depending on the energy levels of the CT state. It undergoes extremely rapid deactivation to the ground state in polar CH 2 Cl 2 , whereas it undergoes transformation to a Pc triplet in nonpolar toluene. The efficient triplet generation in toluene is not due to SF but CT-mediated intersystem crossing. In light of the energy landscape, it is suggested that the deep energy level of the CT state relative to that of the triplet pair state makes the CT state actually serve as a trap state that cannot undergoes an intramolecular singlet fission process. These results provide guidance for the design of SF materials and highlight the requisite for more widely applicable design principles.

  11. Dissecting the role of distinct OCT4-SOX2 heterodimer configurations in pluripotency

    Science.gov (United States)

    Tapia, Natalia; MacCarthy, Caitlin; Esch, Daniel; Gabriele Marthaler, Adele; Tiemann, Ulf; Araúzo-Bravo, Marcos J.; Jauch, Ralf; Cojocaru, Vlad; Schöler, Hans R.

    2015-01-01

    The transcription factors OCT4 and SOX2 are required for generating induced pluripotent stem cells (iPSCs) and for maintaining embryonic stem cells (ESCs). OCT4 and SOX2 associate and bind to DNA in different configurations depending on the arrangement of their individual DNA binding elements. Here we have investigated the role of the different OCT4-SOX2-DNA assemblies in regulating and inducing pluripotency. To this end, we have generated SOX2 mutants that interfere with specific OCT4-SOX2 heterodimer configurations and assessed their ability to generate iPSCs and to rescue ESC self-renewal. Our results demonstrate that the OCT4-SOX2 configuration that dimerizes on a Hoxb1-like composite, a canonical element with juxtaposed individual binding sites, plays a more critical role in the induction and maintenance of pluripotency than any other OCT4-SOX2 configuration. Overall, the results of this study provide new insight into the protein interactions required to establish a de novo pluripotent network and to maintain a true pluripotent cell fate. PMID:26314899

  12. The Ku heterodimer and the metabolism of single-ended DNA double-strand breaks.

    Science.gov (United States)

    Balestrini, Alessia; Ristic, Dejan; Dionne, Isabelle; Liu, Xiao Z; Wyman, Claire; Wellinger, Raymund J; Petrini, John H J

    2013-06-27

    Single-ended double-strand breaks (DSBs) are a common form of spontaneous DNA break, generated when the replisome encounters a discontinuity in the DNA template. Given their prevalence, understanding the mechanisms governing the fate(s) of single-ended DSBs is important. We describe the influence of the Ku heterodimer and Mre11 nuclease activity on processing of single-ended DSBs. Separation-of-function alleles of yku70 were derived that phenocopy Ku deficiency with respect to single-ended DSBs but remain proficient for NHEJ. The Ku mutants fail to regulate Exo1 activity, and bypass the requirement for Mre11 nuclease activity in the repair of camptothecin-induced single-ended DSBs. Ku mutants exhibited reduced affinity for DNA ends, manifest as both reduced end engagement and enhanced probability of diffusing inward on linear DNA. This study reveals an interplay between Ku and Mre11 in the metabolism of single-ended DSBs that is distinct from repair pathway choice at double-ended DSBs. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

  13. The Ku Heterodimer and the Metabolism of Single-Ended DNA Double-Strand Breaks

    Directory of Open Access Journals (Sweden)

    Alessia Balestrini

    2013-06-01

    Full Text Available Single-ended double-strand breaks (DSBs are a common form of spontaneous DNA break, generated when the replisome encounters a discontinuity in the DNA template. Given their prevalence, understanding the mechanisms governing the fate(s of single-ended DSBs is important. We describe the influence of the Ku heterodimer and Mre11 nuclease activity on processing of single-ended DSBs. Separation-of-function alleles of yku70 were derived that phenocopy Ku deficiency with respect to single-ended DSBs but remain proficient for NHEJ. The Ku mutants fail to regulate Exo1 activity, and bypass the requirement for Mre11 nuclease activity in the repair of camptothecin-induced single-ended DSBs. Ku mutants exhibited reduced affinity for DNA ends, manifest as both reduced end engagement and enhanced probability of diffusing inward on linear DNA. This study reveals an interplay between Ku and Mre11 in the metabolism of single-ended DSBs that is distinct from repair pathway choice at double-ended DSBs.

  14. Controlled synthesis of PbS-Au nanostar-nanoparticle heterodimers and cap-like Au nanoparticles

    Science.gov (United States)

    Zhao, Nana; Li, Lianshan; Huang, Teng; Qi, Limin

    2010-11-01

    Uniform PbS-Au nanostar-nanoparticle heterodimers consisting of one Au nanoparticle grown on one horn of a well-defined six-horn PbS nanostar were prepared using the PbS nanostars as growth substrates for the selective deposition of Au nanoparticles. The size of the Au nanoparticles on the horns of the PbS nanostars could be readily adjusted by changing the PbS concentration for the deposition of Au nanoparticles. An optimum cetyltrimethylammonium bromide concentration and temperature were essential for the selective deposition of uniform Au nanoparticles on single horns of the PbS nanostars. Unusual PbS-Au nanoframe-nanoparticle heterodimers were obtained by etching the PbS-Au nanostar-nanoparticle heterodimers with oxalic acid while novel cap-like Au nanoparticles were obtained by etching with hydrochloric acid. The obtained heterodimeric nanostructures and cap-like nanoparticles are promising candidates for anisotropic nanoscale building blocks for the controllable assembly of useful, complex architectures.

  15. Surface Oxidation of AuNi Heterodimers to Achieve High Activities toward Hydrogen/Oxygen Evolution and Oxygen Reduction Reactions.

    Science.gov (United States)

    Ni, Bing; He, Peng; Liao, Wenxin; Chen, Shuangming; Gu, Lin; Gong, Yue; Wang, Kai; Zhuang, Jing; Song, Li; Zhou, Gang; Wang, Xun

    2018-04-01

    Although much attention has been paid to the exploration of highly active electrocatalysts, especially catalysts for hydrogen evolution reaction (HER), oxygen evolution reaction (OER) and oxygen reduction reaction (ORR), the development of multifunctional catalysts remains a challenge. Here, we utilize AuNi heterodimers as the starting materials to achieve high activities toward HER, OER and ORR. The HER and ORR activities in an alkali environment are similar to those of Pt catalysts, and the OER activity is very high and better than that of commercial IrO 2 . Both the experimental and calculated results suggest that the surface oxidation under oxidative conditions is the main reason for the different activities. The NiO/Ni interface which exists in the as-synthesized heterodimers contributes to high HER activity, the Ni(OH) 2 -Ni-Au interface and the surface Ni(OH) 2 obtained in electrochemical conditons gives rise to promising ORR and OER activities, respectively. As a comparison, a Au@Ni core-shell structure is also synthesized and examined. The core-shell structure shows lower activities for HER and OER than the heterodimers, and reduces O 2 selectively to H 2 O 2 . The work here allows for the development of a method to design multifunctional catalysts via the partial oxidation of a metal surface to create different active centers. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Insights into MHC class I peptide loading from the structure of the Tapasin-ERp57 thiol oxidoreductase heterodimer

    Energy Technology Data Exchange (ETDEWEB)

    Dong, G.; Wearsch, P.A.; Peaper, D.R.; Cresswell, P.; Reinisch, K.M.; (Yale-MED)

    2009-03-02

    Tapasin is a glycoprotein critical for loading major histocompatibility complex (MHC) class I molecules with high-affinity peptides. It functions within the multimeric peptide-loading complex (PLC) as a disulfide-linked, stable heterodimer with the thiol oxidoreductase ERp57, and this covalent interaction is required to support optimal PLC activity. Here, we present the 2.6 {angstrom} resolution structure of the tapasin-ERp57 core of the PLC. The structure revealed that tapasin interacts with both ERp57 catalytic domains, accounting for the stability of the heterodimer, and provided an example of a protein disulfide isomerase family member interacting with substrate. Mutational analysis identified a conserved surface on tapasin that interacted with MHC class I molecules and was critical for peptide loading and editing functions of the tapasin-ERp57 heterodimer. By combining the tapasin-ERp57 structure with those of other defined PLC components, we present a molecular model that illuminates the processes involved in MHC class I peptide loading.

  17. Correction: Stereodivergent synthesis of right- and left-handed iminoxylitol heterodimers and monomers. Study of their impact on β-glucocerebrosidase activity.

    Science.gov (United States)

    Stauffert, Fabien; Serra-Vinardell, Jenny; Gómez-Grau, Marta; Michelakakis, Helen; Mavridou, Irene; Grinberg, Daniel; Vilageliu, Lluïsa; Casas, Josefina; Bodlenner, Anne; Delgado, Antonio; Compain, Philippe

    2017-09-26

    Correction for 'Stereodivergent synthesis of right- and left-handed iminoxylitol heterodimers and monomers. Study of their impact on β-glucocerebrosidase activity' by Fabien Stauffert et al., Org. Biomol. Chem., 2017, 15, 3681-3705.

  18. The polar 2e/12c bond in phenalenyl-azaphenalenyl hetero-dimers: Stronger stacking interaction and fascinating interlayer charge transfer

    Science.gov (United States)

    Zhong, Rong-Lin; Xu, Hong-Liang; Li, Zhi-Ru

    2016-08-01

    An increasing number of chemists have focused on the two-electron/multicenter bond (2e/mc) that was first introduced to interpret the bonding mechanism of radical dimers. Herein, we report the polar two-electron/twelve center (2e/12c) bonding character in a series of phenalenyl-azaphenalenyl radical hetero-dimers. Interestingly, the bonding energy of weaker polar hetero-dimer (P-TAP) is dominated by the overlap of the two different singly occupied molecular orbital of radicals, while that of stronger polar hetero-dimer (P-HAP) is dominated by the electrostatic attraction. Results show that the difference between the electronegativity of the monomers plays a prominent role in the essential attribution of the polar 2e/12c bond. Correspondingly, a stronger stacking interaction in the hetero-dimer could be effectively achieved by increasing the difference of nitrogen atoms number between the monomers. It is worthy of note that an interesting interlayer charge transfer character is induced in the polar hetero-dimers, which is dependent on the difference between the electronegativity of the monomers. It is our expectation that the new knowledge about the bonding nature of radical hetero-dimers might provide important information for designing radical based functional materials with various applications.

  19. Small heterodimer partner overexpression partially protects against liver tumor development in farnesoid X receptor knockout mice

    International Nuclear Information System (INIS)

    Li, Guodong; Kong, Bo; Zhu, Yan; Zhan, Le; Williams, Jessica A.; Tawfik, Ossama; Kassel, Karen M.; Luyendyk, James P.; Wang, Li; Guo, Grace L.

    2013-01-01

    Farnesoid X receptor (FXR, Nr1h4) and small heterodimer partner (SHP, Nr0b2) are nuclear receptors that are critical to liver homeostasis. Induction of SHP serves as a major mechanism of FXR in suppressing gene expression. Both FXR −/− and SHP −/− mice develop spontaneous hepatocellular carcinoma (HCC). SHP is one of the most strongly induced genes by FXR in the liver and is a tumor suppressor, therefore, we hypothesized that deficiency of SHP contributes to HCC development in the livers of FXR −/− mice and therefore, increased SHP expression in FXR −/− mice reduces liver tumorigenesis. To test this hypothesis, we generated FXR −/− mice with overexpression of SHP in hepatocytes (FXR −/− /SHP Tg ) and determined the contribution of SHP in HCC development in FXR −/− mice. Hepatocyte-specific SHP overexpression did not affect liver tumor incidence or size in FXR −/− mice. However, SHP overexpression led to a lower grade of dysplasia, reduced indicator cell proliferation and increased apoptosis. All tumor-bearing mice had increased serum bile acid levels and IL-6 levels, which was associated with activation of hepatic STAT3. In conclusion, SHP partially protects FXR −/− mice from HCC formation by reducing tumor malignancy. However, disrupted bile acid homeostasis by FXR deficiency leads to inflammation and injury, which ultimately results in uncontrolled cell proliferation and tumorigenesis in the liver. - Highlights: • SHP does not prevent HCC incidence nor size in FXR KO mice but reduces malignancy. • Increased SHP promotes apoptosis. • Bile acids and inflammation maybe critical for HCC formation with FXR deficiency

  20. Questionable expression of unstable DQ heterodimer containing HLA-DQA1*01:07.

    Science.gov (United States)

    Miyadera, H; Bungener, L B; Kusano, S; Yokoyama, S; Tokunaga, K; Hepkema, B G

    2015-12-01

    Human leukocyte antigens (HLA)-DQA1*01:07 was identified as an HLA-DQ blank specificity that segregated with the serological HLA-A2, -B7, -DR14, -DR52 haplotype, which carried DQB1*05:03. The blank specificity of DQA1*01:07-DQB1*05:03 may be because of lack of reactivity of available typing sera, or disruption of proper assembly of DQ heterodimer. The cDNA sequence of DQA1*01:07 is nearly identical to DQA1*01:04 except for a variant at position 304, which results in the replacement of an arginine with a cysteine at 79α. To determine whether the DQA1*01:07 product can be expressed on cell-surface, we co-expressed DQA1*01:07 with various DQB1*05 or *06 alleles in fibroblast cells. Cell-surface expression of DQ was detectable when DQA1*01:07 was co-expressed with DQB1*06:04 but undetectable with other DQB1*05 and DQB1*06 alleles, including DQB1*05:03, to which DQA1*01:07 was encoded in cis. These data suggest that DQA1*01:07 may act as a phenotypically null allele in the DQA1*01:07-DQB1*05:03 haplotype, while it can be expressed at a low level in the presences of certain DQB1*06 alleles, such as DQB1*06:04, in trans. Based on the null or low expression of DQA1*01:07 as shown in the previous and present studies, DQA1*01:07 has recently been renamed to DQA1*01:07Q, indicating its questionable expression. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  1. Phytolith analysis for differentiating between foxtail millet (Setaria italica and green foxtail (Setaria viridis.

    Directory of Open Access Journals (Sweden)

    Jianping Zhang

    2011-05-01

    Full Text Available Foxtail millet (Setaria italica is one of the oldest domesticated cereal crops in Eurasia, but identifying foxtail millets, especially in charred grains, and differentiating it from its wild ancestor, green foxtail (Setaria viridis, in the archaeobotanical remains, is still problematic. Phytolithic analysis provides a meaningful method for identifying this important crop. In this paper, the silicon structure patterns in the glumes, lemmas, and paleas from inflorescence bracts in 16 modern plants of foxtail millet and green foxtail from China and Europe are examined using light microscopy with phase-contrast and a microscopic interferometer. Our research shows that the silicon structure of ΩIII from upper lemmas and paleas in foxtail millet and green foxtail can be correspondingly divided into two groups. The size of ΩIII type phytolith of foxtail millet is bigger than that from green foxtail. Discriminant function analysis reveals that 78.4% of data on foxtail millet and 76.9% of data on green foxtail are correctly classified. This means certain morphotypes of phytoliths are relatively reliable tools for distinguishing foxtail millet from green foxtail. Our results also revealed that the husk phytolith morphologies of foxtail millets from China and Eastern Europe are markedly different from those from Western Europe. Our research gives a meaningful method of separating foxtail millet and green foxtail. The implications of these findings for understanding the history of foxtail millet domestication and cultivation in ancient civilizations are significant.

  2. Dioxin and phthalate uptake and assimilation by the green mussel Perna viridis

    International Nuclear Information System (INIS)

    Wang, Wen-Xiong; Zhang, Qiong

    2013-01-01

    In this study, the aqueous uptake and dietary assimilation (trophic transfer) of two endocrine disrupting compounds (dioxin and phathalic acid) in the green mussel Perna viridis were quantified. During short-term exposure period, dioxin rapidly sorbed onto phytoplankton and its accumulation was much higher than that of phthalate. The uptake of these two compounds by the mussels increased with increasing temperature and salinity (for dioxin only). The dietary assimilation of the two contaminants was rather modest (10–64% for dioxin and 20–47% for phthalate), and was greatly dependent on the food species and concentration. Interestingly, dietary assimilation increased with increasing diatom food concentration. Gut passage time was partially responsible for the variable dietary assimilation. Given the high dissolved uptake rate and the modest dietary assimilation, aqueous exposure was predicted to be the dominant bioaccumulation source for both dioxin and phthalate in the green mussels under most conditions. -- Capsule: Aqueous uptake was the predominant pathway for dioxin and phthalate accumulation in marine green mussels

  3. Phytolith Analysis for Differentiating between Foxtail Millet (Setaria italica) and Green Foxtail (Setaria viridis)

    Science.gov (United States)

    Zhang, Jianping; Lu, Houyuan; Wu, Naiqin; Yang, Xiaoyan; Diao, Xianmin

    2011-01-01

    Foxtail millet (Setaria italica) is one of the oldest domesticated cereal crops in Eurasia, but identifying foxtail millets, especially in charred grains, and differentiating it from its wild ancestor, green foxtail (Setaria viridis), in the archaeobotanical remains, is still problematic. Phytolithic analysis provides a meaningful method for identifying this important crop. In this paper, the silicon structure patterns in the glumes, lemmas, and paleas from inflorescence bracts in 16 modern plants of foxtail millet and green foxtail from China and Europe are examined using light microscopy with phase-contrast and a microscopic interferometer. Our research shows that the silicon structure of ΩIII from upper lemmas and paleas in foxtail millet and green foxtail can be correspondingly divided into two groups. The size of ΩIII type phytolith of foxtail millet is bigger than that from green foxtail. Discriminant function analysis reveals that 78.4% of data on foxtail millet and 76.9% of data on green foxtail are correctly classified. This means certain morphotypes of phytoliths are relatively reliable tools for distinguishing foxtail millet from green foxtail. Our results also revealed that the husk phytolith morphologies of foxtail millets from China and Eastern Europe are markedly different from those from Western Europe. Our research gives a meaningful method of separating foxtail millet and green foxtail. The implications of these findings for understanding the history of foxtail millet domestication and cultivation in ancient civilizations are significant. PMID:21573069

  4. Williamsia spongiae sp. nov., an actinomycete isolated from the marine sponge Amphimedon viridis.

    Science.gov (United States)

    Afonso de Menezes, Cláudia Beatriz; Afonso, Rafael Sanches; Souza, Wallace Rafael de; Parma, Márcia; Melo, Itamar Soares de; Zucchi, Tiago Domingues; Fantinatti-Garboggini, Fabiana

    2017-05-01

    A novel actinobacterium, designated isolate B138T, was isolated from the marine sponge, Amphimedon viridis, which was collected from Praia Guaecá (São Paulo, Brazil), and its taxonomic position was established using data from a polyphasic study. The organism showed a combination of chemotaxonomic and morphological characteristics consistent with its classification in the genus Williamsia and it formed a distinct phyletic line in the Williamsia 16S rRNA gene tree. It was most closely related to Williamsia serinedens DSM 45037T and Williamsia deligens DSM 44902T (99.0 % 16S rRNA gene sequence similarity) and Williamsia maris DSM 44693T (97.5 % 16S rRNA gene sequence similarity), but was distinguished readily from these strains by the low DNA-DNA relatedness values (62.3-64.4 %) and by the discriminatory phenotypic properties. Based on the data obtained, the isolate B138T (=CBMAI 1094T=DSM 46676T) should be classified as the type strain of a novel species of the genus Williamsia, for which the name Williamsia spongiae sp. nov. is proposed.

  5. The effect of Euglena viridis on immune response of rohu, Labeo rohita (Ham.).

    Science.gov (United States)

    Das, Basanta Kumar; Pradhan, Jyotirmayee; Sahu, Swagatika

    2009-06-01

    The study evaluated the effect of dietary doses of Euglena viridis on the immune response and disease resistance of Labeo rohita fingerlings against infection with the bacterial pathogen Aeromonas hydrophila. L. rohita fingerlings were fed with diet containing 0 (Control), 0.1 g, 0.5 g, 1.0 g Euglena powder kg(-1) dry diet for 90 days. Biochemical (serum total protein, albumin, globulin, albumin:globulin ratio), haematological (WBC, RBC, haemoglobin content) and immunological (superoxide anion production, lysozyme, serum bactericidal activity) parameters of fish were examined after 30, 60 and 90 days of feeding. Fish were challenged with A. hydrophila 90 days post-feeding and mortalities were recorded over 10 days post-infection. The results demonstrate that fish fed with Euglena showed increased levels of superoxide anion production, lysozyme, serum bactericidal activity, serum protein and albumin (P Euglena kg(-1) dry diet showed the highest percentage survival (75%). These results indicate that Euglena stimulates the immunity and makes L. rohita more resistant to A. hydrophila infection.

  6. Kelayakan Kualitas Perairan Sekitar Mangrove Center Tuban Untuk Aplikasi Alat Pengumpul Kerang Hijau (Perna viridis L.

    Directory of Open Access Journals (Sweden)

    Syarifah Hikmah Julinda Sari

    2015-04-01

    Full Text Available The coastal waters around the Mangrove Center Tuban, East Java is a potential habitat for the green mussel (Perna viridis L.. Therefore, the water quality of this area need to be assessment. The study was aimed to determine the feasibility of water quality in coastal water f Mangrove Center Tuban for application collecting gear of green mussels. The sampling was conducted by set up three stations randomly in studied area. Parameters was measured including temperature, pH, salinity, DO, depth, turbidity, BOD and TSS. The results showed that the coastal waters around the Mangrove Center Tuban, owned temperature that ranged from 29.10 to 30.67 0C, the pH ranged from 8.23 to 8.37, salinity ranged from 26.87 to 30.30 ‰, DO fall in the range of 6,63- 6.87 mg / L, the water depth at the time of measurement ranges from 40-85 cm. TSS ranged from 206.2 mg / L to 353.7 mg / L, BOD value between 4.05 to 12.2 mg / L, while the turbidity ranged from 134 to 400 NTU. Parameters that below the standard namely temperature, pH, DO, salinity and BOD, while TSS and turbidity were exceed the threshold quality standards set by the government.

  7. Responses of European green lizards Lacerta viridis following administration of Leishmania agamae promastigotes.

    Science.gov (United States)

    Ingram, G A; Molyneux, D H

    1984-12-01

    European green lizards (Lacerta viridis) were injected intraperitoneally, subcutaneously or orally with viable Leishmania agamae promastigotes. Neither promastigotes nor amastigotes were later found in blood and tissue impression smears, or in blood and selected organ cultures. However, by the use of an immunoperoxidase technique, parasite antigens were detected in the liver, stomach, small intestine, kidney, gonad, heart, lung and skin but not in the bone marrow, brain or spleen. Non-precipitating antibodies with beta 2-electrophoretic mobility were induced against L. agamae. They were detected in the sera by enzyme-linked immunosorbent assay 3-7 days post-infection. The titres increased significantly above background levels (P less than 0.001) and reached maxima after 6-7 weeks, with 27 out of 29 lizards producing antibodies. The mean serum protein concentration significantly increased after infection (P less than 0.005) with no significant differences in mean values between male and female animals. Lizard sera separated into 7 components on cellulose acetate membranes with migration rates comparable to albumin, alpha- and beta-globulins of human serum; gamma-globulins were absent. Significant decreases occurred (P less than 0.05) in the albumin fraction, with significant increases in the beta-globulin region of anti-L. agamae sera. C-reactive protein was not detected in either normal or immune lizard sera.

  8. The sensory component of the facial nerve of a reptile (Lacerta viridis).

    Science.gov (United States)

    Jacobs, V L

    1979-04-01

    The sensory fibers of the facial nerve in Lacerta viridis have been studied with a silver impregnation method to follow the course of axonal degeneration. Destruction of the geniculate ganglion demonstrated the degenerated sensory component of the facial nerve adjacent to the anterior vestibular root. Within the lateral vestibular area the facial sensory fibers consist of numerous rootlets separated by vestibular fibers and cells. These rootlets may join to form a main or paired sensory tract that passes through the vestibular nuclei to enter the tractus solitarius and divide into a small ascending prefacial component and a major descending prevagal division. A few fibers continue into the postvagal part of tractus solitarius and extend caudally to terminate in the nucleus commissura infima. Prefacial fibers terminate along the periventricular gray while prevagal fibers terminate within the tractus solitarius on the dendrites of cells of nucleus tractus solitarius and near the periphery of the dorsal motor nucleus of X. There was no noticeable degeneration in the descendens tractus trigemini. Terminal degeneration to descendens nucleus trigemini and motor nucleus of VII followed the tractus solitarius course. Most facial sensory fibers are probably related to taste and other visceral information.

  9. The mucosubstance coating the pneumonocytes in the lungs of Xenopus laevis and Lacerta viridis.

    Science.gov (United States)

    Meban, C

    1975-01-01

    The layer of mucosubstance that is associated with the free surface membranes of the pneumonocytes in the lungs of the toad Xenopus laevis and the lizard Lacerta viridis was demonstrated by electron microscopy using iron oxide stain. The form and staining reactions of the mucosubstance layer were similar in both animals. In electron micrographs the mucosubstance was represented by a band of densely stained material (25-50 nm thick) which coated the entire free surface of the pneumonocytes. It appeared to be firmly attached to the outer leaflet of the superficial plasma membrane. Short lengths of osmiophilic membranes, presumed to be fragments of pulmonary surfactant, were often observed lying free in the air spaces but they did not show any affinity for iron stain. Incubation of lung sections in a solution of neuraminidase produced a marked decrease in the intensity of the surface staining; no change was detected after incubation in trypsin, papain, hyaluronidase, N-acetyl cysteine, or phosphate buffer. It is, therefore, concluded that the pneumonocyte surface coat consists mainly of a sialomucin.

  10. Ultraviolet nuptial colour determines fight success in male European green lizards (Lacerta viridis).

    Science.gov (United States)

    Bajer, Katalin; Molnár, Orsolya; Török, János; Herczeg, Gábor

    2011-12-23

    Animal communication through colour signals is a central theme in sexual selection. Structural colours can be just as costly and honest signals as pigment-based colours. Ultraviolet (UV) is a structural colour that can be important both in intrasexual competition and mate choice. However, it is still unknown if a UV signal alone can determine the outcome of male-male fights. European green lizard (Lacerta viridis) males develop a nuptial throat coloration with a strong UV component. Among males differing only in their manipulated UV colour, females prefer males with higher UV. Here, we experimentally decreased the UV coloration of randomly chosen males from otherwise similar male pairs to test the hypothesis that a difference in UV colour alone can affect fight success during male-male competition. Our results fully supported the hypotheses: in almost 90 per cent of the contests the male with reduced UV lost the fight. Our results show that UV can be an important signal, affecting both female mate choice and determining male fight success.

  11. The primary humoral immune response of European green lizards (Lacerta viridis) to Leishmania agamae.

    Science.gov (United States)

    Ingram, G A; Molyneux, D H

    1983-01-01

    European green lizards, Lacerta viridis, produced relatively thermostable, dithiothreitol-sensitive, non-precipitating, agglutinins and complement-fixing antibodies (CFA) to Leishmania agamae administered subcutaneously (SC), intraperitoneally (IP) or orally (OR). Antibodies were also detected by the immobilization test (IMM) and by enzyme-linked immunosorbent assay (ELISA). The most sensitive method for the detection of stimulated immunoglobulins was ELISA. Antibodies were detected as early as 3 days post-infection with ELISA and between 5 and 7 for CFA, direct agglutination (DA) and indirect haemagglutination (IHA). In the case of IMM, the times of first detection varied from 14 to 28 days. Maximum CFA (2(-8)), DA (2(-8)), IHA (2(-11)) and ELISA (2(-16)) titres were reached from 42 to 49 days with significantly higher values occurring in the OR and IP groups. With IMM, maxima occurred after 5 or 6 weeks. Following exposure, two- to five-fold significant increases in serum lysozyme levels were demonstrated but the concentrations in sera following SC, IP or OR routes of antigen administration were not significantly different when the groups were compared with each other. The highest lysozyme values (approximately 12.3 - 12.5 micrograms ml(-1)) were found in the SC and OR groups when compared to the IP (7.40 micrograms ml(-1)).

  12. Life History of the Camelthorn Gall Leafhopper, Scenergates viridis (Vilbaste (Hemiptera, Cicadellidae

    Directory of Open Access Journals (Sweden)

    Roman Rakitov

    2012-01-01

    Full Text Available The world’s only member of Hemiptera Auchenorrhyncha known to form true galls, the leafhopper Scenergates viridis (Vilbaste (Cicadellidae, transforms leaves of camelthorn (Alhagi maurorum Medikus, Fabaceae into pod-like chambers, up to 35 mm long, inside which individual leafhoppers develop, mate, and lay eggs. At the study site 40 km SE of Bukhara (Uzbekistan, two generations develop annually. First-instar nymphs cause young leaves to fold along the midrib. The subsequent development takes place inside the tightly closed growing gall, plugged at both ends with a mixture of leafhopper excrement, brochosomes, and crushed exuviae. These plugs act as mechanical barriers and sticky traps for intruders. The inner surface of the gall, lined with brochosomes and wax platelets, is hydrophobic. Adult males emerge from their galls and squeeze into female galls. Fertilized females insert an average of 146 eggs under the gall’s inner epidermis and remain inside, possibly protecting the brood, until they die. The walls of the galls containing eggs are approximately three times thicker than regular leaves. The galls are subject to predation by Gelechiidae caterpillars; the eggs of the leafhopper are parasitized by two species of Trichogrammatidae and one Mymaridae (Hymenoptera, and its larvae by one species of Pipunculidae (Diptera.

  13. Establishing the thermal threshold of the tropical mussel Perna viridis in the face of global warming.

    Science.gov (United States)

    Goh, B P L; Lai, C H

    2014-08-30

    With increasing recognition that maximum oxygen demand is the unifying limit in tolerance, the first line of thermal sensitivity is, as a corollary, due to capacity limitations at a high level of organisational complexity before individual, molecular or membrane functions become disturbed. In this study the tropical mussel Perna viridis were subjected to temperature change of 0.4 °C per hour from ambient to 8-36 °C. By comparing thermal mortality against biochemical indices (hsp70, gluthathione), physiological indices (glycogen, FRAP, NRRT) and behavioural indices (clearance rate), a hierarchy of thermal tolerance was therein elucidated, ranging from systemic to cellular to molecular levels. Generally, while biochemical indices indicated a stress signal much earlier than the more integrated behavioural indices, failure of the latter (indicating a tolerance limit and transition to pejus state) occurred much earlier than the other indices tending towards thermal extremities at both ends of the thermal spectrum. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Inter-population thermal variability and physiological response in the intertidal fish Scartichthys viridis (Blenniidae Variabilidad térmica intrapoblacional y respuesta fisiológica en el pez intermareal Scartichthys viridis (Blenniidae

    Directory of Open Access Journals (Sweden)

    JOSÉ M PULGAR

    2007-12-01

    Full Text Available Determining habitat conditions that generate individual physiological variability represents key basic knowledge to understand the direction of animal's responses to habitat change. The coastal fish Scartichthys viridis inhabits low intertidal pools along the Chilean coast. Because seawater in the low intertidal is renewed during every tidal cycle, this zone is characterized by a low thermal variation and abundant food within and between localities. We evaluated whether seawater thermal conditions and food availability of low intertidal pools registered in three localities of Chilean coast are sufficient to generate physiological and energetic differences in individuals of S. viridis captured from three geographic separate populations spanning approximately 1,200 km. Southern fishes acclimatized to 25 °C showed higher metabolic rates than those from other localities and thermal treatments. On the other hand, southern fishes in natural conditions showed higher condition factor than northern fishes. This evidence is sufficient to indicate that slight latitudinal differences in tidepool seawater temperature associated to differential food availability induced an energetic constraint in this species. Moreover, southern population of S. viridis may suffer important effects on energetic allocation if seawater temperature increases slightly, with repercussions on its geographic distribution in southern Pacific OceanDeterminar las condiciones del ambiente que generan variabilidad fisiológica, representa un conocimiento básico para comprender el sentido de la respuesta de los animales a los cambios en su habitat. El pez costero Scartichthys viridis habita las pozas bajas del intermareal a lo largo de la costa chilena. Debido a que el agua de mar se renueva en cada ciclo de marea en las pozas bajas, esta zona está caracterizada por una baja variación térmica y abundante alimento entre localidades. Nosotros evaluamos si las condiciones térmicas y la

  15. Crecimiento y supervivencia de los mejillones Perna perna, Perna viridis y de un morfotipo indefinido bajo cultivo suspendido

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available Se evaluaron el crecimiento y la influencia de factores ambientales bajo condiciones de cultivo suspendido del mejillón Perna perna L., P. viridis L. y una variante o morfotipo indefinido, que comparte sustrato y características morfológicas y de color de ambas especies. El estudio fue conducido durante 10 meses en la localidad de Turpialito, Golfo de Cariaco, Venezuela. Las tres poblaciones experimentales, sembradas con una talla inicial homogénea (45–50 mm presentaron un patrón de crecimiento similar; sin embargo, P. viridis mostró tasas de crecimiento significativamente menores a las de P. perna y del morfotipo, alcanzando al final del estudio 71.2, 77.0 y 77.8 mm de longitud dorso-ventral de la concha, respectivamente. Los análisis de correlatividad de los factores ambientales y el crecimiento no mostraron una modulación definida del crecimiento somático debido a factores ambientales; no obstante, la actividad reproductiva, especialmente cuando se inicia por primera vez, puede actuar como factor endógeno negativo. Aunque los resultados muestran similar respuesta fisiológica de los mejillones, se observó mayor similitud entre P. perna y el morfotipo y diferencias suficientes entre éstas y P. viridis, sugiriendo que las dos primeras pueden estar más relacionadas genéticamente. Sin embargo, existieron diferencias entre el morfotipo y P. perna, en cuanto a las características fenotípicas de la concha, supervivencia e índice gonadosomático, que pueden establecer diferencias genéticas definidas. La mayor producción gonádica en la variante sugiere su selección para el cultivo.

  16. Characterization of small HSPs from Anemonia viridis reveals insights into molecular evolution of alpha crystallin genes among cnidarians.

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    Full Text Available Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.

  17. Atomic Simulation of Complex DNA DSBs and the Interactions with the Ku70/80 Heterodimer

    Science.gov (United States)

    Hu, Shaowen; Cucinotta, Francis A.

    2011-01-01

    DNA double strand breaks (DSBs) induced by ionizing radiation (IR) usually contain modified bases such as 8-oxo-7,8-dihydroguanine (8-oxoG) and thymine glycol, apurinic/apyrimidinic (AP) sites, 2-deoxyribonolactone, or single-strand breaks (SSBs). The presence of such lesions in close proximity to the DSB terminus makes the DNA nicks more difficult to repair and rejoin than endogenously induced simple DSBs, and as such a major determinant of the biological effects of high linear energy transfer (LET) radiation as encountered in space travel. In this study we conducted molecular dynamics simulations on a series of DNA duplexes with various complex lesions of 8-oxoG and AP sites, in an effort to investigate the effects of such lesions to the structural integrity and stability of DNA after insulted by IR. We also simulated the interaction of such complex DSBs with the Ku70/80 heterodimer, the first protein in mammalian cells to embark the non-homologous end joining (NHEJ) DNA repair pathway. The results indicate, compared to DNA with simple DSBs, the complex lesions can enhance the hydrogen bonds opening rate at the DNA terminus, and increase the mobility of the whole duplex, thus they present more deleterious effects to the genome integrity if not captured and repaired promptly in cells. Simulations also demonstrate the binding of Ku drastically reduces structural disruption and flexibility caused by the complex lesions, and the interactions of Ku with complex DSBs have a different potential energy landscape from the bound structure with simple DSB. In all complex DSBs systems, the binding of DSB terminus with Ku70 is softened while the binding of the middle duplex with Ku80 is tightened. This energy shift may help the Ku protein to secure at the DSB terminus for a longer time, so that other end processing factors or repair pathways can proceed at the lesions before NHEJ repair process starts. These atomic simulations may provide valuable new insight into the

  18. Structural Basis of the Heterodimer Formation between Cell Shape-Determining Proteins Csd1 and Csd2 from Helicobacter pylori.

    Directory of Open Access Journals (Sweden)

    Doo Ri An

    Full Text Available Colonization of the human gastric mucosa by Helicobacter pylori requires its high motility, which depends on the helical cell shape. In H. pylori, several genes (csd1, csd2, csd3/hdpA, ccmA, csd4, csd5, and csd6 play key roles in determining the cell shape by alteration of cross-linking or by trimming of peptidoglycan stem peptides. H. pylori Csd1, Csd2, and Csd3/HdpA are M23B metallopeptidase family members and may act as d,d-endopeptidases to cleave the d-Ala4-mDAP3 peptide bond of cross-linked dimer muropeptides. Csd3 functions also as the d,d-carboxypeptidase to cleave the d-Ala4-d-Ala5 bond of the muramyl pentapeptide. To provide a basis for understanding molecular functions of Csd1 and Csd2, we have carried out their structural characterizations. We have discovered that (i Csd2 exists in monomer-dimer equilibrium and (ii Csd1 and Csd2 form a heterodimer. We have determined crystal structures of the Csd2121-308 homodimer and the heterodimer between Csd1125-312 and Csd2121-308. Overall structures of Csd1125-312 and Csd2121-308 monomers are similar to each other, consisting of a helical domain and a LytM domain. The helical domains of both Csd1 and Csd2 play a key role in the formation of homodimers or heterodimers. The Csd1 LytM domain contains a catalytic site with a Zn2+ ion, which is coordinated by three conserved ligands and two water molecules, whereas the Csd2 LytM domain has incomplete metal ligands and no metal ion is bound. Structural knowledge of these proteins sheds light on the events that regulate the cell wall in H. pylori.

  19. Mortalities of the Green Toad (Epidalea viridis (Laurenti, 1768 in Urban Environment: A Case Study from the City of Plovdiv

    Directory of Open Access Journals (Sweden)

    Miglena V. Valkanova

    2009-08-01

    Full Text Available The current study analyzes the types of mortalities of the green toad (Epidalea viridis in the city of Plovdiv. Among all recorded mortalities (n=42, the road kill was the most common cause of death (65 % of the cases, followed by killing by humans (usually children – 31%. Killing of green toads by dogs (2% and domestic cats (2% has the lowest impact. Both most significant factors (road kill and killing by humans affect mainly the adult specimens. No statistically significant difference between the mortalities of the two sexes was detected.

  20. Disseminated Mycosis in Veiled Chameleons (Chamaeleo calyptratus) Caused by Chamaeleomyces granulomatis, a New Fungus Related to Paecilomyces viridis

    DEFF Research Database (Denmark)

    Sigler, Lynne; Gibas, Connie Fe C.; Kokotovic, Branko

    2010-01-01

    An outbreak of disseminated granulomatous disease occurred in a group of veiled chameleons (Chamaeleo calyptratus) in a zoo collection. An adult female and six offspring developed large granulomas in multiple organs and were euthanized. At necropsy, roughly spherical yellow-to-white nodules 1 to 3...... of morphology results to represent Paecilomyces viridis, a species known only from one outbreak of fatal mycosis in carpet chameleons (Furcifer lateralis). Data obtained from morphological studies and from phylogenetic analyses of nuclear ribosomal rRNA (rDNA) sequence data revealed the Danish chameleon....... Chamaeleomyces species appear to be rare but aggressive pathogens of chameleons....

  1. Drosophila molting neurohormone bursicon is a heterodimer and the natural agonist of the orphan receptor DLGR2

    DEFF Research Database (Denmark)

    Mendive, Fernando M; Van Loy, Tom; Claeysen, Sylvie

    2005-01-01

    Bursicon is a neurohumoral agent responsible for tanning and hardening of the cuticle and expansion of the wings during the final phase of insect metamorphosis. Although the hormonal activity was described more than 40 years ago, the molecular nature of bursicon has remained elusive. We identify...... here Drosophila bioactive bursicon as a heterodimer made of two cystine knot polypeptides. This conclusion was reached in part from the unexpected observation that in the genome of the honey bee, the orthologs of the two Drosophila proteins are predicted to be fused in a single open reading frame...

  2. Behavioural and neurotoxic effects of ayahuasca infusion (Banisteriopsis caapi and Psychotria viridis) in female Wistar rat.

    Science.gov (United States)

    Pic-Taylor, Aline; da Motta, Luciana Gueiros; de Morais, Juliana Alves; Junior, Willian Melo; Santos, Alana de Fátima Andrade; Campos, Leandro Ambrósio; Mortari, Marcia Renata; von Zuben, Marcus Vinicius; Caldas, Eloisa Dutra

    2015-09-01

    Ayahuasca, a psychoactive beverage used by indigenous and religious groups, is generally prepared by the coction of Psychotria viridis and Banisteriopsis caapi plants containing N,N-dimethyltryptamine (DMT) and β-carboline alkaloids, respectively. To investigate the acute toxicity of ayahuasca, the infusion was administered by gavage to female Wistar rats at doses of 30X and 50X the dose taken during a religious ritual, and the animals observed for 14 days. Behavioural functions were investigated one hour after dosing at 15X and 30X using the open field, elevated plus maze, and forced swimming tests. Neuronal activation (c-fos marked neurons) and toxicity (Fluoro-Jade B and Nissl/Cresyl staining) were investigated in the dorsal raphe nuclei (DRN), amygdaloid nucleus, and hippocampal formation brain areas of rats treated with a 30X ayahuasca dose. The actual lethal oral dose in female Wistar rats could not be determined in this study, but was shown to be higher than the 50X (which corresponds to 15.1mg/kg bw DMT). The ayahuasca and fluoxetine treated groups showed a significant decrease in locomotion in the open field and elevated plus-maze tests compared to controls. In the forced swimming test, ayahuasca treated animals swam more than controls, a behaviour that was not significant in the fluoxetine group. Treated animals showed higher neuronal activation in all brain areas involved in serotoninergic neurotransmission. Although this led to some brain injury, no permanent damage was detected. These results suggest that ayahuasca has antidepressant properties in Wistar female at high doses, an effect that should be further investigated. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Comparative genome scan detects host-related divergent selection in the grasshopper Hesperotettix viridis.

    Science.gov (United States)

    Apple, Jennifer L; Grace, Tony; Joern, Anthony; St Amand, Paul; Wisely, Samantha M

    2010-09-01

    In this study, we used a comparative genome scan to examine patterns of population differentiation with respect to host plant use in Hesperotettix viridis, a Nearctic oligophagous grasshopper locally specialized on various Asteraceae including Solidago, Gutierrezia, and Ericameria. We identified amplified fragment length polymorphism (AFLP) loci with significantly elevated F(ST) (outlier loci) in multiple different-host and same-host comparisons of populations while controlling for geographic distance. By comparing the number and identities of outlier loci in different-host vs. same-host comparisons, we found evidence of host plant-related divergent selection for some population comparisons (Solidago- vs. Gutierrezia-feeders), while other comparisons (Ericameria- vs. Gutierrezia-feeders) failed to demonstrate a strong role for host association in population differentiation. In comparisons of Solidago- vs. Gutierrezia-feeding populations, a relatively high number of outlier loci observed repeatedly in different-host comparisons (35% of all outliers and 2.7% of all 625 AFLP loci) indicated a significant role for host-related selection in contributing to overall genomic differentiation in this grasshopper. Mitochondrial DNA sequence data revealed a star-shaped phylogeny with no host- or geography-related structure, low nucleotide diversity, and high haplotype diversity, suggesting a recent population expansion. mtDNA data do not suggest a long period of isolation in separate glacial refugia but are instead more compatible with a single glacial refugium and more recent divergence in host use. Our study adds to research documenting heterogeneity in differentiation across the genome as a consequence of divergent natural selection, a phenomenon that may occur as part of the process of ecological speciation. © 2010 Blackwell Publishing Ltd.

  4. Reactions of green lizards (Lacerta viridis) to major repellent compounds secreted by Graphosoma lineatum (Heteroptera: Pentatomidae).

    Science.gov (United States)

    Gregorovičová, Martina; Černíková, Alena

    2015-06-01

    The chemical defence of Heteroptera is primarily based on repellent secretions which signal the potential toxicity of the bug to its predators. We tested the aversive reactions of green lizards (Lacerta viridis) towards the major compounds of the defensive secretion of Graphosoma lineatum, specifically: (i) a mixture of three aldehydes: (E)-hex-2-enal, (E)-oct-2-enal, (E)-dec-2-enal; (ii) a mixture of these three aldehydes and tridecane; (iii) oxoaldehyde: (E)-4-oxohex-2-enal; (iv) secretion extracted from metathoracic scent glands of G. lineatum adults and (v) hexane as a non-polar solvent. All chemicals were presented on a palatable food (Tenebrio molitor larvae). The aversive reactions of the green lizards towards the mealworms were evaluated by observing the approach latencies, attack latencies and approach-attack intervals. The green lizards exhibited a strong aversive reaction to the mixture of three aldehydes. Tridecane reduced the aversive reaction to the aldehyde mixture. Oxoaldehyde caused the weakest, but still significant, aversive reaction. The secretion from whole metathoracic scent glands also clearly had an aversive effect on the green lizards. Moreover, when a living specimen of G. lineatum or Pyrrhocoris apterus (another aposematic red-and-black prey) was presented to the green lizards before the trials with the aldehyde mixture, the aversive effect of the mixture was enhanced. In conclusion, the mixture of three aldehydes had the strong aversive effect and could signal the potential toxicity of G. lineatum to the green lizards. Copyright © 2015 Elsevier GmbH. All rights reserved.

  5. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis).

    Science.gov (United States)

    Horváth, Gergely; Mészáros, Boglárka; Urszán, Tamás János; Bajer, Katalin; Molnár, Orsolya; Garamszegi, László Zsolt; Herczeg, Gábor

    2017-01-01

    Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality) or across multiple (behavioural syndrome) behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age) and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body condition, physiological performance) and expected to be affected by short-term environmental change. Yet, whether short-term environmental shifts affect behavioural consistency during adulthood remains questionable. Here, by employing a full-factorial laboratory experiment, we explored if quantity of food (low vs. high) and time available for thermoregulation (3h vs. 10h per day) had an effect on activity and risk-taking of reproductive adult male European green lizards (Lacerta viridis). We focussed on different components of behavioural variation: (i) strength of behavioural consistency (repeatability for animal personality; between-individual correlation for behavioural syndrome), (ii) behavioural type (individual mean behaviour) and (iii) behavioural predictability (within-individual behavioural variation). Activity was repeatable in all treatments. Risk-taking was repeatable only in the low basking treatments. We found significant between-individual correlation only in the low food × long basking time group. The treatments did not affect behavioural type, but affected behavioural predictability. Activity predictability was higher in the short basking treatment, where it also decreased with size (≈ age). Risk-taking predictability in the short basking treatment increased with size under food limitation, but decreased when food supply was high. We conclude that short-term environmental change can alter various components of behavioural consistency. The effect could be

  6. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis.

    Directory of Open Access Journals (Sweden)

    Gergely Horváth

    Full Text Available Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality or across multiple (behavioural syndrome behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body condition, physiological performance and expected to be affected by short-term environmental change. Yet, whether short-term environmental shifts affect behavioural consistency during adulthood remains questionable. Here, by employing a full-factorial laboratory experiment, we explored if quantity of food (low vs. high and time available for thermoregulation (3h vs. 10h per day had an effect on activity and risk-taking of reproductive adult male European green lizards (Lacerta viridis. We focussed on different components of behavioural variation: (i strength of behavioural consistency (repeatability for animal personality; between-individual correlation for behavioural syndrome, (ii behavioural type (individual mean behaviour and (iii behavioural predictability (within-individual behavioural variation. Activity was repeatable in all treatments. Risk-taking was repeatable only in the low basking treatments. We found significant between-individual correlation only in the low food × long basking time group. The treatments did not affect behavioural type, but affected behavioural predictability. Activity predictability was higher in the short basking treatment, where it also decreased with size (≈ age. Risk-taking predictability in the short basking treatment increased with size under food limitation, but decreased when food supply was high. We conclude that short-term environmental change can alter various components of behavioural consistency. The effect could be

  7. Biological Carbon Dioxide Assimilation Process Using Marine Phytoplankton Tetraselmis suecica and Bivalve Perna viridis

    Directory of Open Access Journals (Sweden)

    Sirichai Dharmvanij

    2012-01-01

    Full Text Available The Biological CO2 assimilation process using marine phytoplankton and marine bivalve was evaluated by carbon assimilation of the green mussel Perna viridis fed with Tetraselmis suecica under laboratory condition. Incorporation of carbon dioxide into phytoplankton biomass was performed through aeration. The experiment consisted of three treatments i.e. mussels without feeding (Control, mussels fed with T. suecica cultured with air (Treatment 1: T-Air, and mussels fed with T. suecica cultured with 1.5% CO2 in air (Treatment 2: T-CO2. The results showed that growth of mussels in T-Air and T-CO2 was 22.4 ± 4.0 mg/individual/day and 28.9 ± 12.3 mg/individual/day, respectively, which was significantly higher than control (mussels without feeding. Growth of mussels in T-Air was significantly lower than in T-CO2. Carbon content in shell (15.59 ± 0.57 % D.W. and meat (38.28 ± 1.72 % D.W. of mussels fed with aerated T. suecica (T-Air was significantly higher than that found in mussels fed with 1.5% CO2 T. suecica (14.2 ± 0.47 and 36.61± 0.43 % D.W. in shell and in meat, respectively (p≤0.05. With T-Air, 1.95±0.27 and 9.36±1.24% of carbon from T. suecica cells was assimilated into shell and meat of the mussel, respectively, while in T-CO2 , carbon assimilation from T. suecica cells in shell and meat was 2.19±0.55 and 11.22±2.76% respectively.

  8. ThWRKY4 from Tamarix hispida Can Form Homodimers and Heterodimers and Is Involved in Abiotic Stress Responses

    Directory of Open Access Journals (Sweden)

    Liuqiang Wang

    2015-11-01

    Full Text Available WRKY proteins are a large family of transcription factors that are involved in diverse developmental processes and abiotic stress responses in plants. However, our knowledge of the regulatory mechanisms of WRKYs participation in protein–protein interactions is still fragmentary, and such protein–protein interactions are fundamental in understanding biological networks and the functions of proteins. In this study, we report that a WRKY protein from Tamarix hispida, ThWRKY4, can form both homodimers and heterodimers with ThWRKY2 and ThWRKY3. In addition, ThWRKY2 and ThWRKY3 can both bind to W-box motif with binding affinities similar to that of ThWRKY4. Further, the expression patterns of ThWRKY2 and ThWRKY3 are similar to that of ThWRKY4 when plants are exposed to abscisic acid (ABA. Subcellular localization shows that these three ThWRKY proteins are nuclear proteins. Taken together, these results demonstrate that ThWRKY4 is a dimeric protein that can form functional homodimers or heterodimers that are involved in abiotic stress responses.

  9. ThWRKY4 from Tamarix hispida Can Form Homodimers and Heterodimers and Is Involved in Abiotic Stress Responses.

    Science.gov (United States)

    Wang, Liuqiang; Zheng, Lei; Zhang, Chunrui; Wang, Yucheng; Lu, Mengzhu; Gao, Caiqiu

    2015-11-13

    WRKY proteins are a large family of transcription factors that are involved in diverse developmental processes and abiotic stress responses in plants. However, our knowledge of the regulatory mechanisms of WRKYs participation in protein-protein interactions is still fragmentary, and such protein-protein interactions are fundamental in understanding biological networks and the functions of proteins. In this study, we report that a WRKY protein from Tamarix hispida, ThWRKY4, can form both homodimers and heterodimers with ThWRKY2 and ThWRKY3. In addition, ThWRKY2 and ThWRKY3 can both bind to W-box motif with binding affinities similar to that of ThWRKY4. Further, the expression patterns of ThWRKY2 and ThWRKY3 are similar to that of ThWRKY4 when plants are exposed to abscisic acid (ABA). Subcellular localization shows that these three ThWRKY proteins are nuclear proteins. Taken together, these results demonstrate that ThWRKY4 is a dimeric protein that can form functional homodimers or heterodimers that are involved in abiotic stress responses.

  10. HUBUNGAN KEKERABATAN BEBERAPA POPULASI KERANG HIJAU (Perna viridis DI INDONESIA BERDASARKAN SEKUEN CYTROCROME B mtDNA

    Directory of Open Access Journals (Sweden)

    Achmad Sudradjat

    2016-11-01

    Full Text Available Penelitian ini dilakukan untuk mengetahui hubungan kekerabatan stok kerang hijau (Perna viridis di beberapa perairan Indonesia sebagai informasi dasar bagi program pemuliaan. Sampel kerang hijau yang berasal dari populasi alam perairan Tanjung Kait, Kamal, Panimbang, Cirebon, Pasuruan, Kenjeran, dan Pangkep diambil secara acak. Amplifikasi PCR dan sekuensing mitokondria daerah cytochrome B adalah HCO (F: 5’-TAA ACT TCA GGG TGA CCA AAA AAT CA-3’ (26 bp dan LCO (R: 5’-GGT CAA CAA ATC ATA AAG ATA TTG G-3’ (25 bp. Sekuen DNA yang diperoleh digunakan untuk analisis homologi, analisis genetic distance dan analisis kekerabatan. Hasil analisis homologi susunan nukleotida berdasarkan BLAST-N terhadap sekuen mtDNA Perna viridis yang tersimpan di Genebank menunjukkan similaritas 97%. Hasil analisis didapatkan jarak genetik yang terdekat adalah populasi Tanjung Kait dengan Kenjeran sedangkan jarak genetik terjauh adalah populasi Cirebon dengan Kamal. Hubungan kekerabatan yang ditunjukkan dengan dendrogram diperoleh 2 kelompok yaitu 6 populasi membentuk satu kelompok dan populasi Cirebon membentuk kluster tersendiri. Sekuens tersebut mungkin dapat digunakan sebagai penanda dalam program breeding kerang hijau di Indonesia

  11. Molecular identification of Sarcocystis spp. helped to define the origin of green pythons (Morelia viridis) confiscated in Germany.

    Science.gov (United States)

    Moré, Gastón; Pantchev, Nikola; Herrmann, Daland C; Vrhovec, Majda Globokar; Öfner, Sabine; Conraths, Franz J; Schares, Gereon

    2014-04-01

    Sarcocystis spp. represent apicomplexan parasites. They usually have a heteroxenous life cycle. Around 200 species have been described, affecting a wide range of animals worldwide, including reptiles. In recent years, large numbers of reptiles have been imported into Europe as pets and, as a consequence, animal welfare and species protection issues emerged. A sample of pooled feces from four confiscated green pythons (Morelia viridis) containing Sarcocystis spp. sporocysts was investigated. These snakes were imported for the pet trade and declared as being captive-bred. Full length 18S rRNA genes were amplified, cloned into plasmids and sequenced. Two different Sarcocystis spp. sequences were identified and registered as Sarcocystis sp. from M. viridis in GenBank. Both showed a 95-97% sequence identity with the 18S rRNA gene of Sarcocystis singaporensis. Phylogenetic analysis positioned these sequences together with other Sarcocystis spp. from snakes and rodents as definitive and intermediate hosts (IH), respectively. Sequence data and also the results of clinical and parasitological examinations suggest that the snakes were definitive hosts for Sarcocystis spp. that circulate in wild IH. Thus, it seems unlikely that the infected snakes had been legally bred. Our research shows that information on the infection of snakes with Sarcocystis spp. may be used to assess compliance with regulations on the trade with wildlife species.

  12. The solute specificity profiles of nucleobase cation symporter 1 (NCS1) from Zea mays and Setaria viridis illustrate functional flexibility.

    Science.gov (United States)

    Rapp, Micah; Schein, Jessica; Hunt, Kevin A; Nalam, Vamsi; Mourad, George S; Schultes, Neil P

    2016-03-01

    The solute specificity profiles (transport and binding) for the nucleobase cation symporter 1 (NCS1) proteins, from the closely related C4 grasses Zea mays and Setaria viridis, differ from that of Arabidopsis thaliana and Chlamydomonas reinhardtii NCS1. Solute specificity profiles for NCS1 from Z. mays (ZmNCS1) and S. viridis (SvNCS1) were determined through heterologous complementation studies in NCS1-deficient Saccharomyces cerevisiae strains. The four Viridiplantae NCS1 proteins transport the purines adenine and guanine, but unlike the dicot and algal NCS1, grass NCS1 proteins fail to transport the pyrimidine uracil. Despite the high level of amino acid sequence similarity, ZmNCS1 and SvNCS1 display distinct solute transport and recognition profiles. SvNCS1 transports adenine, guanine, hypoxanthine, cytosine, and allantoin and competitively binds xanthine and uric acid. ZmNCS1 transports adenine, guanine, and cytosine and competitively binds, 5-fluorocytosine, hypoxanthine, xanthine, and uric acid. The differences in grass NCS1 profiles are due to a limited number of amino acid alterations. These amino acid residues do not correspond to amino acids essential for overall solute and cation binding or solute transport, as previously identified in bacterial and fungal NCS1, but rather may represent residues involved in subtle solute discrimination. The data presented here reveal that within Viridiplantae, NCS1 proteins transport a broad range of nucleobase compounds and that the solute specificity profile varies with species.

  13. ARCTIC-ANTARCTIC DISJUNCTIONS IN THE BENTHIC SEAWEEDS ACROSIPHONIA-ARCTA (CHLOROPHYTA) AND DESMARESTIA-VIRIDIS-WILLII (PHAEOPHYTA) ARE OF RECENT ORIGIN

    NARCIS (Netherlands)

    VANOPPEN, MJH; OLSEN, JL; STAM, WT; VANDENHOEK, C; WIENCKE, C

    Two examples of the most extreme biogeographic disjunctions in benthic marine algae are found in Acrosiphonia arcta (Chlorophyta) and Desmarestia viridis/willii (Phaeophyta). Both species are members of the Arctic and Antarctic boreal and subboreal marine floras. Although both genera have temperate

  14. [Effects of ablation of the hindlimb on the organization of the ventral horn of the spinal cord in the lumbar region of green lizard embryos (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Clairambault, P

    1978-01-01

    After extirpation of an hind limb in embryos of Lacerta viridis, numerous motor neuroblasts degenerate on the operated side, in the ventral horn of the lumbar spinal cord and the corresponding motor column is reduced or disappears. The lumbar spinal ganglia are affected and reduced on the operated side.

  15. [Ultrastructural characteristics of several constituants of limb buds in the embryos of the slowworm (Anguis fragilis L.) and the green lizard (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-06-09

    Ultrastructural characteristics of the cells of the apical crest, of the mesoblast and of the ventral processes of somites, in the anlage of the anterior limb buds of embryos of the slow-worm (Anguis fragilis) and of the green lizard (Lacerta viridis) are described at early stages of the development. Differences between the two species studied are brought to light.

  16. N2 fixing alder (Alnus viridis spp.fruticosa) effects on soil properties across a secondary successional chronosequence in interior Alaska

    Science.gov (United States)

    Jennifer S. Mitchell; Roger W. Ruess

    2009-01-01

    Green alder (Alnus viridis ssp. fruticosa) is a dominant understory shrub during secondary successional development of upland forests throughout interior Alaska, where it contributes substantially to the nitrogen (N) economy through atmospheric N2 fixation. Across a replicated 200+ year old vegetation...

  17. Sédentarité, déplacements et répartition des individus dans une population de Lacerta viridis (Laurenti, 1768) (Lacertilia, Lacertidae)

    NARCIS (Netherlands)

    Girons, Saint H.; Bradshaw, S.D.

    1989-01-01

    A mark-and-recapture study was undertaken in August 1983, May and September 1987, and May 1988 of a small discrete population of Lacerta viridis occupying an area of 260 x 11—25 m, along the length of a canal in western France. A total of 21 recaptures, over periods of time varying from four months

  18. KARP-1 works as a heterodimer with Ku70, but the function of KARP-1 cannot perfectly replace that of Ku80 in DSB repair.

    Science.gov (United States)

    Koike, Manabu; Yutoku, Yasutomo; Koike, Aki

    2011-10-01

    Ku, the heterodimer of Ku70 and Ku80, plays an essential role in the DNA double-strand break (DSB) repair pathway, i.e., non-homologous end-joining (NHEJ). Two isoforms of Ku80 encoded by the same genes, namely, Ku80 and KARP-1 are expressed and function in primate cells, but not in rodent cells. Ku80 works as a heterodimer with Ku70. However, it is not yet clear whether KARP-1 forms a heterodimer with Ku70 and works as a heterodimer. Although KARP-1 appears to work in NHEJ, its physiological role remains unclear. In this study, we established and characterized EGFP-KARP-1-expressing xrs-6 cell lines, EGFP-KARP-1/xrs-6. We found that nuclear localization signal (NLS) of KARP-1 is localized in the C-terminal region. Our data showed that KARP-1 localizes within the nucleus in NLS-dependent and NLS-independent manner and forms a heterodimer with Ku70, and stabilizes Ku70. On the other hand, EGFP-KARP-1 could not perfectly complement the radiosensitivity and DSB repair activity of Ku80-deficient xrs-6 cells. Furthermore, KARP-1 could not accumulate at DSBs faster than Ku80, although EGFP-KARP-1 accumulates at DSBs. Our data demonstrate that the function of KARP-1 could not perfectly replace that of Ku80 in DSB repair, although KARP-1 has some biochemical properties, which resemble those of Ku80, and works as a heterodimer with Ku70. On the other hand, the number of EGFP-KARP-1-expressing xrs-6 cells showing pan-nuclear γ-H2AX staining significantly increases following X-irradiation, suggesting that KARP-1 may have a novel role in DSB response. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. Rexinoid Bexarotene Modulates Triglyceride but not Cholesterol Metabolism via Gene-Specific Permissivity of the RXR/LXR Heterodimer in the Liver

    DEFF Research Database (Denmark)

    Lalloyer, Fanny; Pedersen, Thomas Åskov; Gross, Barbara

    2009-01-01

    OBJECTIVE: Bexarotene (Targretin) is a clinically used antitumoral agent which exerts its action through binding to and activation of the retinoid-X-receptor (RXR). The most frequent side-effect of bexarotene administration is an increase in plasma triglycerides, an independent risk factor...... controlling cholesterol homeostasis. CONCLUSIONS: These findings demonstrate that the hypertriglyceridemic action of bexarotene occurs via the RXR/LXR heterodimer and show that RXR heterodimers can act with a selective permissivity on target genes of specific metabolic pathways in the liver....

  20. Assessing the herbivore role of the sea-urchin Echinometra viridis: Keys to determine the structure of communities in disturbed coral reefs.

    Science.gov (United States)

    Sangil, Carlos; Guzman, Hector M

    2016-09-01

    Echinometra viridis previously was considered a cryptic species unable to control the development and growth of macroalgae on coral reefs. Its role as a herbivore was seen as minor compared to other grazers present on the reef. However, the present disturbed state of some reefs has highlighted the role played by this sea-urchin. Combining field data with experiments on the Caribbean coast of Panama, we demonstrate that the current community organization on disturbed coral reefs in the Mesoamerican Caribbean is largely due to the action of E. viridis. It is the most abundant sea-urchin species, together with two others (Diadema antillarum and Echinometra lucunter). Field data also indicate that the relationship between its density and the abundance of macroalgae is stronger and it is more negative in impact than those of the other two. However, the niche this urchin exploits most efficiently is confined to leeward reefs with low levels of sedimentation. Outside these habitats, their populations are not decisive in controlling macroalgal growth. Grazing experiments showed that E. viridis consumes more fresh macroalgae per day and per weight of sea-urchin, and is a more effective grazer than D. antillarum or E. lucunter. E. viridis showed food preferences for early-successional turf macroalgae (Acanthophora spicifera), avoiding the less palatable late-successional and fleshy macroalgae (Lobophora variegata, Halimeda opuntia). However, it becomes a generalist herbivore feeding on all varieties of macroalgae when resources are scarce. H. opuntia is the macroalga that most resists E. viridis activity, which may explain its wide distribution. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Leaf oxygen and Carbon Isotopic Signatures Reflect Drought Resistance and Water Use Efficiency in the C4 Grass, Setaria viridis

    Science.gov (United States)

    Ellsworth, P.; Cousins, A. B.

    2014-12-01

    Low water availability is a major constraint in crop production, especially as agriculture is pushed to marginal lands. Therefore, improving drought resistance such as increasing water use efficiency (WUE) through plant breeding is needed to expand the range of soil water availability adequate for food production. With the goal of finding the genomic basis for WUE in C4 grasses, Setaria viridis makes an ideal model species because of its small size, short lifespan, and sequenced genome. Also it is part of the panicoid grass clade, which is one of the most important clades for food and biofuel production. In plant breeding programs, large numbers of genotypes must be quickly screened for drought resistance traits, but there is no well-defined method of screening for WUE in C4 grasses. However, bulk leaf oxygen (Δ18OBL) and carbon (δ13C) isotopic signatures have shown potential as recorders of transpiration rate (E) and stomatal conductance (gs), and combined with biomass production potentially serve as a measure of WUE. Values of Δ18OBL record differences in transpiration rate because leaf water becomes more enriched as transpiration rate decreases, and leaf tissue records the isotopic composition of leaf water in which it is synthesized. Additionally, in C4 plants δ13C values decrease as gs decreases but the change in δ13C in response to gs may not be adequate to tease apart differences in WUE. In this study, we grew S. viridis plants under well-watered and water-limited conditions to determine if Δ18OBL and δ13C could be used as proxies for E and gs, and be used to screen S. viridis for differences in WUE in breeding programs. The Δ18OBL and δ13C were significantly different between well-watered and water-limited plants and correlated with each other and with E, gs, and instantaneous water use efficiency (Anet/gs). Therefore, Δ18OBL and δ13C can be useful proxies to screen genotypes for drought resistance by recording differences in E, gs, and WUE

  2. Componentes bioquímicos de los tejidos de Perna perna y P. viridis (Lineo, 1758 (Bivalvia: Mytilidae, en relación al crecimiento en condiciones de cultivo suspendido Biochemical components of the tissues of Perna perna and P. viridis (Lineo, 1758 (Bivalvia: Mytilidae, in relation to the growth under conditions of suspended cultivation

    Directory of Open Access Journals (Sweden)

    Vanessa Acosta

    2010-01-01

    Full Text Available Se evaluó los cambios ocurridos en carbohidratos, proteínas y lípidos de la glándula digestiva, músculo y lóbulos gonadales de los mejillones Perna perna y P. viridis bajo condiciones de cultivo suspendido en el Golfo de Cariaco, Venezuela. Paralelamente, se llevaron registros de la condición reproductiva de ambas especies y de temperatura, clorofila a y seston. Los resultados muestraron que en los tejidos analizados de ambas especies, los lóbulos gonadales presentaron las mayores variaciones de los sustratos energéticos estudiados. La variación de los sustratos energéticos se explicó en ambos mejillones mediante desarrollo gonádico y la disponibilidad de alimento, particularmente clorofila a para P. perna y seston total para P. viridis. La temperatura fue un factor que afectó negativamente a P. viridis. Los contenidos de los diferentes sustratos energéticos observados en P. perna fueron más altos que en P. viridis, a lo largo de casi todo el periodo experimental, lo que indicó que esta especie mostró una mayor capacidad para explotar de manera más eficiente los recursos alimenticios presentes en las condiciones de cultivo suspendido.In the organisms, the variations of the biochemical composition of reproductive and somatic tissues in the growth permit to infer about its adaptative to environment. In the present study, we evaluate the changes observed in carbohydrates, lipids and proteins of digestive gland, muscle and gonad tissues of Perna perna and P. viridis, growing in suspended culture at Cariaco Gulf , Venezuela. The reproductive condition of both mussels and environmental factors (temperature, chlorophyll a and of the seston were determinate. The results show that, in both species, the gonadic lobes showed the highest variations in the biochemical component. The variations in the biochemical components were direct explained by the variations in the gonad development and the food availability, particularly chlorophyll a

  3. Metalotioninas en Perna viridis (Bivalvia: Mytilidae: variación estacional y su relación con la biología reproductiva Metallothioneins in Perna viridis (Bivalvia: Mytilidae: seasonal variation and its relation to reproductive biology

    Directory of Open Access Journals (Sweden)

    Mairin Lemus

    2013-06-01

    Full Text Available Las metalotioninas (Mts son proteínas de baja masa molecular que juegan un rol importante en la detoxificación de metales, en vista de su papel ecotoxicológico se evaluaron las metalotioneínas (MTs en 350 ejemplares del bivalvo Perna viridis en dos localidades de la costa norte del estado Sucre, desde febrero hasta diciembre 2003. Se determinaron los índices biométricos: índice de condición (IC, rendimiento de carne (RC y relación peso seco-talla (PSL. Las Mts fueron separadas por cromatografía de exclusión molecular, Sephadex G-50 y se cuantificaron por saturación con cadmio. Los índices biométricos (RC y PSL mostraron variaciones estacionales, entre localidades y estados de madurez, con la excepción del CI. No se encontraron diferencias significativas entre sexos. Las Mts mostraron variaciones estacionales, con concentraciones más elevadas entre febrero y marzo y mínimos entre septiembre y diciembre, que coincidieron con los períodos de alta y baja productividad en el área, respectivamente. Los mejillones de Río Caribe presentaron una mayor concentración de Mts que los de Chacopata. Los mejillones inmaduros mostraron la mayor concentración de Mts y la más baja en los desovados. Se encontró una relación negativa y significativa entre Mts y CI. Los resultados demuestran que las Mts de Perna viridis están influidas por el índice de condición y la condición reproductiva, asi como también pot los factores físico-químicos del ambiente marino.Metallothionein is a cytosolic protein found in a variety of tissues and have been involved in the regulation of essential trace metals such as copper and zinc, and in the detoxification of essential and nonessential metals. With the aim to study their seasonal variation and their possible role in reproductive behavior, we evaluated metallothioneins (Mts in Perna viridis, taken from Rio Caribe and Chacopata localities in the North coast of Sucre state, Venezuela. A total of 325

  4. c-Myc/Max heterodimers bind cooperatively to the E-box sequences located in the first intron of the rat ornithine decarboxylase (ODC) gene

    NARCIS (Netherlands)

    Walhout, A.J.M.; Gubbels, J.M.; Bernards, R.A.; Vliet, P.C. van der; Timmers, H.T.M.

    1997-01-01

    The oncoprotein c-Myc plays an important role in cell proliferation, transformation, inhibition of differentiation and apoptosis. These functions most likely result from the transcription factor activity of c-Myc. As a heterodimer with Max, the c-Myc protein binds to the E-box sequence (CACGTG),

  5. Temporal variations of heavy metals levels in Perna viridis, on the Chacopata-Bocaripo lagoon axis, Sucre State, Venezuela.

    Science.gov (United States)

    Pinto, Rafael; Acosta, Vanessa; Segnini, Mary Isabel; Brito, Leonor; Martínez, Gregorio

    2015-02-28

    Perna viridis was used as biomonitor to assess heavy metal levels in the Chacopata-Bocaripo lagoon axis, Venezuela, during rain and drought seasons. The mussels were weighed and measured. The metal concentrations were determined by atomic absorption spectrophotometry. For rain period, the order of bioavailability was: Cu>Ni>Mn>Co>Cd>Pb, and for drought: Cu>Mn>Ni>Co>Pb>Cd. The concentrations of Ni, Co, Cd and Pb showed significant differences (P<0.05) in both periods. There was higher metal accumulation during drought season, possibly related to upwelling, since it produces an increase in primary productivity, which translates more food into organisms, making metals bioavailable for mussels. Only Cu and Mn showed significant relationships between the size and metal concentration, during drought period, it may be because of the organisms need for these essential metals in different physiological processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Partially Purified Extracts of Sea Anemone Anemonia viridis Affect the Growth and Viability of Selected Tumour Cell Lines

    Directory of Open Access Journals (Sweden)

    Matteo Bulati

    2016-01-01

    Full Text Available In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis. Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human cancer cell lines. Our analysis revealed that the four fractions showed different protein contents and diverse patterns of activity towards human PBMC and cancer cell lines. Interestingly, fractions III and IV exerted cytotoxic effects on human cells. Conversely, fractions I and II displayed very low toxic effects associated with antiproliferative activities on cancer cell lines.

  7. Effect of body size on accumulation and distribution of 125I in the green mussel (Perna Viridis)

    International Nuclear Information System (INIS)

    Chen Shunhua; Shi Qiong; Zhao Xiaokui

    1997-10-01

    Effect of body size on accumulation and distribution of 125 I in the green mussel (Perna Viridis), has been studied. The results showed that concentration capacity of every part in smaller mussels was higher than that in larger ones. Concentration factors of 125 I in byssus (about 0.5 x 10 3 ∼1.5 x 10 3 ), the highest in all parts of the mussels, were 30∼200 times as that in soft tissues, 200∼600 times as that in feet, 600∼1000 times as that in shells. Although wet weight of byssus was no more than 1% of whole body's wet weight, the content of 125 I accumulated in it accounted for as high as 75% of total 125 I content. The relationship between concentration factor of 125 I in byssus and whole body's wet weight (or shell length) can be described as a negative power function. (16 refs., 2 figs., 3 tabs.)

  8. Qualitative Assessment and Management of Microplastics in Asian Green Mussels (Perna viridis Cultured in Bacoor Bay, Cavite, Phillipines

    Directory of Open Access Journals (Sweden)

    Cristian Ryan Argamino

    2016-07-01

    Full Text Available Microplastics (> 5 mm have gained popularity in research and the public eye in recent years. This is due to the fact that they contain persistent organic pollutants (POPs which pose potential risks to the environment and human health. Bivalves, which are filter feeders, are considered to be good indicators of marine pollution. In this preliminary study, Asian green mussel (Perna viridis, an example of edible bivalve, cultured in Bacoor Bay, Cavite, Philippines was subjected to qualitative analysis to determine the presence of microplastics. Through microscopic analysis, microplastics were found present in the acid-digested mussel soft tissue. A management program is suggested for policy makers and stakeholders to reduce the negative impact of microplastic pollution to both humans and the marine environment.

  9. Lectin cytochemical localisation of glycoconjugates in the olfactory system of the lizards Lacerta viridis and Podarcis sicula.

    Science.gov (United States)

    Franceschini, V; Lazzari, M; Ciani, F

    2000-07-01

    To investigate the presence of defined carbohydrate moieties on the cell surface of the olfactory and vomeronasal receptor cells and the projections of the latter into the olfactory bulbs, a lectin binding study was performed on the olfactory system of the lizards: Lacerta viridis and Podarcis sicula. Both lizards showed a high lectin binding for N-acetyl-glucosamine in the sensory neurons. The lectin binding patterns in Lacerta indicated that the main olfactory system possessed a moderate density of N-acetyl-galactosamine residues and detectable levels of galactose ones. The vomeronasal system on the other hand contained a high density of N-acetyl-galactosamine moieties and a moderate density of glucosamine ones. In Podarcis the main olfactory system and vomeronasal organ contained respectively detectable and moderate levels of galactose residues. The expression of specific glycoconjugates may be associated with outgrowth, guidance and fasciculation of olfactory and vomeronasal axons.

  10. Lophotrochozoan neuroanatomy: An analysis of the brain and nervous system of Lineus viridis(Nemertea using different staining techniques

    Directory of Open Access Journals (Sweden)

    Loesel Rudi

    2011-07-01

    Full Text Available Abstract Background The now thriving field of neurophylogeny that links the morphology of the nervous system to early evolutionary events relies heavily on detailed descriptions of the neuronal architecture of taxa under scrutiny. While recent accounts on the nervous system of a number of animal clades such as arthropods, annelids, and molluscs are abundant, in depth studies of the neuroanatomy of nemerteans are still wanting. In this study, we used different staining techniques and confocal laser scanning microscopy to reveal the architecture of the nervous system of Lineus viridis with high anatomical resolution. Results In L. viridis, the peripheral nervous system comprises four distinct but interconnected nerve plexus. The central nervous system consists of a pair of medullary cords and a brain. The brain surrounds the proboscis and is subdivided into four voluminous lobes and a ring of commissural tracts. The brain is well developed and contains thousands of neurons. It does not reveal compartmentalized neuropils found in other animal groups with elaborate cerebral ganglia. Conclusions The detailed analysis of the nemertean nervous system presented in this study does not support any hypothesis on the phylogenetic position of Nemertea within Lophotrochozoa. Neuroanatomical characters that are described here are either common in other lophotrochozoan taxa or are seemingly restricted to nemerteans. Since detailed descriptions of the nervous system of adults in other nemertean species have not been available so far, this study may serve as a basis for future studies that might add data to the unsettled question of the nemertean ground pattern and the position of this taxon within the phylogenetic tree.

  11. Analysis of [Gossypium capitis-viridis × (G.hirsutum × G.australe2] Trispecific Hybrid and Selected Characteristics.

    Directory of Open Access Journals (Sweden)

    Di Chen

    Full Text Available Speciation is always a contentious and challenging issue following with the presence of gene flow. In Gossypium, there are many valuable resources and wild diploid cotton especially C and B genome species possess some excellent traits which cultivated cotton always lacks. In order to explore character transferring rule from wild cotton to upland tetraploid cotton, the [G. capitis-viridis × (G. hirsutum × G. australe2] triple hybrid was synthesized by interspecies hybridization and chromosome doubling. Morphology comparisons were measured among this hybrid and its parents. It showed that trispecific hybrid F1 had some intermediate morphological characters like leaf style between its parents and some different characters from its parents, like crawl growth characteristics and two kind flower color. It is highly resistant to insects comparing with other cotton species by four year field investigation. By cytogenetic analysis, triple hybrid was further confirmed by meiosis behavior of pollen mother cells. Comparing with regular meiosis of its three parents, it was distinguished by the occurrence of polyads with various numbers of unbalanced microspores and finally generating various abnormal pollen grains. All this phenomenon results in the sterility of this hybrid. This hybrid was further identified by SSR marker from DNA molecular level. It showed that 98 selected polymorphism primers amplified effective bands in this hybrids and its parents. The genetic proportion of three parents in this hybrid is 47.8% from G. hirsutum, 14.3% from G. australe, 7.0% from G. capitis-viridis, and 30.9% recombination bands respectively. It was testified that wild genetic material has been transferred into cultivated cotton and this new germplasm can be incorporated into cotton breeding program.

  12. Egg parasitoids (Hymenoptera: Mymaridae and Trichogrammatidae) of the gall-making leafhopper Scenergates viridis (Hemiptera: Cicadellidae) from Uzbekistan, with taxonomic notes on the Palaearctic species of Aphelinoidea.

    Science.gov (United States)

    Rakitov, Roman; Triapitsyn, Serguei V

    2013-01-01

    A new species of the Aphelinoidea Girault (Hymenoptera: Trichogrammatidae), A. (Aphelinoidea) sariq Triapitsyn & Rakitov sp. n., is described from Uzbekistan. Both sexes were reared from eggs of the only known truly gall-making leafhopper, Scenergates viridis (Vilbaste), laid inside its galls on camelthorn, Alhagi maurorum Medikus; additional females were found dead inside the galls. Aphelinoidea sariq is the only known species of the nominate subgenus of Aphelinoidea whose body color is predominantly yellow. Taxonomic notes on other Palaearctic species of Aphelinoidea are provided; A. scythica Fursov, syn. n. is synonymized underA. (Aphelinoidea) turanica S. Trjapitzin. Another trichogrammatid, Par-acentrobia (Paracentrobia) sp., was reared from eggs of S. viridis in much smaller numbers. Also described from the same locality and host is Gonatocerus (Lymaenon) mitjaevi Triapitsyn & Rakitov sp. n. (Hymenoptera: Mymaridae).

  13. A case of massive infestation of a male green lizard Lacerta viridis/bilineata by castor bean tick Ixodes ricinus (Linnaeus, 1758):

    OpenAIRE

    Carretero, Miguel A.; Gomes, Veronika; Žagar, Anamarija

    2013-01-01

    Infestation by ticks affects several vertebrate groups, including reptiles. Castor bean tick Ixodes ricinus is the most widespread tick species. Here we report an impressive tick infestation of a male green lizard Lacerta viridis/bilineata found in 2012 in the vicinity of Bilpa cave in the Kolpa valley, Slovenia. Lizards as tick hosts can play an important role in the life cycle of I. ricinus and may also be potential vectors of Lyme disease. Zaprarazitiranost s klopi je pogost pojav pri v...

  14. [Electron microscopic study of the penetration and distribution of somitic cells in the mesoblast of the limb buds of reptiles (Anguis fragilis and Lacerta viridis)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-09-29

    Based on characteristics of mitochondria and on the amount of lipid inclusions, a distinction between somitic cells and mesoblastic somatopleural cells is possible, at the early stages of the development of the limb bud in Reptiles (Anguis fragilis and Lacerta viridis). The dislocation of the ventral processes of the somites and the localisation of the somitic cells in the mesoblast of the anterior limb buds could be studied.

  15. Autekologie lokální populace ještěrky zelené (\\kur{Lacerta viridis}) v Českém krasu.

    OpenAIRE

    BLAŽEK, David

    2013-01-01

    European green lizard (Lacerta viridis) is critically endangered species. Bohemian populations are usually isolated and with lower degree of genetical variability, which gives them a higher degree of vulnerability. Isolated populations are interesting because animals often live there under ultimate possible life conditions for given species, usually in original environment. For the sake of an effective protection of the species morfological, ethological and ecological data are necessary, as w...

  16. The duplicated B-class heterodimer model: whorl-specific effects and complex genetic interactions in Petunia hybrida flower development.

    Science.gov (United States)

    Vandenbussche, Michiel; Zethof, Jan; Royaert, Stefan; Weterings, Koen; Gerats, Tom

    2004-03-01

    In both Antirrhinum (Antirrhinum majus) and Arabidopsis (Arabidopsis thaliana), the floral B-function, which specifies petal and stamen development, is embedded in a heterodimer consisting of one DEFICIENS (DEF)/APETALA3 (AP3)-like and one GLOBOSA (GLO)/PISTILLATA (PI)-like MADS box protein. Here, we demonstrate that gene duplications in both the DEF/AP3 and GLO/PI lineages in Petunia hybrida (petunia) have led to a functional diversification of their respective members, which is reflected by partner specificity and whorl-specific functions among these proteins. Previously, it has been shown that mutations in PhDEF (formerly known as GREEN PETALS) only affect petal development. We have isolated insertion alleles for PhGLO1 (FLORAL BINDING PROTEIN1) and PhGLO2 (PETUNIA MADS BOX GENE2) and demonstrate unique and redundant properties of PhDEF, PhGLO1, and PhGLO2. Besides a full homeotic conversion of petals to sepals and of stamens to carpels as observed in phglo1 phglo2 and phdef phglo2 flowers, we found that gene dosage effects for several mutant combinations cause qualitative and quantitative changes in whorl 2 and 3 meristem fate, and we show that the PHDEF/PHGLO1 heterodimer controls the fusion of the stamen filaments with the petal tube. Nevertheless, when the activity of PhDEF, PhGLO1, and PhGLO2 are considered jointly, they basically appear to function as DEF/GLO does in Antirrhinum and to a lesser extent as AP3/PI in Arabidopsis. By contrast, our data suggest that the function of the fourth B-class MADS box member, the paleoAP3-type PETUNIA HYBRIDA TM6 (PhTM6) gene, differs significantly from the known euAP3-type DEF/AP3-like proteins; PhTM6 is mainly expressed in the developing stamens and ovary of wild-type flowers, whereas its expression level is upregulated in whorls 1 and 2 of an A-function floral mutant; PhTM6 is most likely not involved in petal development. The latter is consistent with the hypothesis that the evolutionary origin of the higher eudicot

  17. OCCURRENCE IN THE SOIL AND DISPERSAL OF Lecanicillium lecanii, A FUNGAL PATHOGEN OF THE GREEN COFFEE SCALE (Coccus viridis AND COFFEE RUST (Hemileia vastatrix

    Directory of Open Access Journals (Sweden)

    Doug William Jackson

    2012-08-01

    Full Text Available The fungus Lecanicillium lecanii attacks the green scale (Coccus viridis, a pest of coffee, and is also a hyperparasite of coffee rust (Hemileia vastatrix. Knowledge of the epizootiology of this fungus is potentially important for conservation biological control in coffee agroecosystems. The presence of viable propagules of L. lecanii in the soil, a possible environmental reservoir, was assessed using two baiting methods: the standard Galleria mellonella bait method and a C. viridis bait method. Infectious propagules of L. lecanii were detected in soil samples taken from a 45 ha study plot, both nearby and far from recent epizootics of L. lecanii. To test the potential for the transmission of L. lecanii conidia from the soil via rain splash or wind, coffee seedlings with populations of C. viridis were placed near L. lecanii-inoculated soil and then subjected to artificial rain and wind treatments. Rain splash was shown to be a potential transmission mechanism. Dispersal of L. lecanii conidia by the ant Azteca instabilis was tested using field and laboratory ant-exclusion experiments. Azteca instabilis was shown to transport conidia of L. lecanii; however, dispersal by A. instabilis may not be important under field conditions.

  18. Mapping of quantitative trait locus (QTLs) that contribute to germination and early seedling drought tolerance in the interspecific cross Setaria italica×Setaria viridis.

    Science.gov (United States)

    Qie, Lufeng; Jia, Guanqing; Zhang, Wenying; Schnable, James; Shang, Zhonglin; Li, Wei; Liu, Binhui; Li, Mingzhe; Chai, Yang; Zhi, Hui; Diao, Xianmin

    2014-01-01

    Drought tolerance is an important breeding target for enhancing the yields of grain crop species in arid and semi-arid regions of the world. Two species of Setaria, domesticated foxtail millet (S. italica) and its wild ancestor green foxtail (S. viridis) are becoming widely adopted as models for functional genomics studies in the Panicoid grasses. In this study, the genomic regions controlling germination and early seedling drought tolerance in Setaria were identified using 190 F7 lines derived from a cross between Yugu1, a S. italica cultivar developed in China, and a wild S. viridis genotype collected from Uzbekistan. Quantitative trait loci were identified which contribute to a number of traits including promptness index, radical root length, coleoptile length and lateral root number at germinating stage and seedling survival rate was characterized by the ability of desiccated seedlings to revive after rehydration. A genetic map with 128 SSR markers which spans 1293.9 cM with an average of 14 markers per linkage group of the 9 linkage groups was constructed. A total of eighteen QTLs were detected which included nine that explained over 10% of the phenotypic variance for a given trait. Both the wild green foxtail genotype and the foxtail millet cultivar contributed the favorite alleles for traits detected in this trial, indicating that wild Setaria viridis populations may serve as a reservoir for novel stress tolerance alleles which could be employed in foxtail millet breeding.

  19. Sub-lethal effects of cadmium and copper on RNA/DNA ratio and energy reserves in the green-lipped mussel Perna viridis.

    Science.gov (United States)

    Yeung, Jamius W Y; Zhou, Guang-Jie; Leung, Kenneth M Y

    2016-10-01

    This study aims to test if RNA/DNA ratio and various energy reserve parameters (i.e., glycogen, lipid, protein content and total energy reserves) are sensitive biomarkers for indicating stresses induced by metal contaminants in the green-lipped mussel Perna viridis, a common organism for biomonitoring in Southeast Asia. This study was, therefore, designed to examine the effects of cadmium (Cd) and copper (Cu) on these potential biomarkers in two major energy storage tissues, adductor muscle (AM) and hepatopancreas (HP), of P. viridis after sub-lethal exposure to either metal for 10 days. The results showed that neither Cd nor Cu treatments affected the RNA/DNA ratio, glycogen and protein contents in AM and HP. As the most sensitive biomarker in P. viridis, the total lipid content in both AM and HP was significantly decreased in the treatment of 5μg Cu/L and 0.01-0.1μgCd/L, respectively. However, soft-tissue body burdens of Cu or Cd did not significantly correlate with each of the four biomarkers regardless of the tissue type. In addition, AM generally stored more glycogen than HP, whereas HP stored more lipids than AM. We proposed that multiple biomarkers may be employed as an integrated diagnostic tool for monitoring the health condition of the mussels. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. Spatiotemporal variations in metal accumulation, RNA/DNA ratio and energy reserve in Perna viridis transplanted along a marine pollution gradient in Hong Kong.

    Science.gov (United States)

    Yeung, Jamius W Y; Zhou, Guang-Jie; Leung, Kenneth M Y

    2017-11-30

    We examined spatiotemporal variations of metal levels and three growth related biomarkers, i.e., RNA/DNA ratio (RD), total energy reserve (Et) and condition index (CI), in green-lipped mussels Perna viridis transplanted into five locations along a pollution gradient in the marine environment of Hong Kong over 120days of deployment. There were significant differences in metal levels and biomarker responses among the five sites and six time points. Mussels in two clean sites displayed better CI and significantly lower levels of Ag, Cu, Pb and Zn in their tissues than the other sites. Temporal patterns of RD in P. viridis were found to be site-specific. Across all sites, Et decreased in P. viridis over the deployment period, though the rate of decrease varied significantly among the sites. Therefore, temporal variation of biomarkers should be taken to consideration in mussel-watch programs because such information can help discriminate pollution-induced change from natural variation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. A Pleiotropic Role for the Orphan Nuclear Receptor Small Heterodimer Partner in Lipid Homeostasis and Metabolic Pathways

    Directory of Open Access Journals (Sweden)

    Gabriella Garruti

    2012-01-01

    Full Text Available Nuclear receptors (NRs comprise one of the most abundant classes of transcriptional regulators of metabolic diseases and have emerged as promising pharmaceutical targets. Small heterodimer partner (SHP; NR0B2 is a unique orphan NR lacking a DNA-binding domain but contains a putative ligand-binding domain. SHP is a transcriptional regulator affecting multiple key biological functions and metabolic processes including cholesterol, bile acid, and fatty acid metabolism, as well as reproductive biology and glucose-energy homeostasis. About half of all mammalian NRs and several transcriptional coregulators can interact with SHP. The SHP-mediated repression of target transcription factors includes at least three mechanisms including direct interference with the C-terminal activation function 2 (AF2 coactivator domains of NRs, recruitment of corepressors, or direct interaction with the surface of NR/transcription factors. Future research must focus on synthetic ligands acting on SHP as a potential therapeutic target in a series of metabolic abnormalities. Current understanding about the pleiotropic role of SHP is examined in this paper, and principal metabolic aspects connected with SHP function will be also discussed.

  2. Critical role of RanBP2-mediated SUMOylation of Small Heterodimer Partner in maintaining bile acid homeostasis

    Science.gov (United States)

    Kim, Dong-Hyun; Kwon, Sanghoon; Byun, Sangwon; Xiao, Zhen; Park, Sean; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Kemper, Byron; Kemper, Jongsook Kim

    2016-01-01

    Bile acids (BAs) are recently recognized signalling molecules that profoundly affect metabolism. Because of detergent-like toxicity, BA levels must be tightly regulated. An orphan nuclear receptor, Small Heterodimer Partner (SHP), plays a key role in this regulation, but how SHP senses the BA signal for feedback transcriptional responses is not clearly understood. We show an unexpected function of a nucleoporin, RanBP2, in maintaining BA homoeostasis through SUMOylation of SHP. Upon BA signalling, RanBP2 co-localizes with SHP at the nuclear envelope region and mediates SUMO2 modification at K68, which facilitates nuclear transport of SHP and its interaction with repressive histone modifiers to inhibit BA synthetic genes. Mice expressing a SUMO-defective K68R SHP mutant have increased liver BA levels, and upon BA- or drug-induced biliary insults, these mice exhibit exacerbated cholestatic pathologies. These results demonstrate a function of RanBP2-mediated SUMOylation of SHP in maintaining BA homoeostasis and protecting from the BA hepatotoxicity. PMID:27412403

  3. Archaeal fibrillarin-Nop5 heterodimer 2'-O-methylates RNA independently of the C/D guide RNP particle.

    Science.gov (United States)

    Tomkuvienė, Miglė; Ličytė, Janina; Olendraitė, Ingrida; Liutkevičiūtė, Zita; Clouet-d'Orval, Béatrice; Klimašauskas, Saulius

    2017-09-01

    Archaeal fibrillarin (aFib) is a well-characterized S -adenosyl methionine (SAM)-dependent RNA 2'- O -methyltransferase that is known to act in a large C/D ribonucleoprotein (RNP) complex together with Nop5 and L7Ae proteins and a box C/D guide RNA. In the reaction, the guide RNA serves to direct the methylation reaction to a specific site in tRNA or rRNA by sequence complementarity. Here we show that a Pyrococcus abyssi aFib-Nop5 heterodimer can alone perform SAM-dependent 2'- O -methylation of 16S and 23S ribosomal RNAs in vitro independently of L7Ae and C/D guide RNAs. Using tritium-labeling, mass spectrometry, and reverse transcription analysis, we identified three in vitro 2'- O -methylated positions in the 16S rRNA of P. abyssi , positions lying outside of previously reported pyrococcal C/D RNP methylation sites. This newly discovered stand-alone activity of aFib-Nop5 may provide an example of an ancestral activity retained in enzymes that were recruited to larger complexes during evolution. © 2017 Tomkuvienė et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

  4. An Iml3-Chl4 Heterodimer Links the Core Centromere to Factors Required for Accurate Chromosome Segregation

    Directory of Open Access Journals (Sweden)

    Stephen M. Hinshaw

    2013-10-01

    Full Text Available Accurate segregation of genetic material in eukaryotes relies on the kinetochore, a multiprotein complex that connects centromeric DNA with microtubules. In yeast and humans, two proteins—Mif2/CENP-C and Chl4/CNEP-N—interact with specialized centromeric nucleosomes and establish distinct but cross-connecting axes of chromatin-microtubule linkage. Proteins recruited by Chl4/CENP-N include a subset that regulates chromosome transmission fidelity. We show that Chl4 and a conserved member of this subset, Iml3, both from Saccharomyces cerevisiae, form a stable protein complex that interacts with Mif2 and Sgo1. We have determined the structures of an Iml3 homodimer and an Iml3-Chl4 heterodimer, which suggest a mechanism for regulating the assembly of this functional axis of the kinetochore. We propose that at the core centromere, the Chl4-Iml3 complex participates in recruiting factors, such as Sgo1, that influence sister chromatid cohesion and encourage sister kinetochore biorientation.

  5. Heterochiral Jun and Fos bZIP peptides form a coiled-coil heterodimer that is competent for DNA binding.

    Science.gov (United States)

    Kamada, Rui; Nakagawa, Natsumi; Oyama, Taiji; Sakaguchi, Kazuyasu

    2017-07-01

    Coiled coils, consisting of at least two α-helices, have important roles in the regulation of transcription, cell differentiation, and cell growth. Peptides composed of d-amino acids (d-peptides) have received great attention for their potential in biomedical applications, because they give large diversity for the design of peptidyl drug and are more resistant to proteolytic digestion than l-peptides. However, the interactions between l-peptides/l-protein and d-peptides in the formation of complex are poorly understood. In this study, stereoisomer-specific peptides were constructed corresponding to regions of the basic-leucine-zipper domains of Jun and Fos proteins. basic-leucine-zipper domains consist of an N-terminal basic domain, which is responsible for DNA binding, and a C-terminal domain that enables homodimerization or heterodimerization via formation of a coiled-coil. By combining peptides with different stereochemistries, the d-l heterochiral Jun-Fos heterodimer formation induced DNA binding by the basic domains of Jun-Fos. Our study provides new insight into the interaction between l-peptide and d-peptide enantiomers for developing d-peptide materials and drugs. Copyright © 2017 European Peptide Society and John Wiley & Sons, Ltd. Copyright © 2017 European Peptide Society and John Wiley & Sons, Ltd.

  6. Two-Step Hydrothermal Synthesis of Bifunctional Hematite-Silver Heterodimer Nanoparticles for Potential Antibacterial and Anticancer Applications

    Science.gov (United States)

    Trang, Vu Thi; Tam, Le Thi; Phan, Vu Ngoc; Van Quy, Nguyen; Huy, Tran Quang; Le, Anh-Tuan

    2017-06-01

    In recent years, the development of composite nanostructures containing noble metal and magnetic nanocrystals has attracted much interest because they offer a promising avenue for multifunctional applications in nanomedicine and pharmacotherapy. In this work, we present a facile two-step hydrothermal approach for the synthesis of bifunctional heterodimer nanoparticles (HDNPs) composed of hematite nanocubes (α-Fe2O3 NCs) and silver nanoparticles (Ag-NPs). The formation and magnetic property of α-Fe2O3-Ag HDNPs was analyzed by transmission electron microscopy, x-ray diffraction and vibrating sample magnetometer. Interestingly, the hydrothermal-synthesized α-Fe2O3-Ag HDNPs were found to display significant antibacterial activity against three types of infectious bacteria. The cytotoxicity of α-Fe2O3-Ag nanocomposite against lung cancer A549 cell line was investigated and compared with that of pure α-Fe2O3 NCs and Ag-NPs. The obtained results reveal that the α-Fe2O3-Ag nanocomposite exhibited higher anticancer performance than that of pure Ag-NPs, whereas pure α-Fe2O3 NCs were not cytotoxic to the tested cells. The inhibitory concentration (IC50) of the α-Fe2O3-Ag nanocomposite was found at 20.94 μg/mL. With the aforementioned properties, α-Fe2O3-Ag HDNPs showed a high potential as a multifunctional material for advanced biomedicine and nanotherapy applications.

  7. Morphostasis in a novel eukaryote illuminates the evolutionary transition from phagotrophy to phototrophy: description of Rapaza viridis n. gen. et sp. (Euglenozoa, Euglenida

    Directory of Open Access Journals (Sweden)

    Yamaguchi Aika

    2012-03-01

    Full Text Available Abstract Background Morphostasis of traits in different species is necessary for reconstructing the evolutionary history of complex characters. Studies that place these species into a molecular phylogenetic context test hypotheses about the transitional stages that link divergent character states. For instance, the transition from a phagotrophic mode of nutrition to a phototrophic lifestyle has occurred several times independently across the tree of eukaryotes; one of these events took place within the Euglenida, a large group of flagellates with diverse modes of nutrition. Phototrophic euglenids form a clade that is nested within lineages of phagotrophic euglenids and that originated through a secondary endosymbiosis with green algae. Although it is clear that phototrophic euglenids evolved from phagotrophic ancestors, the morphological disparity between species representing these different nutritional modes remains substantial. Results We cultivated a novel marine euglenid, Rapaza viridis n. gen. et sp. ("green grasper", and a green alga, Tetraselmis sp., from the same environment. Cells of R. viridis were comprehensively characterized with light microscopy, SEM, TEM, and molecular phylogenetic analysis of small subunit rDNA sequences. Ultrastructural and behavioral observations demonstrated that this isolate habitually consumes a specific strain of Tetraselmis prey cells and possesses a functional chloroplast that is homologous with other phototrophic euglenids. A novel feeding apparatus consisting of a reduced rod of microtubules facilitated this first and only example of mixotrophy among euglenids. R. viridis also possessed a robust photoreception apparatus, two flagella of unequal length, euglenoid movement, and a pellicle consisting of 16 strips and one (square-shaped whorl of posterior strip reduction. The molecular phylogenetic data demonstrated that R. viridis branches as the nearest sister lineage to phototrophic euglenids

  8. [Effects of cytosine-arabinofuranoside on the development of reptilian embryos (Lacerta viridis, Laur. and Anguis fragilis, L.)].

    Science.gov (United States)

    Raynaud, A

    1982-01-01

    Administered into the yolk sac of eggs of Lacerta viridis as a single dose of 17 to 40 micrograms, cytosine-arabinoside (Ara-C) was compatible with survival of the embryo, from the sixth day of incubation, for at least 20 to 25 days. The LD50 was 40 to 50 micrograms per egg. Doses of 20 to 40 micrograms of Ara-C introduced in the yolk sac of eggs of the slow-worm (Anguis fragilis) cultured in vitro, at stages of the allantoid bud of 0,5 mm to 2,5 mm long, killed the embryo in 4 to 8 days (possibly due to alterations of capillary blood vessels of allantois and area vasculosa). In the two species, these doses caused cytotoxic effects on embryonic proliferating tissues, growth inhibition and a variety of developmental defects. In young embryos of Anguis fragilis, similar doses of 20 to 40 micrograms of Ara-C caused, in 2 to 4 days, death of many cells in the anlagen of growing organs: neural tube, sensory organs, bronchi, mesoderm of the limb bud, subcutaneous mesenchyme, anlage of dorsal skeletal structures, etc.; followed by growth inhibition and malformations. On the other hand, in the limb bud, the apical ridge was less retrogressed than in control embryos; the limb buds showed slightly better development in treated embryos than in controls, but, Ara-C induced severe damage in their mesoderm. In all embryos of Lacerta viridis, treated at the stage of 6 days or of 10 days of incubation by doses of 20 to 40 micrograms of Ara-C and killed 15 to 35 days later, there was a general reduction of size and of weight and external and internal malformations, more or less severe, were present: modifications of the form of the head, shortening of the lower jaw, labial clefts, microphthalmia, micromelia and other limbs defects, developmental defects of the tail. In some embryos, the only external defects observed were missing fingers and toes; in three of these embryos, the same digits were missing in the four limbs. Modifications of limb morphogenesis induced by Ara-C are

  9. Sublethal effects of the pyrethroid insecticide deltamethrin on oxidative stress parameters in green toad (Bufotes viridis L.).

    Science.gov (United States)

    Radovanović, Tijana B; Nasia, Mohammed; Krizmanić, Imre I; Prokić, Marko D; Gavrić, Jelena P; Despotović, Svetlana G; Gavrilović, Branka R; Borković-Mitić, Slavica S; Pavlović, Slađan Z; Saičić, Zorica S

    2017-10-01

    Pyrethroids are synthetic insecticides widely used in agriculture, public health, and veterinary medicine. Deltamethrin, a type II pyrethroid insecticide, has attracted particular attention because of its frequent use. The mechanisms of the toxicity of most pesticides (including pyrethroids) in nontarget organisms is linked to the production of free radicals, oxidative stress induction, increased lipid peroxidation, and disruption of the total antioxidant potential. The aim of the present study was to investigate the effects of acute toxicity of 3 different concentrations (8, 16, and 32 mg/kg body wt) of orally applied deltamethrin after 96 h of treatment. Some of the front-line oxidative stress parameters as well as cholinesterase (ChE) activity and cytochrome P4501A (CYP1A) expression in the liver, muscle, skin, and gastrointestinal tissue of the adult green toad Bufotes viridis were determined. Compared with the control group, the activity of catalase and glutathione reductase was increased in the liver and skin, while the concentration of sulfhydryl groups was reduced. In the liver and muscle, concentrations of thiobarbituric reactive substances were increased, as well as liver CYP1A expression. In the muscle and skin, glutathione-S-transferase activity was higher in treated toads. The oxidative stress parameters examined were affected by different deltamethrin concentrations. We conclude that the assessed parameters represent good biomarkers of pesticide-induced oxidative stress. Environ Toxicol Chem 2017;36:2814-2822. © 2017 SETAC. © 2017 SETAC.

  10. Study of the behavior of Euglena viridis, Euglena gracilis and Lepadella patella cultured in all-glass microaquarium.

    Science.gov (United States)

    Podwin, Agnieszka; Kubicki, Wojciech; Dziuban, Jan A

    2017-09-01

    In the paper, the microaquarium fabricated in a form of entirely glass lab-on-a-chip for culturing and microscale study of microorganisms has been presented. A new approach towards cellular studies that brings a significant improvement over commonly utilized - polymer-based solutions has been shown. For the first time, all-borosilicate glass chip was applied for the culturing of the selected microorganisms and enabled notable population growth and behaviorism investigation. The chip fabrication method in comparison to typical glass chip technology was notably simplified, including quick patterning and low temperature bonding in 80 °C. In the studies, both a single-cell (Euglena gracilis and Euglena viridis) and multi-cell microorganisms (Lepadella patella) were cultured in the microaquarium. Behaviorism of the selected microorganisms was investigated by supplying various proportions of carbon dioxide, nitrogen and air into the chip. Tests included studies of microorganisms chemotaxis, viability (mostly based on photosynthesis process) and coexistence in the lab-on-a-chip environment. The experiments confirmed that the developed chip is a tool that fits the requirements for the culturing and behavioral studies of microorganisms and constitute ground-works to propel its further application in broadly defined cellular study field.

  11. Relationship of Genetics and Cs-137 in Asian Green Mussel (Perna viridis from Nuclear Activities in Asia-Pacific Region

    Directory of Open Access Journals (Sweden)

    Wanwiwa Tumnoi

    2017-03-01

    Full Text Available This study focuses on the relationship of genetics and Cs-137 radiation doses in Asian green mussel (Perna viridis collected from Chonburi province, Thailand. They might accumulate the radiocaesium from the nuclear power plants in the Asia-Pacific region including the Fukushima-Daiichi nuclear power plant via their routine or accidental releases. The radiation doses, estimated using ERICA Tool in the bivalves categorized into 3 different size classes including 4-6, 6-8, and 8-10 cm, were below 0.02 nGy/h. In parallel, Micronucleus test and Comet assay were used to investigate genetic responses in the mussels. They revealed minimum micronucleus frequency (MNF and %Tail DNA varying from 1.80-2.90% and 1.36-1.70%, respectively. The result indicates that neither particular accumulation of Cs-137 nor genetic responses among different size classes of the animals were observed. Furthermore, the radiation doses in the mussels were below the dose limit of 10 µGy/h. Therefore, no radiation effect caused by Cs-137 was found and it was also confirmed by minimal genetic damages. Data obtained can be used as site-specific data for radiological dose and impact assessment and as baseline data to establish the national radiation safety levels to protect Thai marine biota from any possible future nuclear accidents.

  12. Biomonitoring of Mercury Contamination at Petroleum Production Platforms in the Gulf of Thailand using Transplanted Green Mussel, Perna viridis

    Directory of Open Access Journals (Sweden)

    Chatree Ritthong

    2011-01-01

    Full Text Available Assessment of mercury contamination was conducted using transplanted green mussels (Perna viridis. Mussels were first exposed to HgCl2 at 0.5, 1.0, 2.5, and 5.0 nmol/L for 8 weeks at laboratory conditions. The result showed that Hg level in the water decreased rapidly, while Hg in mussels increased coincidentally with the applied doses. After 8 weeks the Hg, levels in tissue were a thousand-fold higher than that in the water. Mussels were then transplanted to 3 petroleum production platforms for field study. The result revealed that survival and growth rates of transplanted mussels at all 3 stations were in close to each other but significantly lower than that from the reference site. Hg concentrations in the tissues of transplanted mussels ranged from less than 0.010 to 0.173 µg/g, and Hg concentrations in mussel tissues from all stations were significantly increased within 2 months, while Hg levels in mussel tissues from reference site were not changed. Hg levels of transplanted mussels increased with increasing depths of the water. The transplanted mussels showed no signs of any physical anomalies, indicating that transplanted mussels could be maintained for up to 3 months in an un-natural habitat, such as petroleum production platforms, where food is much less abundant.

  13. European green lizard (Lacerta viridis) personalities: Linking behavioural types to ecologically relevant traits at different ontogenetic stages.

    Science.gov (United States)

    Bajer, Katalin; Horváth, Gergely; Molnár, Orsolya; Török, János; Garamszegi, László Zsolt; Herczeg, Gábor

    2015-02-01

    Consistent individual differences within (animal personality) and across (behavioural syndrome) behaviours became well recognized during the past decade. Nevertheless, our knowledge about the evolutionary and developmental mechanisms behind the phenomena is still incomplete. Here, we explored if risk-taking and exploration were consistent and linked to different ecologically relevant traits in wild-caught adult male European green lizards (Lacerta viridis) and in their 2-3 weeks old laboratory-reared offspring. Both adults and juveniles displayed animal personality, consistency being higher in juveniles. We found correlation between risk-taking and exploration (suggestive of a behavioural syndrome) only in adults. Juveniles were more explorative than adults. Large or ectoparasite-free adult males were more explorative than small or parasitized males. Juvenile females tended to be more risk-taking than males. Behaviour of fathers and their offspring did not correlate. We conclude that European green lizards show high behavioural consistency and age is an important determinant of its strength and links to traits likely affecting fitness. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Small heterodimer partner (SHP deficiency protects myocardia from lipid accumulation in high fat diet-fed mice.

    Directory of Open Access Journals (Sweden)

    Jung Hun Ohn

    Full Text Available The small heterodimer partner (SHP regulates fatty acid oxidation and lipogenesis in the liver by regulating peroxisome proliferator-activated receptor (PPAR γ expression. SHP is also abundantly expressed in the myocardium. We investigated the effect of SHP expression on myocardia assessing not only heart structure and function but also lipid metabolism and related gene expression in a SHP deletion animal model. Transcriptional profiling with a microarray revealed that genes participating in cell growth, cytokine signalling, phospholipid metabolism, and extracellular matrix are up-regulated in the myocardia of SHP knockout (KO mice compared to those of wild-type (WT mice (nominal p value < 0.05. Consistent with these gene expression changes, the left ventricular masses of SHP KO mice were significantly higher than WT mice (76.8 ± 20.5 mg vs. 52.8 ± 6.8 mg, P = 0.0093. After 12 weeks of high fat diet (HFD, SHP KO mice gained less weight and exhibited less elevation in serum-free fatty acid and less ectopic lipid accumulation in the myocardium than WT mice. According to microarray analysis, genes regulated by PPARγ1 and PPARα were down-regulated in myocardia of SHP KO mice compared to their expression in WT mice after HFD, suggesting that the reduction in lipid accumulation in the myocardium resulted from a decrease in lipogenesis regulated by PPARγ. We confirmed the reduced expression of PPARγ1 and PPARα target genes such as CD36, medium-chain acyl-CoA dehydrogenase, long-chain acyl-CoA dehydrogenase, and very long-chain acyl-CoA dehydrogenase by SHP KO after HFD.

  15. Retrospective evaluation of the effect of antivenom administration on hospitalization duration and treatment cost for dogs envenomated by Crotalus viridis: 113 dogs (2004-2012).

    Science.gov (United States)

    Katzenbach, Julia E; Foy, Daniel S

    2015-01-01

    To compare the effect of antivenom administration on mortality, hospitalization duration, and cost of hospitalization for dogs envenomated by Crotalus viridis. Retrospective study (January 2004-December 2012). Private veterinary emergency and referral center. One hundred thirteen dogs with confirmed C. viridis envenomation. None. Dogs were divided into groups treated with either supportive care only (group 1) or supportive care plus antivenin crotalidae polyvalent (group 2). A modified snakebite severity score was used to compare patients from group 1 and group 2. Patients in group 2 received one 10 mL vial of antivenin crotalidae polyvalent over 4-6 hours. The mortality rate was 1.8% (2/113).  Group 1 had a median duration of hospitalization of 20 hours (range, 8-50 hours), while group 2 had a median duration of hospitalization of 24 hours (range, 1.5-74 hours). Group 1 had a median cost of hospitalization of 1050.00 USD (range, 423.52-2266.09 USD) while group 2 had a median cost of hospitalization of 2002.19 USD (range, 1139.91-6908.01 USD). Both the duration of hospitalization (P dogs receiving antivenom. Both the cost and the duration of hospitalization were significantly greater in the group of dogs that received antivenom. The difference in cost between the groups was approximately the cost of the antivenom vial and administration. Amongst the parameters evaluated, no significant benefit was associated with antivenom administered to dogs envenomated by C. viridis. © Veterinary Emergency and Critical Care Society 2015.

  16. Deciphering the growth, organic acid exudations, and ionic homeostasis of Amaranthus viridis L. and Portulaca oleracea L. under lead chloride stress.

    Science.gov (United States)

    Javed, Muhammad Tariq; Akram, Muhammad Sohail; Habib, Noman; Tanwir, Kashif; Ali, Qasim; Niazi, Nabeel Khan; Gul, Huma; Iqbal, Naeem

    2018-01-01

    Lead (Pb) stress adversely affects in planta nutrient homeostasis and metabolism when present at elevated concentration in the surrounding media. The present study was aimed at investigation of organic acid exudations, elemental contents, growth, and lipid peroxidation in two wild plants (Amaranthus viridis L. and Portulaca oleracea L.), exhibiting differential root to shoot Pb translocation, under Pb stress. Plants were placed in soil spiked with lead chloride (PbCl 2 ) concentrations of 0, 15, 30, 45, or 60 mg Pb/kg soil, in rhizoboxes supplied with nylon nets around the roots. The plant mucilage taken from root surfaces, mirroring the rhizospheric solution, was analyzed for various organic acids. Lead stress resulted in a release of basified root exudates from both plants. Exudates of P. oleracea roots showed a higher pH. In both plants, the pH rising effect was diminished at the highest Pb treatment level. The exudation of citric acid, glutamic acid (in both plants), and fumaric acid (in P. oleracea only) was significantly increased with applied Pb levels. In both plant species, root and shoot Pb contents increased while nutrients (Ca, Mg, and K) decreased with increasing Pb treatment levels, predominantly in A. viridis. At 60 mg Pb/kg soil, shoot Na content of A. viridis was significantly higher as compared to untreated control. Higher Pb treatment levels decreased plant fresh and dry masses as well as the quantity of photosynthetic pigments due to enhanced levels of plant H 2 O 2 and thiobarbituric acid reactive substances in both species. Photosynthetic, growth, and oxidative stress parameters were grouped into three distinct dendrogram sections depending on their similarities under Pb stress. A positive correlation was identified between Pb contents of studied plants and secretion of different organic acids. It is concluded that Pb stress significantly impaired the growth of A. viridis and P. oleracea as a result of nutritional ion imbalance, and the

  17. Effects of the invasive polychaete, Marenzelleria viridis, on the fate of sediment associated pollutants – a microcosm study with 14C-labelled pyrene

    DEFF Research Database (Denmark)

    Banta, Gary Thomas; Hedman, Jenny Elisabet

    on the fate of deeply buried sediment-associated pollutants in the historically polluted Baltic Sea. We report here the results of an experimental microcosm study examining the fate of 14C radiolabelled pyrene (a 4-ring PAH) in sediment microcosms with and without Marenzelleria viridis. We also investigated......The deep burrowing, invasive spionid polychaete, Marenzelleria spp. (3 sibling species), is rapidly expanding its range in the Baltic Sea ecosystem, increasing the depth of the bioturbated zone dramatically relative to the native benthic community. One concern is the effect of this invasion...

  18. Understanding the Differential Response of Setaria viridis L. (green foxtail) and Setaria pumila Poir. (yellow foxtail) to Pyroxsulam.

    Science.gov (United States)

    Satchivi, Norbert M; deBoer, Gerrit J; Bell, Jared L

    2017-08-30

    Green foxtail [Setaria viridis (L) Beauv.] and yellow foxtail [Setaria pumila (Poir.) Roem. & Schult.] are among the most abundant and troublesome annual grass weeds in cereal crops in the Northern Plains of the United States and the Prairie Provinces of Canada. Greenhouse and laboratory experiments were conducted to examine the differential responses of both weed species to foliar applications of the new triazolopyrimidine sulfonamide acetolactate synthase-inhibiting herbicide, pyroxsulam, and to determine the mechanism(s) of differential weed control. Foliar applications of pyroxsulam resulted in >90% control of yellow foxtail at rates between 7.5 and 15 g ai ha -1 , whereas the same rates resulted in a reduced efficacy on green foxtail (≤81%). The absorption and translocation of [ 14 C]pyroxsulam in green and yellow foxtail were similar and could not explain the differential whole-plant efficacy. Studies with [ 14 C]pyroxsulam revealed a higher percentage of absorbed pyroxsulam was metabolized into an inactive metabolite in the treated leaf of green foxtail than in the treated leaf of yellow foxtail. Metabolism studies demonstrated that, 48 h after application, 50 and 35% of pyroxsulam in the treated leaf was converted to 5-hydroxy-pyroxsulam in green and yellow foxtail, respectively. The acetolactate synthase (ALS) inhibition assay showed that ALS extracted from green foxtail was more tolerant to pyroxsulam than the enzyme extracted from yellow foxtail was. The in vitro ALS assay showed IC 50 values of 8.39 and 0.26 μM pyroxsulam for green and yellow foxtail, respectively. The ALS genes from both green and yellow foxtail were sequenced and revealed amino acid differences; however, the changes are not associated with known resistance-inducing mutations. The differential control of green and yellow foxtail following foliar applications of pyroxsulam was attributed to differences in both metabolism and ALS sensitivity.

  19. Variationas of 210Po Activity in Mussels (Perna viridis) of Samut Sakhon and Its Contribution to Dose Assessment

    International Nuclear Information System (INIS)

    Porntepkasemsan, B; Srisuksawad, K.; Permnamtip, V.

    2014-01-01

    Levels of 210 Po and its effective dose in green mussel (Perna viridis) collected from mussel farming area at the Samut Sakhon province during the period of 2012-2013 are presented. Several parameters including maximum shell length and the physiological performance of mussels using condition index and physical properties of seawater (pH, salinity, conductivity, TDS, DO and cation-anion elements) were measured. Each individual mussel was measured on its maximum shell length which was adopted as size class. The activity concentration of 210Po was determined spectroscopically through its 5.30 MeV alpha particle emission, using 209 Po as an internal tracer. The 210 Po activity concentration in mussels was found to vary between 1.044 and 6.951 Bq.kg-1 wet weight. The 210 Po concentration was higher in smaller sized classes (>35 mm) and lowest in larger ones (40-70 mm). This confirms that larger mussels have lower 210Po levels on a weight basis. The 210 Po body burden (activity per mussel) ranged from 1.035 to 17.183 mBq. Contrary to the 210 Po concentrations, results of the body burden revealed the lower activities in smaller sized mussels (>35 mm) and the higher in larger sized ones (40-70 mm). The type of fluctuations observed with 210 Po concentrations are interpreted as a seasonal effect. Total annual effective 210 Po dose due to mussel consumption was calculated to be in the range of 3.081 to 16.401 μSv. Based on the international guideline, the average dose calculated due to 210 Po in mussels of Samut Sakhon would not pose any significant radiological impact on human health and the mussels are considered to be safe for intake.

  20. The role of photo-osmotic adaptation in semi-continuous culture and lipid particle release fromDunaliella viridis.

    Science.gov (United States)

    Davis, Ryan W; Carvalho, Benjamin J; Jones, Howland D T; Singh, Seema

    Although great efforts have been made to elucidate the phenotypic responses of alga to varying levels of nutrients, osmotic environments, and photosynthetically active radiation intensities, the role of interactions among these variables is largely nebulous. Here, we describe a general method for establishing and maintaining semi-continuous cultures of the halophilic microalgal production strain, Dunaliella viridis , that is independent of variations in salinity and illumination intensity. Using this method, the cultures were evaluated to elucidate the overlapping roles of photosynthetic and osmotic adaptation on the accumulation and compositional variation of the biomass, photosynthetic productivity, and physiological biomarkers, as well as spectroscopic and morphological details at the single-cell level. Correlation matrices defining the relationships among the observables and based on variation of the illumination intensity and salinity were constructed for predicting bioproduct yields for varying culture conditions. Following maintenance of stable cultures for 6-week intervals, phenotypic responses to photo-osmotic drift were explored using a combination of single-cell hyperspectral fluorescence imaging and flow cytometry. In addition to morphological changes, release of lipid microparticles from the cells that is disproportionate to cell lysis was observed under hypotonic drift, indicating the existence of a reversible membrane permeation mechanism in Dunaliella . This phenomenon introduces the potential for low-cost strategies for recovering lipids and pigments from the microalgae by minimizing the requirement for energy intensive harvesting and dewatering of the biomass. The results should be applicable to outdoor culture, where seasonal changes resulting in variable solar flux and precipitation and evaporation rates are anticipated.

  1. Mapping of a Microbial Protein Domain Involved in Binding and Activation of the TLR2/TLR1 Heterodimer 1

    Science.gov (United States)

    Liang, Shuang; Hosur, Kavita B.; Lu, Shanyun; Nawar, Hesham F.; Weber, Benjamin R.; Tapping, Richard I.; Connell, Terry D.; Hajishengallis, George

    2009-01-01

    LT-IIb-B5, a doughnut-shaped oligomeric protein from enterotoxigenic Escherichia coli, is known to activate the TLR2/TLR1 heterodimer (TLR2/1). We investigated the molecular basis of the LT-IIb-B5 interaction with TLR2/1 in order to define the structure-function relationship of LT-IIb-B5 and, moreover, to gain an insight into how TLR2/1 recognizes large, non-acylated protein ligands that cannot fit within its lipid-binding pockets, as previously shown for the Pam3CSK4 lipopeptide. We first identified four critical residues in the upper region of the LT-IIb-B5 pore: Corresponding point mutants (M69E, A70D, L73E, S74D) were defective in binding TLR2 or TLR1 and could not activate antigen-presenting cells, despite retaining full ganglioside-binding capacity. Point mutations in the TLR2/1 dimer interface, as determined in the crystallographic structure of the TLR2/1-Pam3CSK4 complex, resulted in diminished activation by both Pam3CSK4 and LT-IIb-B5. Docking analysis of the LT-IIb-B5 interaction with this apparently “predominant” activation conformation of TLR2/1 revealed that LT-IIb-B5 may primarily contact the convex surface of the TLR2 central domain. Although the TLR1/LT-IIb-B5 interface is relatively smaller, the leucine-rich repeat motifs 9–12 in the central domain of TLR1 were found to be critical for cooperative TLR2-induced cell activation by LT-IIb-B5. Moreover, the putative LT-IIb-B5 binding site overlaps partially with that of Pam3CSK4; consistent with this, Pam3CSK4 suppressed TLR2 binding of LT-IIb-B5, albeit not as potently as self-competitive inhibition. In conclusion, we identified the upper pore region of LT-IIb-B5 as a TLR2/1 interactive domain, which contacts the heterodimeric receptor at a site that is distinct from, though overlaps with, that of Pam3CSK4. PMID:19234193

  2. The crystal structure of the AhRR-ARNT heterodimer reveals the structural basis of the repression of AhR-mediated transcription.

    Science.gov (United States)

    Sakurai, Shunya; Shimizu, Toshiyuki; Ohto, Umeharu

    2017-10-27

    2,3,7,8-Tetrachlorodibenzo- p -dioxin and related compounds are extraordinarily potent environmental toxic pollutants. Most of the 2,3,7,8-tetrachlorodibenzo- p -dioxin toxicities are mediated by aryl hydrocarbon receptor (AhR), a ligand-dependent transcription factor belonging to the basic helix-loop-helix (bHLH) Per-ARNT-Sim (PAS) family. Upon ligand binding, AhR forms a heterodimer with AhR nuclear translocator (ARNT) and induces the expression of genes involved in various biological responses. One of the genes induced by AhR encodes AhR repressor (AhRR), which also forms a heterodimer with ARNT and represses the activation of AhR-dependent transcription. The control of AhR activation is critical for managing AhR-mediated diseases, but the mechanisms by which AhRR represses AhR activation remain poorly understood, because of the lack of structural information. Here, we determined the structure of the AhRR-ARNT heterodimer by X-ray crystallography, which revealed an asymmetric intertwined domain organization presenting structural features that are both conserved and distinct among bHLH-PAS family members. The structures of AhRR-ARNT and AhR-ARNT were similar in the bHLH-PAS-A region, whereas the PAS-B of ARNT in the AhRR-ARNT complex exhibited a different domain arrangement in this family reported so far. The structure clearly disclosed that AhRR competitively represses AhR binding to ARNT and target DNA and further suggested the existence of an AhRR-ARNT-specific repression mechanism. This study provides a structural basis for understanding the mechanism by which AhRR represses AhR-mediated gene transcription. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  3. Bioreduction of trivalent aurum to nano-crystalline gold particles by active and inactive cells and cell-free extract of Aspergillus oryzae var. viridis

    Energy Technology Data Exchange (ETDEWEB)

    Binupriya, A.R. [Department of Food Science and Technology, College of Agriculture and Life Science, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Sathishkumar, M., E-mail: cvemuthu@nus.edu.sg [Singapore-Delft Water Alliance, National University of Singapore, 2 Engineering Drive 2, Singapore 117577 (Singapore); Vijayaraghavan, K. [Singapore-Delft Water Alliance, National University of Singapore, 2 Engineering Drive 2, Singapore 117577 (Singapore); Yun, S.-I., E-mail: siyun@chonbuk.ac.kr [Department of Food Science and Technology, College of Agriculture and Life Science, Chonbuk National University, Jeonju 561-756 (Korea, Republic of)

    2010-05-15

    Bioreduction efficacy of both active (AB) and inactive (IB) cells/biomass of Aspergillus oryzae var. viridis and their respective cell-free extracts (ACE and ICE) to convert trivalent aurum to gold nanoparticles were tested in the present study. Strong plasmon resonance of gold nanoparticles was observed between 540 and 560 nm in the samples obtained from AB, IB, ACE and ICE. Transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM), energy dispersive X-ray (EDX) and X-ray diffraction (XRD) were performed to examine the formation of gold nanoparticles. Comparing all four forms of A. oryzae var. viridis, ICE showed high gold nanoparticle productivity. The nanoparticles formed were quite uniform in shape and ranged in size from 10 to 60 nm. In addition some triangle, pentagon and hexagon-shaped nanoplates with size range of 30-400 nm were also synthesized especially at lower pH. Organics from the inactive cells are believed to be responsible for reduction of trivalent aurum to nano-sized gold particles. Organic content of the ICE was found to be double the amount of ACE. High productivity of gold nanoparticles by metabolic-independent process opens up an interesting area of nanoparticle synthesis using waste fungal biomass from industries.

  4. Relationship of leaf oxygen and carbon isotopic composition with transpiration efficiency in the C4 grasses Setaria viridis and Setaria italica.

    Science.gov (United States)

    Ellsworth, Patrick Z; Ellsworth, Patrícia V; Cousins, Asaph B

    2017-06-15

    Leaf carbon and oxygen isotope ratios can potentially provide a time-integrated proxy for stomatal conductance (gs) and transpiration rate (E), and can be used to estimate transpiration efficiency (TE). In this study, we found significant relationships of bulk leaf carbon isotopic signature (δ13CBL) and bulk leaf oxygen enrichment above source water (Δ18OBL) with gas exchange and TE in the model C4 grasses Setaria viridis and S. italica. Leaf δ13C had strong relationships with E, gs, water use, biomass, and TE. Additionally, the consistent difference in δ13CBL between well-watered and water-limited plants suggests that δ13CBL is effective in separating C4 plants with different availability of water. Alternatively, the use of Δ18OBL as a proxy for E and TE in S. viridis and S. italica was problematic. First, the oxygen isotopic composition of source water, used to calculate leaf water enrichment (Δ18OLW), was variable with time and differed across water treatments. Second, water limitations changed leaf size and masked the relationship of Δ18OLW and Δ18OBL with E. Therefore, the data collected here suggest that δ13CBL but not Δ18OBL may be an effective proxy for TE in C4 grasses. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  5. Is Hybridization a Source of Adaptive Venom Variation in Rattlesnakes? A Test, Using a Crotalus scutulatus × viridis Hybrid Zone in Southwestern New Mexico

    Directory of Open Access Journals (Sweden)

    Giulia Zancolli

    2016-06-01

    Full Text Available Venomous snakes often display extensive variation in venom composition both between and within species. However, the mechanisms underlying the distribution of different toxins and venom types among populations and taxa remain insufficiently known. Rattlesnakes (Crotalus, Sistrurus display extreme inter- and intraspecific variation in venom composition, centered particularly on the presence or absence of presynaptically neurotoxic phospholipases A2 such as Mojave toxin (MTX. Interspecific hybridization has been invoked as a mechanism to explain the distribution of these toxins across rattlesnakes, with the implicit assumption that they are adaptively advantageous. Here, we test the potential of adaptive hybridization as a mechanism for venom evolution by assessing the distribution of genes encoding the acidic and basic subunits of Mojave toxin across a hybrid zone between MTX-positive Crotalus scutulatus and MTX-negative C. viridis in southwestern New Mexico, USA. Analyses of morphology, mitochondrial and single copy-nuclear genes document extensive admixture within a narrow hybrid zone. The genes encoding the two MTX subunits are strictly linked, and found in most hybrids and backcrossed individuals, but not in C. viridis away from the hybrid zone. Presence of the genes is invariably associated with presence of the corresponding toxin in the venom. We conclude that introgression of highly lethal neurotoxins through hybridization is not necessarily favored by natural selection in rattlesnakes, and that even extensive hybridization may not lead to introgression of these genes into another species.

  6. [Cytophotometric studies on the levels of proteins and RNA in the nuclei of the apical crest ane the epiblast of the limb bud of the green lizard (Lacerta viridis Laur.) and the blindworm (Anguis fragilis L)].

    Science.gov (United States)

    Raynaud, A; Jeanny, J C; Gontcharoff, M

    1975-06-16

    Cytophotometric determinations establish that in the limb buds of young embryos of the slow worm (Anguis fragilis L.) and of the green lizard (Lacerta viridis Laur.) the level of nuclear proteins and RNA is higher in the cells of the apical crest than in the cells of the epiblast on either side of the crest. This relative increase is progressively y reduced.

  7. Stress-induced nuclear import of apoptosis signal-regulating kinase 1 is mediated by karyopherin α2/β1 heterodimer.

    Science.gov (United States)

    Sturchler, Emmanuel; Feurstein, Daniel; Chen, Weimin; McDonald, Patricia; Duckett, Derek

    2013-03-01

    The apoptosis signal-regulating kinase 1 (ASK1) is activated in response to a wide variety of extracellular stressors. Consequently, dysregulation of ASK1 is associated with multiple pathologies. Here, we show that ASK1 translocates from the cytoplasm to the nucleus in HEK293 cells and human cardiomyocytes in response to hydrogen peroxide (H(2)O(2)) or angiotensin respectively. Immunoprecipitation and mass spectrometry experiments reveal that ASK1 physically interacts with the karyopherin α2/β1 heterodimer in response to stress and genetic knockdown experiments confirm that this association mediates H(2)O(2)-induced ASK1 nuclear translocation. In addition, we have identified a nuclear localization signal (NLS)-like motif within the primary amino acid sequence of ASK1 composed of two clusters of basic amino acids separated by an intervening 16 amino acid spacer, KR[ACANDLLVDEFLKVSS]KKKK. Mutation of the downstream lysine cluster markedly reduces the H(2)O(2)-induced ASK1-karyopherin α2/β1 interaction and inhibits ASK1 nuclear translocation. Furthermore, we demonstrate that nuclear ASK1 is active and participates in H(2)O(2)-induced ASK1-mediated cell death. Collectively, our findings have identified a functional interaction between ASK1 and the karyopherin α2/β1 heterodimer and have also revealed a novel mechanism by which nuclear trafficking regulates the apoptotic function of ASK1 in response to stress. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Specific binding of a Pop6/Pop7 heterodimer to the P3 stem of the yeast RNase MRP and RNase P RNAs.

    Science.gov (United States)

    Perederina, Anna; Esakova, Olga; Koc, Hasan; Schmitt, Mark E; Krasilnikov, Andrey S

    2007-10-01

    Pop6 and Pop7 are protein subunits of Saccharomyces cerevisiae RNase MRP and RNase P. Here we show that bacterially expressed Pop6 and Pop7 form a soluble heterodimer that binds the RNA components of both RNase MRP and RNase P. Footprint analysis of the interaction between the Pop6/7 heterodimer and the RNase MRP RNA, combined with gel mobility assays, demonstrates that the Pop6/7 complex binds to a conserved region of the P3 domain. Binding of these proteins to the MRP RNA leads to local rearrangement in the structure of the P3 loop and suggests that direct interaction of the Pop6/7 complex with the P3 domain of the RNA components of RNases MRP and P may mediate binding of other protein components. These results suggest a role for a key element in the RNase MRP and RNase P RNAs in protein binding, and demonstrate the feasibility of directly studying RNA-protein interactions in the eukaryotic RNases MRP and P complexes.

  9. Present levels of heavy metals in some molluscs of the Upper Gulf of Thailand. [Pernia viridis; Crassostrea commercialis; Anadara granosa; Paphia undulata; Amusium pleuronectes

    Energy Technology Data Exchange (ETDEWEB)

    Hungspreugs, M.; Yuangthong, C.

    1984-05-01

    This investigation was carried out as part of Thailand's participation in the global 'Mussel Watch' program. The levels of Cd, Cr, Cu, Pb, and Zn in the green mussel, Perna viridis, oyster, Crassostrea commercialis, and the cockle, Anadara granosa, were studied from July 1982 to November 1982. Comparison was made with the previous study in August 1981 which also included the short necked clam, Paphia undulata and moon scallop, Amusium pleuronectes. It was found that the metal levels were sufficiently low that the molluscs could be consumed without any danger to health. The salinity of the water appeared to influence the uptake as higher levels of metals were found during the flood season when salinity was lower.

  10. Mercury depuration effectiveness on green mussel (Perna viridis L.) and blood cockle (Anadara granosa L.) from Jakarta Bay using ozone, chitosan and hydrodynamic technique

    Science.gov (United States)

    Widiah Ningrum, Endar; Duryadi Solihin, Dedy; Butet, Nurlisa A.

    2016-01-01

    Depuration has been used to eliminate microorganism and toxic chemical contaminants in bivalve. However, scientific research still needs to discover the effectiveness of depuration. This research aimed at assessing the best depuration effectiveness in decreasing mercury (Hg) concentration level in two species of bivalves, green mussel (Perna viridis L.) and blood cockle (Anadara granosa L.). The depuration treatments applied 1.5 ppm ozon, 0.5 ppm chitosan, hydrodynamic technique (1.3 m/s), combination between hydrodynamic-ozon, hydrodynamic-chitosan and ozon-chitosan. The experiment were conducted in mini aquaria for 60 minutes. Mercury concentration was measured in 10 g dry weight of green mussel (4.05±0.020 ppm) and blood cockle (3.27 ± 0.666 ppm). The result showed that mercury depuration were highly effective by combination of ozone-chitosan in green mussel (96.51%) and 1.5 ppm ozone in blood cockle (87.06%).

  11. Placenta growth factor-1 antagonizes VEGF-induced angiogenesis and tumor growth by the formation of functionally inactive PIGF-1/VEGF heterodimers

    DEFF Research Database (Denmark)

    Eriksson, A.; Cao, R.; Pawliuk, R.

    2002-01-01

    , the biological function of its related homolog, placenta growth factor (PlGF), is poorly understood. Here we demonstrate that PlGF-1, an alternatively spliced isoform of the PlGF gene, antagonizes VEGF-induced angiogenesis when both factors are coexpressed in murine fibrosarcoma cells. Overexpression of PlGF-1...... in VEGF-producing tumor cells results in the formation of PlGF-1/VEGF heterodimers and depletion of the majority of mouse VEGF homodimers. The heterodimeric form of PlGF-1/VEGF lacks the ability to induce angiogenesis in vitro and in vivo. Similarly, PlGF-1/VEGF fails to activate the VEGFR-2-mediated...... signaling pathways. Further, PlGF-1 inhibits the growth of a murine fibrosarcoma by approximately 90% when PlGF-1-expressing tumor cells are implanted in syngeneic mice. In contrast, overexpression of human VEGF in murine tumor cells causes accelerated and exponential growth of primary fibrosarcomas...

  12. Tolerancia a la anoxia y defensas antioxidantes en el mejillón verde Perna viridis (Linneus, 1758 bajo exposición aguda al cadmio

    Directory of Open Access Journals (Sweden)

    Edgar Zapata-Vívenes

    2014-07-01

    Full Text Available Se estimó la sobrevivencia a la anoxia del mejillón verde Perna viridis después de siete días de exposición a 50 μg L-1 de cadmio (Cd, seguido de un período de recuperación en el mar durante 21 días. En la glándula digestiva de los organismos experimentales se determinó los niveles de Cd acumulados, y marcadores de estrés oxidativo tales como: metalotioneínas (MT, glutatión reducido (GSH, peroxidación lipídica (TBARS y las actividades de las enzimas catalasa (CAT, glutatión reductasa (GR y glutatión-S-transferasa (GST. Los organismos expuestos a Cd mostraron una menor tolerancia al tratamiento anóxico, sin embargo una vez recuperados en el mar presentaron valores de sobrevivencia relativamente mayores en comparación a sus controles. Los organismos expuestos a Cd revelaron un incremento en la concentración de MT y la actividad de CAT, correlacionado al ingreso corporal de Cd. Los organismos transplantados al mar mostraron una disminución del metal acumulado, manteniendo niveles de MT incrementados. Los mejillones tratados y controles no exhibieron diferencias significativas en los marcadores de estrés oxidativo determinados (TBARS, GSH, GR y GST. El Cd acumulado posiblemente afectó algunas estrategias bioquímicas relacionadas con la tolerancia a la anoxia de P. viridis. Sin embargo, los altos niveles de MT en organismos pre-expuestos y posteriormente recuperados, podría condicionar la protección contra la toxicidad del Cd e indirectamente una mayor tolerancia a la anoxia.

  13. Application of a novel alkali-tolerant thermostable DyP-type peroxidase from Saccharomonospora viridis DSM 43017 in biobleaching of eucalyptus kraft pulp.

    Directory of Open Access Journals (Sweden)

    Wangning Yu

    Full Text Available Saccharomonospora viridis is a thermophilic actinomycete that may have biotechnological applications because of its dye decolorizing activity, though the enzymatic oxidative system responsible for this activity remains elusive. Bioinformatic analysis revealed a DyP-type peroxidase gene in the genome of S. viridis DSM 43017 with sequence similarity to peroxidase from dye-decolorizing microbes. This gene, svidyp, consists of 1,215 bp encoding a polypeptide of 404 amino acids. The gene encoding SviDyP was cloned, heterologously expressed in Escherichia coli, and then purified. The recombinant protein could efficiently decolorize several triarylmethane dyes, anthraquinonic and azo dyes under neutral to alkaline conditions. The optimum pH and temperature for SviDyP was pH 7.0 and 70°C, respectively. Compared with other DyP-type peroxidases, SviDyP was more active at high temperatures, retaining>63% of its maximum activity at 50-80°C. It also showed broad pH adaptability (>35% activity at pH 4.0-9.0 and alkali-tolerance (>80% activity after incubation at pH 5-10 for 1 h at 37°C, and was highly thermostable (>60% activity after incubation at 70°C for 2 h at pH 7.0. SviDyP had an accelerated action during the biobleaching of eucalyptus kraft pulp, resulting in a 21.8% reduction in kappa number and an increase of 2.98% (ISO in brightness. These favorable properties make SviDyP peroxidase a promising enzyme for use in the pulp and paper industries.

  14. A Single Transcriptome of a Green Toad (Bufo viridis Yields Candidate Genes for Sex Determination and -Differentiation and Non-Anonymous Population Genetic Markers.

    Directory of Open Access Journals (Sweden)

    Jörn F Gerchen

    Full Text Available Large genome size, including immense repetitive and non-coding fractions, still present challenges for capacity, bioinformatics and thus affordability of whole genome sequencing in most amphibians. Here, we test the performance of a single transcriptome to understand whether it can provide a cost-efficient resource for species with large unknown genomes. Using RNA from six different tissues from a single Palearctic green toad (Bufo viridis specimen and Hiseq2000, we obtained 22,5 Mio reads and publish >100,000 unigene sequences. To evaluate efficacy and quality, we first use this data to identify green toad specific candidate genes, known from other vertebrates for their role in sex determination and differentiation. Of a list of 37 genes, the transcriptome yielded 32 (87%, many of which providing the first such data for this non-model anuran species. However, for many of these genes, only fragments could be retrieved. In order to allow also applications to population genetics, we further used the transcriptome for the targeted development of 21 non-anonymous microsatellites and tested them in genetic families and backcrosses. Eleven markers were specifically developed to be located on the B. viridis sex chromosomes; for eight markers we can indeed demonstrate sex-specific transmission in genetic families. Depending on phylogenetic distance, several markers, which are sex-linked in green toads, show high cross-amplification success across the anuran phylogeny, involving nine systematic anuran families. Our data support the view that single transcriptome sequencing (based on multiple tissues provides a reliable genomic resource and cost-efficient method for non-model amphibian species with large genome size and, despite limitations, should be considered as long as genome sequencing remains unaffordable for most species.

  15. Application of a novel alkali-tolerant thermostable DyP-type peroxidase from Saccharomonospora viridis DSM 43017 in biobleaching of eucalyptus kraft pulp.

    Science.gov (United States)

    Yu, Wangning; Liu, Weina; Huang, Huoqing; Zheng, Fei; Wang, Xiaoyu; Wu, Yuying; Li, Kangjia; Xie, Xiangming; Jin, Yi

    2014-01-01

    Saccharomonospora viridis is a thermophilic actinomycete that may have biotechnological applications because of its dye decolorizing activity, though the enzymatic oxidative system responsible for this activity remains elusive. Bioinformatic analysis revealed a DyP-type peroxidase gene in the genome of S. viridis DSM 43017 with sequence similarity to peroxidase from dye-decolorizing microbes. This gene, svidyp, consists of 1,215 bp encoding a polypeptide of 404 amino acids. The gene encoding SviDyP was cloned, heterologously expressed in Escherichia coli, and then purified. The recombinant protein could efficiently decolorize several triarylmethane dyes, anthraquinonic and azo dyes under neutral to alkaline conditions. The optimum pH and temperature for SviDyP was pH 7.0 and 70°C, respectively. Compared with other DyP-type peroxidases, SviDyP was more active at high temperatures, retaining>63% of its maximum activity at 50-80°C. It also showed broad pH adaptability (>35% activity at pH 4.0-9.0) and alkali-tolerance (>80% activity after incubation at pH 5-10 for 1 h at 37°C), and was highly thermostable (>60% activity after incubation at 70°C for 2 h at pH 7.0). SviDyP had an accelerated action during the biobleaching of eucalyptus kraft pulp, resulting in a 21.8% reduction in kappa number and an increase of 2.98% (ISO) in brightness. These favorable properties make SviDyP peroxidase a promising enzyme for use in the pulp and paper industries.

  16. Metalotioninas en Perna viridis (Bivalvia: Mytilidae: variación estacional y su relación con la biología reproductiva

    Directory of Open Access Journals (Sweden)

    Mairin Lemus

    2013-06-01

    Full Text Available Las metalotioninas (Mts son proteínas de baja masa molecular que juegan un rol importante en la detoxificación de metales, en vista de su papel ecotoxicológico se evaluaron las metalotioneínas (MTs en 350 ejemplares del bivalvo Perna viridis en dos localidades de la costa norte del estado Sucre, desde febrero hasta diciembre 2003. Se determinaron los índices biométricos: índice de condición (IC, rendimiento de carne (RC y relación peso seco-talla (PSL. Las Mts fueron separadas por cromatografía de exclusión molecular, Sephadex G-50 y se cuantificaron por saturación con cadmio. Los índices biométricos (RC y PSL mostraron variaciones estacionales, entre localidades y estados de madurez, con la excepción del CI. No se encontraron diferencias significativas entre sexos. Las Mts mostraron variaciones estacionales, con concentraciones más elevadas entre febrero y marzo y mínimos entre septiembre y diciembre, que coincidieron con los períodos de alta y baja productividad en el área, respectivamente. Los mejillones de Río Caribe presentaron una mayor concentración de Mts que los de Chacopata. Los mejillones inmaduros mostraron la mayor concentración de Mts y la más baja en los desovados. Se encontró una relación negativa y significativa entre Mts y CI. Los resultados demuestran que las Mts de Perna viridis están influidas por el índice de condición y la condición reproductiva, asi como también pot los factores físico-químicos del ambiente marino.

  17. Lack of evidence for AT1R/B2R heterodimerization in COS-7, HEK293, and NIH3T3 cells: how common is the AT1R/B2R heterodimer?

    DEFF Research Database (Denmark)

    Hansen, Jakob L; Hansen, Jonas T; Speerschneider, Tobias

    2008-01-01

    It has been suggested previously ( AbdAlla, S., Lother, H., and Quitterer, U. (2000) Nature 407, 94-98 ) that the angiotensin II type 1 receptor (AT1R) and the bradykinin B2 receptor (B2R) form constitutive heterodimers. Furthermore they demonstrate that AT1R signaling significantly increases in ...

  18. Nomenclatural availability of the names applied to “varieties” of the green toad (Bufo viridis subgroup in the Italian territory, with emphasis on the variety lineata of Ninni (Anura: Bufonidae

    Directory of Open Access Journals (Sweden)

    Nicola Novarini

    2010-07-01

    Full Text Available Recent molecular investigations on Eurasian green toads led to the recognition of distinct lineages and to the establishment of new taxa within the former Bufo viridis; as a consequence, significant range-wide nomenclatural changes have been proposed, although some uncertainties remained on the available names applicable within the Italian territory. In order to contribute to clarify the matter, we evaluated, under the provisions of the International Code of Zoological Nomenclature, the nomenclatural availability of all the names that have been applied to infrasubspecific entities of the Bufo viridis subgroup within the Italian territory. We also provided a historical overview of the usage of all these names, as well as detailed information on the original material upon which the variety lineata of A.P. Ninni was established. Our analysis supports the view that only the names crucigera Eichwald, 1831 and balearica Boettger, 1880 are available, the former being however junior synonym of B. viridis Laurenti, 1768, whereas the names acutirostris and obtusirostris of Lessona, lineata of Ninni, concolor and maculata of Camerano, and nardoi of Paolucci, Fuhn and Bruno are all not available.

  19. Heterodimers as the Structural Unit of the T=1 Capsid of the Fungal Double-Stranded RNA Rosellinia necatrix Quadrivirus 1.

    Science.gov (United States)

    Luque, Daniel; Mata, Carlos P; González-Camacho, Fernando; González, José M; Gómez-Blanco, Josué; Alfonso, Carlos; Rivas, Germán; Havens, Wendy M; Kanematsu, Satoko; Suzuki, Nobuhiro; Ghabrial, Said A; Trus, Benes L; Castón, José R

    2016-12-15

    Most double-stranded RNA (dsRNA) viruses are transcribed and replicated in a specialized icosahedral capsid with a T=1 lattice consisting of 60 asymmetric capsid protein (CP) dimers. These capsids help to organize the viral genome and replicative complex(es). They also act as molecular sieves that isolate the virus genome from host defense mechanisms and allow the passage of nucleotides and viral transcripts. Rosellinia necatrix quadrivirus 1 (RnQV1), the type species of the family Quadriviridae, is a dsRNA fungal virus with a multipartite genome consisting of four monocistronic segments (segments 1 to 4). dsRNA-2 and dsRNA-4 encode two CPs (P2 and P4, respectively), which coassemble into ∼450-Å-diameter capsids. We used three-dimensional cryo-electron microscopy combined with complementary biophysical techniques to determine the structures of RnQV1 virion strains W1075 and W1118. RnQV1 has a quadripartite genome, and the capsid is based on a single-shelled T=1 lattice built of P2-P4 dimers. Whereas the RnQV1-W1118 capsid is built of full-length CP, P2 and P4 of RnQV1-W1075 are cleaved into several polypeptides, maintaining the capsid structural organization. RnQV1 heterodimers have a quaternary organization similar to that of homodimers of reoviruses and other dsRNA mycoviruses. The RnQV1 capsid is the first T=1 capsid with a heterodimer as an asymmetric unit reported to date and follows the architectural principle for dsRNA viruses that a 120-subunit capsid is a conserved assembly that supports dsRNA replication and organization. Given their importance to health, members of the family Reoviridae are the basis of most structural and functional studies and provide much of our knowledge of dsRNA viruses. Analysis of bacterial, protozoal, and fungal dsRNA viruses has improved our understanding of their structure, function, and evolution, as well. Here, we studied a dsRNA virus that infects the fungus Rosellinia necatrix, an ascomycete that is pathogenic to a wide

  20. Selective Assembly of Na,K-ATPase α2β2 Heterodimers in the Heart: DISTINCT FUNCTIONAL PROPERTIES AND ISOFORM-SELECTIVE INHIBITORS.

    Science.gov (United States)

    Habeck, Michael; Tokhtaeva, Elmira; Nadav, Yotam; Ben Zeev, Efrat; Ferris, Sean P; Kaufman, Randal J; Bab-Dinitz, Elizabeta; Kaplan, Jack H; Dada, Laura A; Farfel, Zvi; Tal, Daniel M; Katz, Adriana; Sachs, George; Vagin, Olga; Karlish, Steven J D

    2016-10-28

    The Na,K-ATPase α 2 subunit plays a key role in cardiac muscle contraction by regulating intracellular Ca 2+ , whereas α 1 has a more conventional role of maintaining ion homeostasis. The β subunit differentially regulates maturation, trafficking, and activity of α-β heterodimers. It is not known whether the distinct role of α 2 in the heart is related to selective assembly with a particular one of the three β isoforms. We show here by immunofluorescence and co-immunoprecipitation that α 2 is preferentially expressed with β 2 in T-tubules of cardiac myocytes, forming α 2 β 2 heterodimers. We have expressed human α 1 β 1 , α 2 β 1 , α 2 β 2 , and α 2 β 3 in Pichia pastoris, purified the complexes, and compared their functional properties. α 2 β 2 and α 2 β 3 differ significantly from both α 2 β 1 and α 1 β 1 in having a higher K 0.5 K + and lower K 0.5 Na + for activating Na,K-ATPase. These features are the result of a large reduction in binding affinity for extracellular K + and shift of the E 1 P-E 2 P conformational equilibrium toward E 1 P. A screen of perhydro-1,4-oxazepine derivatives of digoxin identified several derivatives (e.g. cyclobutyl) with strongly increased selectivity for inhibition of α 2 β 2 and α 2 β 3 over α 1 β 1 (range 22-33-fold). Molecular modeling suggests a possible basis for isoform selectivity. The preferential assembly, specific T-tubular localization, and low K + affinity of α 2 β 2 could allow an acute response to raised ambient K + concentrations in physiological conditions and explain the importance of α 2 β 2 for cardiac muscle contractility. The high sensitivity of α 2 β 2 to digoxin derivatives explains beneficial effects of cardiac glycosides for treatment of heart failure and potential of α 2 β 2 -selective digoxin derivatives for reducing cardiotoxicity. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  1. Gastric cancer progression may involve a shift in HLA-E profile from an intact heterodimer to β2-microglobulin-free monomer.

    Science.gov (United States)

    Sasaki, Toshiyuki; Ravindranath, Mepur H; Terasaki, Paul I; Freitas, Maria Cecilia; Kawakita, Satoru; Jucaud, Vadim

    2014-04-01

    Phenotypic expression of human leukocyte antigen (HLA)-E on the surface of tumor lesions includes intact heterodimer [HLA-E heavy chain and β2-microglobulin (β2m)] and β2m-free monomer. Anti-HLA-E monoclonal antibodies (mAbs), MEM-E/02 or 3D12 bind to the peptide sequences in β2m-free HLA-E, which is common and shared with HLA-Ia monomers. A newly developed monospecific anti-HLA-E mAb (TFL-033) recognizes HLA-E-restricted peptide sequences on α1 and α2 helices away from β2-m-site. Tumor progression may involve shedding of β2-m from HLA-E or overexpression of β2m-free monomers. There is a need to identify and distinguish the different phenotypic expression of HLA-E, particularly the intact heterodimer from the β2m-free monomer on the surface of tumor lesions. Because of the unique peptide-binding affinities of the mAbs, it is hypothesized that TFL-033 and MEM-E/02 may distinguish the phenotypic expressions of cell surface HLA-E during stages of tumor progression. Only TFL-033 stained diffusely the cytoplasm of normal mucosa. The incidence and intensity of TFL-033 staining of the cell surface in early stages, poorly or undifferentiated and non-nodal lesions and in diffuse carcinoma is greater than that of MEM-E/02. Whereas MEM-E/02 stained terminal stages, adenocarcinoma and lymph node metastatic lesions intensely, either owing to increased expression of β2m-free HLA-E with tumor progression or owing to expression of HLA-Ia molecules. Our study evaluates the relative diagnostic potential of HLA-E-monospecific TFL-033 and the HLA-Ia-reactive MEM-E/02 for determining the specific distribution and immunodiagnosis of different phenotypic expression HLA-E in tumor lesions, and the structural and functional alterations undergone by HLA-E during tumor progression. © 2013 UICC.

  2. Modulation of expression of the nuclear receptor NR0B2 (small heterodimer partner 1 and its impact on proliferation of renal carcinoma cells

    Directory of Open Access Journals (Sweden)

    Prestin K

    2016-08-01

    Full Text Available Katharina Prestin,1,* Maria Olbert,2,* Janine Hussner,1 Tamara L Isenegger,1 Daniel G Gliesche,1 Kerstin Böttcher,2 Uwe Zimmermann,3 Henriette E Meyer zu Schwabedissen1 1Department of Pharmaceutical Sciences, Biopharmacy, University of Basel, Basel, Switzerland; 2Center of Drug Absorption and Transport, Institute of Pharmacology, 3Department of Urology, University Medicine Greifswald, Greifswald, Germany *These authors contributed equally to this work Abstract: Mammalian nuclear receptors (NRs are transcription factors regulating the expression of target genes that play an important role in drug metabolism, transport, and cellular signaling pathways. The orphan and structurally unique receptor small heterodimer partner 1 (syn NR0B2 is not only known for its modulation of drug response, but has also been reported to be involved in hepatocellular carcinogenesis. Indeed, previous studies show that NR0B2 is downregulated in human hepatocellular carcinoma, suggesting that NR0B2 acts as a tumor suppressor via inhibition of cellular growth and activation of apoptosis in this tumor entity. The aim of our study was to elucidate whether NR0B2 may also play a role in other tumor entities. Comparing NR0B2 expression in renal cell carcinoma and adjacent nonmalignant transformed tissue revealed significant downregulation in vivo. Additionally, the impact of heterologous expression of NR0B2 on cell cycle progression and proliferation in cells of renal origin was characterized. Monitoring fluorescence intensity of resazurin turnover in RCC-EW cells revealed no significant differences in metabolic activity in the presence of NR0B2. However, there was a significant decrease of cellular proliferation in cells overexpressing this NR, and NR0B2 was more efficient than currently used antiproliferative agents. Furthermore, flow cytometry analysis showed that heterologous overexpression of NR0B2 significantly reduced the amount of cells passing the G1 phase, while on

  3. Changes in growth, carbon and nitrogen enzyme activity and mRNA accumulation in the halophilic microalga Dunaliella viridis in response to NaCl stress

    Science.gov (United States)

    Wang, Dongmei; Wang, Weiwei; Xu, Nianjun; Sun, Xue

    2016-12-01

    Many species of microalga Dunaliella exhibit a remarkable tolerance to salinity and are therefore ideal for probing the effects of salinity. In this work, we assessed the effects of NaCl stress on the growth, activity and mRNA level of carbon and nitrogen metabolism enzymes of D. viridis. The alga could grow over a salinity range of 0.44 mol L-1 to 3.00 mol L-1 NaCl, but the most rapid growth was observed at 1.00 mol L-1 NaCl, followed by 2.00 mol L-1 NaCl. Paralleling these growth patterns, the highest initial and total Rubisco activities were detected in the presence of 1.00 mol L-1 NaCl, decreasing to 37.33% and 26.39% of those values, respectively, in the presence of 3.00 mol L-1 NaCl, respectively. However, the highest extracellular carbonic anhydrase (CA) activity was measured in the presence of 2.00 mol L-1 NaCl, followed by 1.00 mol L-1 NaCl. Different from the two carbon enzymes, nitrate reductase (NR) activity showed a slight change under different NaCl concentrations. At the transcriptional level, the mRNAs of Rubisco large subunit ( rbcL), and small subunit ( rbcS), attained their highest abundances in the presence of 1.00 and 2.00 mol L-1 NaCl, respectively. The CA mRNA accumulation was induced from 0.44 mol L-1 to 3.00 mol L-1 NaCl, but the NR mRNA showed the decreasing tendency with the increasing salinity. In conclusion, the growth and carbon fixation enzyme of Rubisco displayed similar tendency in response to NaCl stress, CA was proved be salt-inducible within a certain salinity range and NR showed the least effect by NaCl in D. viridis.

  4. Hydrogen/deuterium exchange reveals distinct agonist/partial agonist receptor dynamics within vitamin D receptor/retinoid X receptor heterodimer.

    Science.gov (United States)

    Zhang, Jun; Chalmers, Michael J; Stayrook, Keith R; Burris, Lorri L; Garcia-Ordonez, Ruben D; Pascal, Bruce D; Burris, Thomas P; Dodge, Jeffery A; Griffin, Patrick R

    2010-10-13

    Regulation of nuclear receptor (NR) activity is driven by alterations in the conformational dynamics of the receptor upon ligand binding. Previously, we demonstrated that hydrogen/deuterium exchange (HDX) can be applied to determine novel mechanism of action of PPARγ ligands and in predicting tissue specificity of selective estrogen receptor modulators. Here, we applied HDX to probe the conformational dynamics of the ligand binding domain (LBD) of the vitamin D receptor (VDR) upon binding its natural ligand 1α,25-dihydroxyvitamin D3 (1,25D3), and two analogs, alfacalcidol and ED-71. Comparison of HDX profiles from ligands in complex with the LBD with full-length receptor bound to its cognate receptor retinoid X receptor (RXR) revealed unique receptor dynamics that could not be inferred from static crystal structures. These results demonstrate that ligands modulate the dynamics of the heterodimer interface as well as provide insight into the role of AF-2 dynamics in the action of VDR partial agonists. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Hydrogen/Deuterium Exchange Reveals Distinct Agonist/Partial Agonist Receptor Dynamics within the intact Vitamin D Receptor/Retinoid X Receptor Heterodimer

    Science.gov (United States)

    Zhang, Jun; Chalmers, Michael J.; Stayrook, Keith R.; Burris, Lorri L.; Garcia-Ordonez, Ruben D.; Pascal, Bruce D.; Burris, Thomas P.; Dodge, Jeffery A.; Griffin, Patrick R.

    2010-01-01

    Summary Regulation of nuclear receptor (NR) activity is driven by alterations in the conformational dynamics of the receptor upon ligand binding. Previously we demonstrated that hydrogen/deuterium exchange (HDX) can be applied to determine novel mechanism of action of PPARγ ligands and in predicting tissue specificity of selective estrogen receptor modulators. Here we applied HDX to probe the conformational dynamics of the ligand binding domain (LBD) of the vitamin D receptor (VDR) upon binding its natural ligand 1α,25-dihydroxyvitamin D3 (1,25D3), and two analogs, alfacalcidol and ED-71. Comparison of HDX profiles from ligands in complex with the LBD with full-length receptor bound to its cognate receptor retinoid X receptor (RXR) revealed unique receptor dynamics that could not be inferred from static crystal structures. These results demonstrate that ligands modulate the dynamics of the heterodimer interface as well as providing insight into the role of AF-2 dynamics in the action of VDR partial agonists. PMID:20947021

  6. Use of antibodies against the variable regions of the T-cell receptor alpha/beta heterodimer for the study of cutaneous T-cell lymphomas.

    Science.gov (United States)

    Ralfkiaer, E; Wollf-Sneedorff, A; Vejlsgaard, G L

    1991-11-01

    Recent studies have suggested that antibodies against the variable (V) regions of the T-cell antigen receptor (TCR) may be used as markers for clonality and malignancy in T-cell infiltrates. We have investigated this by examining biopsy samples from 45 patients with cutaneous T-cell lymphomas (CTCL) for reactivity with seven antibodies against different V-gene families on the TCR alpha/beta heterodimer, i.e. ICI (V beta 5a), W112 (V beta 5b), OT145 (V beta 6a), 16G8 (V beta 8a), S511 (V beta 12a), F1 (V alpha 2a) and LC4 (alpha beta Va). Serial biopsies were available in 13 patients and a total of 62 samples were studied. The neoplastic cells in five cases were positive for either V beta 5 (one case), V beta 6 (one case), V beta 8 (two cases) or V beta 12 (one case). In the remaining 40 cases, no staining was seen of the neoplastic cells. These findings indicate that while antibodies against the TCR V-regions may be used as clonotypic markers for certain T-cell neoplasms, there is as yet not a sufficient number of anti-TCR V-region antibodies available for the routine diagnosis of these conditions.

  7. The X-Ray Crystal Structure of the Keratin 1-Keratin 10 Helix 2B Heterodimer Reveals Molecular Surface Properties and Biochemical Insights into Human Skin Disease

    Energy Technology Data Exchange (ETDEWEB)

    Bunick, Christopher G.; Milstone, Leonard M.

    2017-01-01

    Keratins 1 (K1) and 10 (K10) are the primary keratins expressed in differentiated epidermis. Mutations in K1/K10 are associated with human skin diseases. We determined the crystal structure of the complex between the distal (2B) helices of K1 and K10 to better understand how human keratin structure correlates with function. The 3.3 Å resolution structure confirms many features inferred by previous biochemical analyses, but adds unexpected insights. It demonstrates a parallel, coiled-coil heterodimer with a predominantly hydrophobic intermolecular interface; this heterodimer formed a higher order complex with a second K1-K10-2B heterodimer via a Cys401K10 disulfide link, although the bond angle is unanticipated. The molecular surface analysis of K1-K10-2B identified several pockets, one adjacent to the disulfide linkage and conserved in K5-K14. The solvent accessible surface area of the K1-K10 structure is 20–25% hydrophobic. The 2B region contains mixed acidic and basic patches proximally (N-terminal), whereas it is largely acidic distally (C-terminal). Mapping of conserved and nonconserved residues between K1-K10 and K5-K14 onto the structure demonstrated the majority of unique residues align along the outer helical ridge. Finally, the structure permitted a fresh analysis of the deleterious effects caused by K1/K10 missense mutations found in patients with phenotypic skin disease.

  8. Habitat degradation correlates with tolerance to climate-change related stressors in the green mussel Perna viridis from West Java, Indonesia.

    Science.gov (United States)

    Wendling, Carolin Charlotte; Huhn, Mareike; Ayu, Nurina; Bachtiar, Ramadian; von Juterzenka, Karen; Lenz, Mark

    2013-06-15

    It is unclear whether habitat degradation correlates with tolerance of marine invertebrates to abiotic stress. We therefore tested whether resistance to climate change-related stressors differs between populations of the green mussel Perna viridis from a heavily impacted and a mostly pristine site in West Java, Indonesia. In laboratory experiments, we compared their oxygen consumption and mortality under lowered salinity (-13 and -18 units, both responses), hypoxia (0.5 mg/l, mortality only) and thermal stress (+7 °C, mortality only). Mussels from the eutrophied and polluted Jakarta Bay showed a significantly smaller deviation from their normal oxygen consumption and higher survival rates when stressed than their conspecifics from the unaffected Lada Bay. This shows that human induced habitat degradation correlates with mussel tolerance to environmental stress. We discuss possible mechanisms - e.g. the selection of tolerant genotypes or habitat-specific differences in the nutritional status of the mussels - that could explain our observation. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. Depuration Study of Heavy Metal Lead (Pb) and Copper (Cu) in Green Mussels Perna viridis through Continues-discontinues and Acid Extraction Methods

    Science.gov (United States)

    Budiawan; Bakri, Ridla; Cahaya Dani, Intan; Handayani, Sri; Ade Kurnia Putri, Rizki; Tamala, Riska

    2018-01-01

    Green mussel or Perna viridis is filter feeder, which is very susceptible to heavy metals. It takes an effort to release heavy metal contents on the green shell, one of method that can be used to release heavy metal from green shell is depuration proccess. In this research, the depuration process was conducted by continues method of depuration, discontinues method by using various kind of water and acid extraction. The optimum time of continues depuration method is 1.5 hours, with circulation speed 250 L/h and result of Pb metal content decreased is equal to 30.048% and 29.748% for Cu. In the discontinues method, the optimum result was reached at 100oC by using PAM water as the media at 3 h immersion period with decrease of Pb metal content 35.001% and Cu metal content 39.015%. In the acid extraction method, the optimum condition was achieved by 11% acetic acid solvent with decreasing of Pb and Cu levels are 88.224% and 76.298%. For the determination of protein content, the decrease of protein content obtained by treatment with 11% acetic acid extract showed decrease of protein content 36.656% with Kjeldahl method.

  10. Differential proteomic responses in hepatopancreas and adductor muscles of the green-lipped mussel Perna viridis to stresses induced by cadmium and hydrogen peroxide

    Energy Technology Data Exchange (ETDEWEB)

    Leung, Priscilla T.Y. [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Wang Yu [Department of Pharmacology and Pharmacy, University of Hong Kong, Sassoon Road, Hong Kong (Hong Kong); Mak, Sarah S.T.; Ng, W.C. [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Leung, Kenneth M.Y., E-mail: kmyleung@hkucc.hku.hk [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong)

    2011-09-15

    This study aimed to reveal the proteomic responses in the hepatopancreas and adductor muscle of a common biomonitor, Perna viridis after 14-day exposure to two model chemicals, cadmium (Cd; a toxic metal) and hydrogen peroxide (H{sub 2}O{sub 2}; a pro-oxidant), using two-dimensional gel electrophoresis coupled with multivariate statistical analyses. Unique sets of tissue-specific protein expression signatures were revealed corresponding to the two treatment groups. In the hepatopancreas, 15 and 2 spots responded to Cd and H{sub 2}O{sub 2} treatments respectively. 6 and 7 spots were differentially expressed in the adductor muscle for Cd and H{sub 2}O{sub 2} treatments, respectively. 15 differentially expressed spots were successfully identified by MALDI-TOF/TOF MS analysis. These proteins are involved in glycolysis, amino acid metabolism, energy homeostasis, oxidative stress response, redox homeostasis and protein folding, heat-shock response, and muscle contraction modulation. This is the first time, to have demonstrated that Cd exposure not only leads to substantial oxidative stress but also results in endoplasmic reticulum stress in hepatopancreas of the mussel. Such notable stress responses may be attributable to high Cd accumulation in this tissue. Our results suggested that investigations on these stress-associated protein changes could be used as a new and complementary approach in pollution monitoring by this popular biomonitor species.

  11. Computed tomography of the lung of healthy snakes of the species Python regius, Boa constrictor, Python reticulatus, Morelia viridis, Epicrates cenchria, and Morelia spilota.

    Science.gov (United States)

    Pees, Michael; Kiefer, Ingmar; Thielebein, Jens; Oechtering, Gerhard; Krautwald-Junghanns, Maria-Elisabeth

    2009-01-01

    Thirty-nine healthy boid snakes representing six different species (Python regius, Boa constrictor, Python reticulatus, Morelia viridis, Epicrates cenchria, and Morelia spilota) were examined using computed tomography (CT) to characterize the normal appearance of the respiratory tissue. Assessment was done subjectively and densitometry was performed using a defined protocol. The length of the right lung was calculated to be 11.1% of the body length, without a significant difference between species. The length of the left lung in proportion to the right was dependent on the species examined. The most developed left lung was in P. regius (81.2%), whereas in B. constrictor, the left lung was vestigial or absent (24.7%). A median attenuation of -814.6 HU and a variability of 45.9 HU were calculated for all species with no significant difference between species. Within the species, a significantly higher attenuation was found for P. regius in the dorsal and cranial aspect of the lung compared with the ventral and caudal part. In B. constrictor, the reduced left lung was significantly hyperattenuating compared with the right lung. Results of this study emphasize the value of CT and provide basic reference data for assessment of the snake lung in these species. Veterinary Radiology &

  12. Role of a Novel Human Leukocyte Antigen-DQA1*01:02;DRB1*15:01 Mixed Isotype Heterodimer in the Pathogenesis of “Humanized” Multiple Sclerosis-like Disease*

    Science.gov (United States)

    Kaushansky, Nathali; Eisenstein, Miriam; Boura-Halfon, Sigalit; Hansen, Bjarke Endel; Nielsen, Claus Henrik; Milo, Ron; Zeilig, Gabriel; Lassmann, Hans; Altmann, Daniel M.; Ben-Nun, Avraham

    2015-01-01

    Gene-wide association and candidate gene studies indicate that the greatest effect on multiple sclerosis (MS) risk is driven by the HLA-DRB1*15:01 allele within the HLA-DR15 haplotype (HLA-DRB1*15:01-DQA1*01:02-DQB1*0602-DRB5*01:01). Nevertheless, linkage disequilibrium makes it difficult to define, without functional studies, whether the functionally relevant effect derives from DRB1*15:01 only, from its neighboring DQA1*01:02-DQB1*06:02 or DRB5*01:01 genes of HLA-DR15 haplotype, or from their combinations or epistatic interactions. Here, we analyzed the impact of the different HLA-DR15 haplotype alleles on disease susceptibility in a new “humanized” model of MS induced in HLA-transgenic (Tg) mice by human oligodendrocyte-specific protein (OSP)/claudin-11 (hOSP), one of the bona fide potential primary target antigens in MS. We show that the hOSP-associated MS-like disease is dominated by the DRB1*15:01 allele not only as the DRA1*01:01;DRB1*15:01 isotypic heterodimer but also, unexpectedly, as a functional DQA1*01:02;DRB1*15:01 mixed isotype heterodimer. The contribution of HLA-DQA1/DRB1 mixed isotype heterodimer to OSP pathogenesis was revealed in (DRB1*1501xDQB1*0602)F1 double-Tg mice immunized with hOSP(142–161) peptide, where the encephalitogenic potential of prevalent DRB1*1501/hOSP(142–161)-reactive Th1/Th17 cells is hindered due to a single amino acid difference in the OSP(142–161) region between humans and mice; this impedes binding of DRB1*1501 to the mouse OSP(142–161) epitope in the mouse CNS while exposing functional binding of mouse OSP(142–161) to DQA1*01:02;DRB1*15:01 mixed isotype heterodimer. This study, which shows for the first time a functional HLA-DQA1/DRB1 mixed isotype heterodimer and its potential association with disease susceptibility, provides a rationale for a potential effect on MS risk from DQA1*01:02 through functional DQA1*01:02;DRB1*15:01 antigen presentation. Furthermore, it highlights a potential contribution to MS

  13. Lettuce-produced hepatitis C virus E1E2 heterodimer triggers immune responses in mice and antibody production after oral vaccination.

    Science.gov (United States)

    Clarke, Jihong Liu; Paruch, Lisa; Dobrica, Mihaela-Olivia; Caras, Iuliana; Tucureanu, Catalin; Onu, Adrian; Ciulean, Sonya; Stavaru, Crina; Eerde, Andre; Wang, Yanliang; Steen, Hege; Haugslien, Sissel; Petrareanu, Catalina; Lazar, Catalin; Popescu, Costin-Ioan; Bock, Ralph; Dubuisson, Jean; Branza-Nichita, Norica

    2017-12-01

    The hepatitis C virus (HCV) is a major etiologic agent for severe liver diseases (e.g. cirrhosis, fibrosis and hepatocellular carcinoma). Approximately 140 million people have chronic HCV infections and about 500 000 die yearly from HCV-related liver pathologies. To date, there is no licensed vaccine available to prevent HCV infection and production of a HCV vaccine remains a major challenge. Here, we report the successful production of the HCV E1E2 heterodimer, an important vaccine candidate, in an edible crop (lettuce, Lactuca sativa) using Agrobacterium-mediated transient expression technology. The wild-type dimer (E1E2) and a variant without an N-glycosylation site in the E2 polypeptide (E1E2∆N6) were expressed, and appropriate N-glycosylation pattern and functionality of the E1E2 dimers were demonstrated. The humoral immune response induced by the HCV proteins was investigated in mice following oral administration of lettuce antigens with or without previous intramuscular prime with the mammalian HEK293T cell-expressed HCV dimer. Immunization by oral feeding only resulted in development of weak serum levels of anti-HCV IgM for both antigens; however, the E1E2∆N6 proteins produced higher amounts of secretory IgA, suggesting improved immunogenic properties of the N-glycosylation mutant. The mice group receiving the intramuscular injection followed by two oral boosts with the lettuce E1E2 dimer developed a systemic but also a mucosal immune response, as demonstrated by the presence of anti-HCV secretory IgA in faeces extracts. In summary, our study demonstrates the feasibility of producing complex viral antigens in lettuce, using plant transient expression technology, with great potential for future low-cost oral vaccine development. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and the Association of Applied Biologists and John Wiley & Sons Ltd.

  14. Infectivity inhibition by overlapping synthetic peptides derived from the gH/gL heterodimer of herpes simplex virus type 1.

    Science.gov (United States)

    Franci, Gianluigi; Falanga, Annarita; Zannella, Carla; Folliero, Veronica; Martora, Francesca; Galdiero, Marilena; Galdiero, Stefania; Morelli, Giancarlo; Galdiero, Massimiliano

    2017-04-01

    Herpes simplex virus (HSV) is a human pathogen that infects epithelial cells. The cutaneous lesions, caused by the virus, spread to the nervous system creating several complications. Fusion of host membranes with the viral envelope is mandatory and mediated by a group of glycoproteins conserved in all Herpesviridae subfamilies, such as the glycoproteins B (gB), H (gH), L (gL) and D (gD). We investigated the inhibitory activity mediated by synthetic overlapping peptides spanning the entire ectodomains of gH and gL glycoproteins. We have performed a brute analysis of the complete gH/gL heterodimer in order to explore the inhibitory activity of peptides modelled on these glycoproteins against HSV-1 infection. Twenty-four of the gH peptides at a concentration of 150 μM reached the 50% of inhibition cut-off. Interestingly, they are mainly located in the gH carboxy-terminal domain. None of the gL peptides had a clear inhibiting effect. No peptide toxicity was observed by lactate dehydrogenase assay at the concentrations used in our experimental conditions. HSV-1 therapy is based on acyclovir treatment, but some resistant strains are emerging. In this scenario, innovative approaches for HSV-1 treatment are necessary. Our data support the direct involvement of the described domains in the process of virus penetration; therefore, these results are of relevance to the potential development of novel therapeutic compounds to prevent HSV-1 infections. Copyright © 2017 European Peptide Society and John Wiley & Sons, Ltd. Copyright © 2017 European Peptide Society and John Wiley & Sons, Ltd.

  15. Crecimiento del mejillón verde Perna viridis (Bivalvia: Mytilidae bajo sistema de cultivo de fondo en la ensenada de Turpialito, Golfo de Cariaco, Venezuela Growth and survival of the green mussel P. viridis (Bivalvia: Mytilidae in bottom culture conditions in Turpialito, Golfo de Cariaco, Venezuela

    Directory of Open Access Journals (Sweden)

    Vanessa Acosta

    2012-12-01

    Full Text Available Los moluscos representan uno de los grupos más importantes desde el punto de vista económico en la acuicultura marina, debido a los bajos costos de producción y a su alta rentabilidad. En este estudio se planteó probar la hipótesis de un mayor crecimiento de Perna viridis en cultivo de fondo, por un mejor aprovechamiento de alimento presente en el medio, lo cual permitirá descartarla o no como especie de cultivo para el Golfo de Cariaco. En este sentido, se evaluó el crecimiento y la supervivencia del mejillón verde P. viridis en condiciones de cultivo de fondo entre julio 2007 y febrero 2008. Las semillas del mejillón (35.81±1.41mm de longitud fueron obtenidas en la localidad de Guaca (costa norte del estado Sucre y trasladadas hasta la Estación Hidrobiológica de Turpialito, golfo de Cariaco, estado Sucre-Venezuela, en donde se sembraron en cestas “españolas”. Mensualmente se determinó supervivencia así como la longitud máxima de la concha, la masa seca del músculo, resto de tejidos y de la gónada. Los parámetros ambientales (temperatura del agua, salinidad, oxígeno disuelto, clorofila a, seston total y su fracción orgánica, en la zona de cultivo se determinaron cada 15 días. Mensualmente se realizaron determinaciones de proteínas, lípidos y carbohidratos al seston. Durante todo el estudio el mejillón mantuvo un crecimiento continuo, alcanzando al final una longitud máxima de 78.7±4.43mm. Sin embargo, la tasa de crecimiento de la masa seca de los tejidos somáticos (músculo, resto de tejido y reproductivo, mostraron variabilidad a lo largo del estudio, produciéndose al final un incremento significativo en dichos tejidos. Las variaciones observadas en la tasa de crecimiento de la masa del tejido reproductivo, dependió de las reservas acumuladas y del alimento ofertado por el medio ambiente. El seston orgánico durante toda la experiencia mostró una independencia de la temperatura y de la clorofila a

  16. Identification of fruit volatiles from green hawthorn (Crataegus viridis) and blueberry hawthorn (Crataegus brachyacantha) host plants attractive to different phenotypes of Rhagoletis pomonella flies in the southern United States.

    Science.gov (United States)

    Cha, Dong H; Powell, Thomas H Q; Feder, Jeffrey L; Linn, Charles E

    2011-09-01

    The apple maggot fly, Rhagoletis pomonella, infests several hawthorn species in the southern USA. In a companion paper, we showed that R. pomonella flies infesting two different mayhaw species (Crataegus opaca and C. aestivalis) can discriminate between volatile blends developed for each host fruit, and that these blends are different from previously constructed blends for northern fly populations that infest domestic apple (Malus domestica), downy hawthorn (Crataegus mollis), and flowering dogwood (Cornus florida). Here, we show by using coupled gas chromatography and electroantennographic detection (GC-EAD), gas chromatography with mass spectrometry (GC-MS), and flight tunnel bioassays, that two additional southern hawthorn fly populations infesting C. viridis (green hawthorn) and C. brachyacantha (blueberry hawthorn) also can discriminate between volatile blends for each host fruit type. A 9-component blend was developed for C. viridis (3-methylbutan-1-ol [5%], butyl butanoate [19.5%], propyl hexanoate [1.5%], butyl hexanoate [24%], hexyl butanoate [24%], pentyl hexanoate [2.5%], 1-octen-3-ol [0.5%], pentyl butanoate [2.5%], and (3E)-4,8-dimethyl-1,3,7-nonatriene (DMNT) [20.5%]) and an 8-component blend for C. brachyacantha (3-methylbutan-1-ol [0.6%], butyl acetate [50%], pentyl acetate [3.5%], butyl butanoate [9%], butyl hexanoate [16.8%], hexyl butanoate [16.8%], 1-octen-3-ol [0.3%], and pentyl butanoate [3%]). Crataegus viridis and C. brachyacantha-origin flies showed significantly higher levels of upwind oriented flight to their natal blend in flight tunnel assays compared to the alternate, non-natal blend and previously developed northern host plant blends. The presence of DMNT in C. viridis and butyl acetate in C. brachyacantha appeared to be largely responsible for driving the differential response. This sharp behavioral distinction underscores the diversity of odor response phenotypes in the southern USA, points to possible host race formation in these

  17. Neuro-endocrine effects of aqueous extract of Amaranthus viridis (Linn. leaf in male Wistar rat model of cyclophosphamide-induced reproductive toxicity

    Directory of Open Access Journals (Sweden)

    Ayoka Oladele Abiodun

    2016-01-01

    Full Text Available Cyclophosphamide (CP is a widely used cytotoxic alkylating agent with antitumor and immunosuppressant properties that is associated with various forms of reproductive toxicity. The significance of natural antioxidants of plant origin should be explored, especially in a world with increasing incidence of patients in need of chemotherapy. The neuro-endocrine effects of aqueous extract of Amaranthus viridis (Linn. leaf (AEAVL in Wistar rats with CP-induced reproductive toxicity was determined. Forty rats were used for this study such that graded doses of the extract were administered following CP-induced reproductive toxicity and comparisons were made against control, toxic and standard (vitamin E groups at p < 0.05. The synthetic drugs (CP, 65 mg/kg i.p. for 5 days; Vitamin E, 100 mg/kg p.o. for 30 days as well as the extract (100, 200 and 400 mg/kg p.o. for 30 days were administered to the rats at 0.2 mL/100 g. CP induced reproductive toxicity as evidenced by significantly lowered levels of FSH, LH and testosterone, perturbation of sperm characterization, deleterious disruptions of the antioxidant system as evidenced by decreased levels of GSH as well as elevation of TBARS activity. Histopathological examination showed hemorrhagic lesions with scanty and hypertrophied parenchymal cells in the pituitary while the testis showed ballooned seminiferous tubules with loosed connective tissues and vacuolation of testicular interstitium. These conditions were significantly reversed (p < 0.05 following administration of the graded doses of the extract. It was, therefore, concluded that AEAVL could potentially be a therapeutic choice in patients with CP-induced neuro-endocrine dysfunction and reproductive toxicity.

  18. Seasonal variation in antioxidative responses and acetylcholinesterase activity in Perna viridis in eastern oceanic and western estuarine waters of Hong Kong

    Science.gov (United States)

    Lau, P. S.; Wong, H. L.; Garrigues, Ph.

    2004-10-01

    A year-round study was conducted to assess the seasonal variations and potential influence of the riverine discharge from the Pearl River on biomarker responses in Hong Kong waters. A suite of biomarkers including antioxidant enzymes superoxide dismutase (SOD), catalase (CAT), the lipid peroxidation product malondialdehyde (MDA), a Phase II detoxification enzyme glutathione-S-transferase (GST) and the neural transmitter enzyme acetylcholinesterase (AChE) in the green mussel, Perna viridis, were monitored from three coastal sites, Port Shelter, Tung Chung and Tai O, stretching from the east to the west of Hong Kong. Despite of the seasonal variations, the total protein profiles suggested that mussels from the three sites had a growth cycle that was in phase with each other. This implied that intrinsic variation between sites due to a different phase of growth was minimal. Seasonal variations of the biomarker responses in the mussels were found to be significant (Tukey multiple comparison test, pbiomarker responses at Tai O in relation to the extreme low salinity of 8‰. Mussels from the western site also revealed a higher oxidative stress than those from the eastern side throughout the year (Tukey multiple comparison test, pbiomarker responses. Gill tissues of the mussels were more advantageous for biomarker studies or monitoring because their protein levels were less sensitive to seasonal variations and they yielded a higher protein normalized biomarker response than the whole body tissues. This increases their discrimination ability for site comparisons. The feasibility of biomarker monitoring in areas of sub-lethal or low chemical contamination will also be discussed.

  19. De novo assembly and comparative transcriptome analysis of the foot from Chinese green mussel (Perna viridis in response to cadmium stimulation.

    Directory of Open Access Journals (Sweden)

    Xinhui Zhang

    Full Text Available The Chinese green mussel, Perna viridis, is a marine bivalve with important economic values as well as biomonitoring roles for aquatic pollution. Byssus, secreted by the foot gland, has been proved to bind heavy metals effectively. In this study, using the RNA sequencing technology, we performed comparative transcriptomic analysis on the mussel feet with or without inducing by cadmium (Cd. Our current work is aiming at providing insights into the molecular mechanisms of byssus binding to heavy metal ions. The transcriptome sequencing generated a total of 26.13-Gb raw data. After a careful assembly of clean data, we obtained a primary set of 105,127 unigenes, in which 32,268 unigenes were annotated. Based on the expression profiles, we identified 9,048 differentially expressed genes (DEGs between Cd treatment (50 or 100 μg/L at 48 h and the control, suggesting an extensive transcriptome response of the mussels during the Cd stimulation. Moreover, we observed that the expression levels of 54 byssus protein coding genes increased significantly after the 48-h Cd stimulation. In addition, 16 critical byssus protein coding genes were picked for profiling by quantitative real-time PCR (qRT-PCR. Finally, we reached a primary conclusion that high content of tyrosine (Tyr, cysteine (Cys, histidine (His residues or the special motif plays an important role in the accumulation of heavy metals in byssus. We also proposed an interesting model for the confirmed byssal Cd accumulation, in which biosynthesis of byssus proteins may play simultaneously critical roles since their transcription levels were significantly elevated.

  20. The complete chloroplast DNA sequence of the green alga Oltmannsiellopsis viridis reveals a distinctive quadripartite architecture in the chloroplast genome of early diverging ulvophytes

    Directory of Open Access Journals (Sweden)

    Lemieux Claude

    2006-02-01

    Full Text Available Abstract Background The phylum Chlorophyta contains the majority of the green algae and is divided into four classes. The basal position of the Prasinophyceae has been well documented, but the divergence order of the Ulvophyceae, Trebouxiophyceae and Chlorophyceae is currently debated. The four complete chloroplast DNA (cpDNA sequences presently available for representatives of these classes have revealed extensive variability in overall structure, gene content, intron composition and gene order. The chloroplast genome of Pseudendoclonium (Ulvophyceae, in particular, is characterized by an atypical quadripartite architecture that deviates from the ancestral type by a large inverted repeat (IR featuring an inverted rRNA operon and a small single-copy (SSC region containing 14 genes normally found in the large single-copy (LSC region. To gain insights into the nature of the events that led to the reorganization of the chloroplast genome in the Ulvophyceae, we have determined the complete cpDNA sequence of Oltmannsiellopsis viridis, a representative of a distinct, early diverging lineage. Results The 151,933 bp IR-containing genome of Oltmannsiellopsis differs considerably from Pseudendoclonium and other chlorophyte cpDNAs in intron content and gene order, but shares close similarities with its ulvophyte homologue at the levels of quadripartite architecture, gene content and gene density. Oltmannsiellopsis cpDNA encodes 105 genes, contains five group I introns, and features many short dispersed repeats. As in Pseudendoclonium cpDNA, the rRNA genes in the IR are transcribed toward the single copy region featuring the genes typically found in the ancestral LSC region, and the opposite single copy region harbours genes characteristic of both the ancestral SSC and LSC regions. The 52 genes that were transferred from the ancestral LSC to SSC region include 12 of those observed in Pseudendoclonium cpDNA. Surprisingly, the overall gene organization of

  1. Diferenças morfológicas entre Amaranthus cruentus, cv. BRS Alegria, e as plantas daninhas A. hybridus, A. retroflexus, A. viridis e A. spinosus Morphological differences between Amaranthus cruentus, cv. BRS Alegria, and the weed species A. hybridus, A. retroflexus, A. viridis and A. spinosus

    Directory of Open Access Journals (Sweden)

    C.R. Spehar

    2003-12-01

    Full Text Available O pseudocereal amaranto, com as espécies Amaranthus caudatus, A. cruentus e A. hypochondriacus, domesticado pelas populações indígenas antes que a América fosse descoberta, tem se adaptado aos sistemas produtivos dos cerrados. A planta apresenta panículas apicais, divididas em pequenos ramos com frutos do tipo pixídio, com uma semente cada. Estas germinam rapidamente em presença de umidade, após atingirem a maturação fisiológica. No início da fase vegetativa, o amaranto cultivado pode confundir-se com espécies de plantas daninhas do mesmo gênero (A. hybridus, A. retroflexus, A. viridis e A. spinosus, as quais estão associadas à expansão agrícola. As diferenças morfológicas tornam-se mais visíveis após o florescimento: ramificações com flores axilares e terminais, em contraste com o amaranto, no qual a inflorescência (panícula é apical; as sementes claras das espécies cultivadas contrastam com as das invasoras, que são escuras. BRS Alegria (A. cruentus, cultivar pioneiro no Brasil, apresenta plantas com 180 cm, das quais a panícula ocupa 48 cm; maturação fisiológica aos 90 dias; resistência ao acamamento; e 0,68 g por 1.000 sementes, com produção de 2,3 t ha¹ (sementes e 5,6 t ha-1 (biomassa total. As sementes nas plantas daninhas são menores, germinam gradativamente e podem permanecer no solo por muitos anos, infestando as áreas. As diferenças morfológicas detectadas na experimentação demonstram que as espécies são distinguíveis; elas contribuem para orientar a produção de sementes e o cultivo comercial de amaranto, enfatizando as características de adaptação, em contraste com as das invasoras do mesmo gênero botânico.The pseudocereal grain amaranth, with the species Amaranthus caudatus, A. ruentus e A. hypochondriacus, domesticated by indigenous populations before America was discovered, has shown adaptability to production systems in the Brazilian savannah. The plants present apical

  2. Estabilidad temporal de las infracomunidades de parásitos en la borrachilla Scartichthys viridis (Valenciennes, 1836 (Pisces : Blenniidae en la costa central de Chile Temporal stability in parasite infracommunities of the blenny Scartichthys viridis(Valenciennes, 1836 (Pisces: Blenniidae on the central coast of Chile

    Directory of Open Access Journals (Sweden)

    FREDDY DÍAZ

    2002-12-01

    Full Text Available Se comparan las infracomunidades de parásitos de la borrachilla Scartichthys viridis (Pisces: Blenniidae de tres muestras tomadas en un lapso de 17 meses, entre 1999 y 2001, desde pozas intermareales vecinas a Las Cruces (33°27' S, 71°37' O, Chile central. El objetivo es averiguar si la riqueza, diversidad, abundancia y composición de las infracomunidades de parásitos son persistentes o no en el tiempo ontogenético y cronológico. Se recolectaron 10 taxa parasitarios en cerca del 89 % de los 63 huéspedes examinados, de los cuales ocho eran metazoarios. La búsqueda de protozoos se realizó sólo en los últimos 2 años. El 75 % de los ocho taxa de metazoos ocurrieron en los tres años, uno no estuvo presente en un año, y otro fue encontrado solamente en un año. La mayoría de los huéspedes examinados albergaba protozoos parásitos. La prevalencia de los protozoos Cryptobia sp. fue alta para ambos años, y menor en Trichodina sp. La longitud total de los huéspedes era un predictor relevante de las variaciones en la riqueza, abundancia, diversidad y composición infracomunitaria en el conjunto de los tres años. En cambio, el año de muestreo no lo fue, en particular al comparar entre huéspedes de similar longitud total. Estos resultados son similares a los encontrados en infracomunidades de parásitos de otras especies de peces en Chile, en que hay baja variabilidad en las propiedades agregadas de las infracomunidades en el tiempo cronológico. Se discute acerca de la extensión relativa del tiempo ontogenético en contraste al tiempo cronológico al ser probablemente ambos de importancia en las características de las infracomunidades, y se propone que se explore la medida en la cual estos resultados constituyen un patrón.Parasite infracommunities of the blenny Scartichthys viridis (Pisces: Blenniidae are compared among three samples taken within a 17-month period during three consecutive years (1999-2001, from intertidal pools at

  3. Radiation Dose and Risk Assessments from Polonium-210 in Green Mussels (Perna viridis) and Seafood Consumers Living nearby the Industrial Area in Chonburi Province, Thailand

    Energy Technology Data Exchange (ETDEWEB)

    Tumnoi, Y.; Phaopeng, N. [Office of Atoms for Peace - OAP (Thailand)

    2014-07-01

    Marine environmental samples including seawater (filtered and unfiltered), suspended particles, and green mussels (Perna viridis) were collected from Sriracha and Angsira areas located in Chonburi province in order to determine Po-210 radioactivity. The former was chosen because it is generally believed that this area has been contaminated by one of the largest industrial estates in Thailand and others human-activities (non-nuclear activities) nearby such as oil refineries and Coal Power Plants. Discharges, ashes, and wastes released from these activities may result in an increase of Po-210 concentration in marine environment when compared to other areas. The later was designated to serve as a control site in this study since this area is unlikely to be impacted by industrial activities. Our results revealed that, in the filtered seawater, averaged values of Po-210 level were 0.26 + 0.14 mBq/L (Sriracha) and 0.56 + 0.42 mBq/L (Angsira) and, in the unfiltered seawater, means of Po-210 radioactivity were 2.37 + 0.32 mBq/L (Sriracha) and 4.20 + 2.78 mBq/L (Angsira). Furthermore, the suspended particles contained Po-210 concentrations with averaged values of 14.11 + 8.87 Bq/kg dw (Sriracha) and 102.21 + 51.49 Bq/kg dw (Angsira) while averaged Po-210 levels of 35.74 + 17.53 Bq/kg dw (Sriracha) and 71.12 + 62.88 Bq/kg dw (Angsira) were found in the green mussels examined. The present finding indicates that there is no radiological impact caused by those human activities to the marine environment at Sriracha. Radiation dose assessment was also performed in both the green mussels and human who consume green mussels. The results show that the green mussels farmed at Sriracha and Angsira received averaged radiation dose rates from Po-210 at 0.0007 and 0.0015 mGy/d, respectively. In addition, our results reveal that populations living in Chonburi province and ingesting the green mussels from these 2 locations received radiation dose rates from Po-210 at the means of 44.25 and

  4. [Demonstration, by means of electron microscopy, of the penetration of somitic cells into the mesoblast of the limb buds of reptile embryos (Anguis fragilis, Lacerta viridis)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-01-01

    An electron microscopic study of the components of anterior limb buds of the slow-worm (Anguis fragilis) and of the green lizard (Lacerta viridis) (embryos of Anguis whose allantoic bud reach 0,7 to 4 mm of length; embryos of Lacerta 2 to 7 days old) provides data on the cytological characteristics of the components of the limb bud at these early stages. 1. The cells of the distal extremity of the somitic processes extending in the limb bud of Anguis and Lacerta, are elongated cells with ovoid nuclei containing large nucleolus; they possess mitochondria always thin and with dense matrix; they are rich in lipid droplets; they possess cilia; they are devoid of myofilaments; endoplasmic reticulum, free ribosomes and polyribosomes are abundant. Golgi networks display signs of activity. These characteristics are also observed in the cells of the "dermatome" layer of the dermo-myotome; and so, it appears probable that the cells of the "dermatome". Furthermore, in Anguis embryos, the cells of the distal extremities of the somitic processes possess numerous lysosomes and a certain number of cells among them, degenerate early. 2. The somatopleural mesoblastic cells of the limb bud of Anguis and Lacerta embryos keep the characters of the cells of the mesodermic layer of lateral plate from which they originate; they have rounded nuclei, cilia, and their mitochondria are always larger and more transparent to electrons, than the ones of cells of the somitic processes and of cells of the epiblastic apical crest. Golgi networks are well developped, endoplasmic reticulum is abundant, lipid droplets are rare. 3. The processes of somites which extend in the dorsal part of the limb bud of Anguis embryos are cords of cells with thin lumina; at the stage of the allantoic bud of 0,6 to 0,8 mm long, the distal extremity of these processes dislocate in group of cells which afterwards dissociate, releasing individual somitic cells which are integrated among the mesoblastic somatopleural

  5. DEVELOPMENT OF LEPTOPELIS VIRIDIS CINNAMOMEUS ...

    African Journals Online (AJOL)

    (BOCAGE) WITH NOTES ON ITS SYSTEMATIC POSITION. IAN LINDEN. Dept. of Bi%gy, University of Ma/awi. The taxonomic studies of J. Poynton (1964a, 1964b and 1966) and A. Schiotz (1967) indicate a remarkable parallel between the speciation of the genus Leptope/is in West, South and East. Mrica. The tree, ground ...

  6. Comunidad de moluscos asociados al mejillón verde Perna viridis (Mollusca: Bivalvia y sus relaciones tróficas en la costa norte de la Península de Araya, Estado Sucre, Venezuela

    Directory of Open Access Journals (Sweden)

    Sioliz Villafranca

    2006-12-01

    Full Text Available Perna viridis es un bivalvo procedente del Indo-Pacífico que habita en la zona intermareal y ha invadido varios ecosistemas de la costa norte del estado Sucre, Venezuela. Con la finalidad de realizar un estudio sobre las comunidades de moluscos asociadas a esta especie y sus relaciones tróficas, se llevaron a cabo muestreos bimensuales entre octubre/97 y agosto/98, en un banco natural de mejillones a dos metros de profundidad en la costa norte de la península de Araya (10°40’N -48°63’W. Los organismos fueron recolectados delimitando el área con una cuadrícula de 0.25 m². Se identificaron los organismos hasta la categoría de especies utilizando claves específicas para moluscos y bibliográficamente se les determinó categoría trófica.Se capturó un total de 1 235 individuos de P. viridis y asociados a la especie 3 163 especímenes pertenecientes al phylum Mollusca, contenidos en tres clases: Bivalvia,Gastropoda y Polyplacophora. Éstas estuvieron representadas por 50 especies correspondientes a 10 órdenes, 24 familias; para los gasterópodos se contabilizaron 25 especies, para los bivalvos 22 y tres para los poliplacóforos. Del total de las especies, 40% fueron filtradoras, 26% carnívoras, 24% herbívoras y el 10% restante presentó dos categorías.De las filtradoras las más representativas fueron: Perna perna, Musculus lateralis, Crassostrea rhizophorae y Ostrea equestris; en el grupo de los carnívoros dominaron tres especies de la familia Columbellidae:Mitrella lunata, Anachis obesa y Nitidella ocellata y para el grupo de los herbívoros destacaron dos especies de la familia Fisurellidae: Diodora cayenensis y D. minuta. Se registraron dos especies filtradoras-detritívoras, y tres especies herbívoras-filtradoras representantes del género C repidula. El alto porcentaje de filtradores sería un indicativo de que dentro de este sistema probablemente hay una mayor disponibilidad de fracciones alimenticias para este grupo

  7. Perfil de lípidos y ácidos grasos de Perna viridis, mejillón verde (Mollusca: Bivalvia en el oriente venezolano y la costa oeste de Trinidad

    Directory of Open Access Journals (Sweden)

    Tamar Koftayan

    2011-03-01

    Full Text Available Los lípidos totales fueron extraídos, identificados y cuantificados por gravimetría, mediante TLC/FID (sistema Iatroscan. Los ácidos grasos de los lípidos totales, fosfolípidos y triacilgliceroles fueron identificados y cuantificados por cromatografía de gases. Las mayores concentraciones de lípidos totales se presentaron en las muestras de Los Cedros, La Brea y Chaguaramas con valores de 7.92, 7.74 y 7.53%; respectivamente y los valores mínimos en las de La Restinga (6.08%. En la composición lípidica, las muestras de Chacopata presentaron la menor concentración de fosfolípidos (48.86% y los máximos valores de colesterol (38.87% y triacilgliceroles (12.26%, y las muestras de La Esmeralda y Río Caribe exhibieron concentraciones máximas de fosfolípidos (88.71-84.93%, respectivamente y mínimas de colesterol (6.50-4.42%. En los lípidos totales, los ácidos grasos saturados se encontraron entre 15.04 y 65.55%, con máximos en muestras de La Esmeralda y mínimos en Chacopata y los poliinsaturados estuvieron entre 7.80 y 37.18%, con máximos valores en la Brea y mínimos en la Esmeralda. En los fosfolípidos, la concentración de ácidos grasos saturados estuvo entre 38.81 y 48.68% para las muestras de Chaguaramas y Chacopata, respectivamente; los ácidos grasos poliinsaturados se encontraron entre no detectado y 34.51%, con altas concentraciones en muestras de Los Cedros (27.97% y Chaguaramas (34.51%. En los triacilgliceroles, la composición de ácidos grasos saturados variaron entre 14.27 y 53.80%, con baja concentración en Chacopata y alta concentración en La Restinga; los ácidos grasos poliinsaturados estuvieron entre 4.66 y 35.55%, con valores menores en las muestras de Chacopata (4.66% y mayores en Chaguaramas. El consumo frecuente de Perna viridis es recomendable, debido a su alto contenido de fosfolípidos y ácidos grasos insaturados.Lipid and fatty acid profile of Perna viridis, Green Mussel (Mollusca: Bivalvia in

  8. Degradation of phycobilisomes in Synechocystis sp. PCC6803: evidence for essential formation of an NblA1/NblA2 heterodimer and its codegradation by A Clp protease complex.

    Science.gov (United States)

    Baier, Antje; Winkler, Wiebke; Korte, Thomas; Lockau, Wolfgang; Karradt, Anne

    2014-04-25

    When cyanobacteria acclimate to nitrogen deficiency, they degrade their large (3-5-MDa), light-harvesting complexes, the phycobilisomes. This massive, yet specific, intracellular degradation of the pigmented phycobiliproteins causes a color change of cyanobacterial cultures from blue-green to yellow-green, a process referred to as chlorosis or bleaching. Phycobilisome degradation is induced by expression of the nblA gene, which encodes a protein of ~7 kDa. NblA most likely acts as an adaptor protein that guides a Clp protease to the phycobiliproteins, thereby initiating the degradation process. Most cyanobacteria and red algae possess just one nblA-homologous gene. As an exception, the widely used "model organism" Synechocystis sp. PCC6803 expresses two such genes, nblA16803 and nblA26803, both of whose products are required for phycobilisome degradation. Here, we demonstrate that the two NblA proteins heterodimerize in vitro and in vivo using pull-down assays and a Förster energy-transfer approach, respectively. We further show that the NblA proteins form a ternary complex with ClpC (the HSP100 chaperone partner of Clp proteases) and phycobiliproteins in vitro. This complex is susceptible to ATP-dependent degradation by a Clp protease, a finding that supports a proposed mechanism of the degradation process. Expression of the single nblA gene encoded by the genome of the N2-fixing, filamentous cyanobacterium Nostoc sp. PCC7120 in the nblA1/nblA2 mutant of Synechocystis sp. PCC6803 induced phycobilisome degradation, suggesting that the function of the NblA heterodimer of Synechocystis sp. PCC6803 is combined in the homodimeric protein of Nostoc sp. PCC7120.

  9. Orphan Nuclear Receptor Small Heterodimer Partner Negatively Regulates Growth Hormone-mediated Induction of Hepatic Gluconeogenesis through Inhibition of Signal Transducer and Activator of Transcription 5 (STAT5) Transactivation*

    Science.gov (United States)

    Kim, Yong Deuk; Li, Tiangang; Ahn, Seung-Won; Kim, Don-Kyu; Lee, Ji-Min; Hwang, Seung-Lark; Kim, Yong-Hoon; Lee, Chul-Ho; Lee, In-Kyu; Chiang, John Y. L.; Choi, Hueng-Sik

    2012-01-01

    Growth hormone (GH) is a key metabolic regulator mediating glucose and lipid metabolism. Ataxia telangiectasia mutated (ATM) is a member of the phosphatidylinositol 3-kinase superfamily and regulates cell cycle progression. The orphan nuclear receptor small heterodimer partner (SHP: NR0B2) plays a pivotal role in regulating metabolic processes. Here, we studied the role of ATM on GH-dependent regulation of hepatic gluconeogenesis in the liver. GH induced phosphoenolpyruvate carboxykinase (PEPCK) and glucose 6-phosphatase gene expression in primary hepatocytes. GH treatment and adenovirus-mediated STAT5 overexpression in hepatocytes increased glucose production, which was blocked by a JAK2 inhibitor, AG490, dominant negative STAT5, and STAT5 knockdown. We identified a STAT5 binding site on the PEPCK gene promoter using reporter assays and point mutation analysis. Up-regulation of SHP by metformin-mediated activation of the ATM-AMP-activated protein kinase pathway led to inhibition of GH-mediated induction of hepatic gluconeogenesis, which was abolished by an ATM inhibitor, KU-55933. Immunoprecipitation studies showed that SHP physically interacted with STAT5 and inhibited STAT5 recruitment on the PEPCK gene promoter. GH-induced hepatic gluconeogenesis was decreased by either metformin or Ad-SHP, whereas the inhibition by metformin was abolished by SHP knockdown. Finally, the increase of hepatic gluconeogenesis following GH treatment was significantly higher in the liver of SHP null mice compared with that of wild-type mice. Overall, our results suggest that the ATM-AMP-activated protein kinase-SHP network, as a novel mechanism for regulating hepatic glucose homeostasis via a GH-dependent pathway, may be a potential therapeutic target for insulin resistance. PMID:22977252

  10. From Macrocrystals to Microcrystals: A Strategy for Membrane Protein Serial Crystallography.

    Science.gov (United States)

    Dods, Robert; Båth, Petra; Arnlund, David; Beyerlein, Kenneth R; Nelson, Garrett; Liang, Mengling; Harimoorthy, Rajiv; Berntsen, Peter; Malmerberg, Erik; Johansson, Linda; Andersson, Rebecka; Bosman, Robert; Carbajo, Sergio; Claesson, Elin; Conrad, Chelsie E; Dahl, Peter; Hammarin, Greger; Hunter, Mark S; Li, Chufeng; Lisova, Stella; Milathianaki, Despina; Robinson, Joseph; Safari, Cecilia; Sharma, Amit; Williams, Garth; Wickstrand, Cecilia; Yefanov, Oleksandr; Davidsson, Jan; DePonte, Daniel P; Barty, Anton; Brändén, Gisela; Neutze, Richard

    2017-09-05

    Serial protein crystallography was developed at X-ray free-electron lasers (XFELs) and is now also being applied at storage ring facilities. Robust strategies for the growth and optimization of microcrystals are needed to advance the field. Here we illustrate a generic strategy for recovering high-density homogeneous samples of microcrystals starting from conditions known to yield large (macro) crystals of the photosynthetic reaction center of Blastochloris viridis (RC vir ). We first crushed these crystals prior to multiple rounds of microseeding. Each cycle of microseeding facilitated improvements in the RC vir serial femtosecond crystallography (SFX) structure from 3.3-Å to 2.4-Å resolution. This approach may allow known crystallization conditions for other proteins to be adapted to exploit novel scientific opportunities created by serial crystallography. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Phytoextraction assessment of green amaranth ( Amaranthus viridis ...

    African Journals Online (AJOL)

    Disposal of sewage sludge is the major challenge facing wastewater treatment facilities. Several reports claimed that land application is the best option to manage sludge disposal. However, there is perception that sludge contains heavy metals that are potentially harmful to the living organisms. Thus, the study assessed ...

  12. Tertiary Structural studies of Myotoxin a from Crotalus viridis viridis Venom by Nuclear Magnetic Resonance

    Science.gov (United States)

    1993-05-01

    electrophorus electri... 47 47 47 Sw:Ibb2SWheat P09864 wheat (triticum aestivum). proteina ... 46 46 51 Sw:Pa29$Pseau P20253 mulga snake (pseudechis...Sw:Pa2bSPsepo P20259 red-bellied black snake (pseudechis... 34 46 37 Sw:IbblSWheat P09863 wheat (triticum aestivum). proteina ... 46 46 52 Sw:Pa2a$Psepo P20258 red

  13. Resonance Coupling in Plasmonic Nanomatryoshka Homo- and Heterodimers

    Science.gov (United States)

    2016-08-16

    publishing.aip.org/authors/rights-and-permissions. Download to IP: 131.84.11.215 On: Thu, 16 Jun 2016 16:07:47 065102-2 Ahmadivand, Sinha, and Pala AIP...sensitive detec- tors and nanostructures, as well as SERS applications.10–13 Several nanoparticles with different shapes and sizes in a symmetric...permissions. Download to IP: 131.84.11.215 On: Thu, 16 Jun 2016 16:07:47 065102-3 Ahmadivand, Sinha, and Pala AIP Advances 6, 065102 (2016) resonant

  14. Efeito de cascas de café e de arroz dispostas nas camadas do solo sobre a germinação e o crescimento inicial do caruru-de-mancha Allelopathic effect of coffee and rice husks arranged in soil layers on the germination and initial growth of Amaranthus viridis

    Directory of Open Access Journals (Sweden)

    J.C.F. Santos

    2001-08-01

    Full Text Available Estudos dos efeitos dos resíduos de plantas pela utilização de coberturas mortas no controle das plantas daninhas têm apresentado dificuldade de determinar a diferenciação entre alelopatia e competição. Atualmente, muitas pesquisas têm se referido a critérios que propõem evidência à alelopatia. Este trabalho em casa de vegetação visou determinar os efeitos alelopáticos proporcionados pelas cascas de café e de arroz sobre o caruru-de-mancha, por meio das disposições desses resíduos nas camadas do solo. O delineamento experimental foi o de blocos casualizados, com os tratamentos em quatro repetições e organizados num esquema fatorial (3x3, sendo cascas de café e de arroz e vermiculita expandida como um fator e suas disposições, com resíduos depositados no topo, incorporados na superfície e incorporados no fundo, como segundo fator. Como testemunha foi usado um tratamento adicional sem cobertura. De modo geral, resíduos de cascas proporcionaram inibição da germinação e estímulo ao crescimento do caruru-de-mancha. A casca de arroz proporcionou menor índice de velocidade de emergência e germinação de sementes do que a casca de café. A casca de café depositada no topo proporcionou maior crescimento e maior peso da matéria seca do caruru-de-mancha, seguido pela mesma casca incorporada na superfície do solo.Studies of plant residue effects involving mulches to control weeds in perennial crops are difficult to carry out due to the need to differentiate between allelopathy and competition. Many researches, nowadays, refer to criteria proving allelopathy. This work was established under greenhouse conditions to determine the allelopathic effects of coffee and rice husks on Amaranthus viridis through their arrangements in soil layers. The experimental design was a randomized block with four replications, arranged in a 3 x 3 factorial scheme, with coffee and rice husks and expanded vermiculite being one factor and

  15. Asymmetry in serial femtosecond crystallography data.

    Science.gov (United States)

    Sharma, Amit; Johansson, Linda; Dunevall, Elin; Wahlgren, Weixiao Y; Neutze, Richard; Katona, Gergely

    2017-03-01

    Serial crystallography is an increasingly important approach to protein crystallography that exploits both X-ray free-electron laser (XFEL) and synchrotron radiation. Serial crystallography recovers complete X-ray diffraction data by processing and merging diffraction images from thousands of randomly oriented non-uniform microcrystals, of which all observations are partial Bragg reflections. Random fluctuations in the XFEL pulse energy spectrum, variations in the size and shape of microcrystals, integrating over millions of weak partial observations and instabilities in the XFEL beam position lead to new types of experimental errors. The quality of Bragg intensity estimates deriving from serial crystallography is therefore contingent upon assumptions made while modeling these data. Here it is observed that serial femtosecond crystallography (SFX) Bragg reflections do not follow a unimodal Gaussian distribution and it is recommended that an idealized assumption of single Gaussian peak profiles be relaxed to incorporate apparent asymmetries when processing SFX data. The phenomenon is illustrated by re-analyzing data collected from microcrystals of the Blastochloris viridis photosynthetic reaction center and comparing these intensity observations with conventional synchrotron data. The results show that skewness in the SFX observations captures the essence of the Wilson plot and an empirical treatment is suggested that can help to separate the diffraction Bragg intensity from the background.

  16. Phytochemical and antimicrobial studies of Olax viridis OLIV. (Fam ...

    African Journals Online (AJOL)

    A 1-kg portion of the pulverized crude drug was defatted using n-hexane (F1) and subsequently extracted with methanol in soxhlet, and the methanol extract (F2) fractionated into F3-F8. All the fractions were screened for activity against some clinical strains of bacteria and fungi. Their phytochemical composition was, ...

  17. Tolerance of High Inorganic Mercury of Perna viridis : Laboratory ...

    African Journals Online (AJOL)

    ... a 'very' high level of inorganic Hg, it has a high bioaccumulative capability and a high tolerance to inorganic Hg. The mussel byssus was found to have the highest depuration rate coefficient, indicating that it could act as one of the excretion routes for Hg and it can be proposed as a sensitive biomonitoring material for Hg.

  18. The G protein-coupled receptor heterodimer network (GPCR-HetNet) and its hub components.

    Science.gov (United States)

    Borroto-Escuela, Dasiel O; Brito, Ismel; Romero-Fernandez, Wilber; Di Palma, Michael; Oflijan, Julia; Skieterska, Kamila; Duchou, Jolien; Van Craenenbroeck, Kathleen; Suárez-Boomgaard, Diana; Rivera, Alicia; Guidolin, Diego; Agnati, Luigi F; Fuxe, Kjell

    2014-05-14

    G protein-coupled receptors (GPCRs) oligomerization has emerged as a vital characteristic of receptor structure. Substantial experimental evidence supports the existence of GPCR-GPCR interactions in a coordinated and cooperative manner. However, despite the current development of experimental techniques for large-scale detection of GPCR heteromers, in order to understand their connectivity it is necessary to develop novel tools to study the global heteroreceptor networks. To provide insight into the overall topology of the GPCR heteromers and identify key players, a collective interaction network was constructed. Experimental interaction data for each of the individual human GPCR protomers was obtained manually from the STRING and SCOPUS databases. The interaction data were used to build and analyze the network using Cytoscape software. The network was treated as undirected throughout the study. It is comprised of 156 nodes, 260 edges and has a scale-free topology. Connectivity analysis reveals a significant dominance of intrafamily versus interfamily connections. Most of the receptors within the network are linked to each other by a small number of edges. DRD2, OPRM, ADRB2, AA2AR, AA1R, OPRK, OPRD and GHSR are identified as hubs. In a network representation 10 modules/clusters also appear as a highly interconnected group of nodes. Information on this GPCR network can improve our understanding of molecular integration. GPCR-HetNet has been implemented in Java and is freely available at http://www.iiia.csic.es/~ismel/GPCR-Nets/index.html.

  19. Minimal conformational plasticity enables TCR cross-reactivity to different MHC class II heterodimers

    Science.gov (United States)

    Holland, Christopher J.; Rizkallah, Pierre J.; Vollers, Sabrina; Calvo-Calle, J. Mauricio; Madura, Florian; Fuller, Anna; Sewell, Andrew K.; Stern, Lawrence J.; Godkin, Andrew; Cole, David K.

    2012-01-01

    Successful immunity requires that a limited pool of αβ T-cell receptors (TCRs) provide cover for a vast number of potential foreign peptide antigens presented by ‘self’ major histocompatibility complex (pMHC) molecules. Structures of unligated and ligated MHC class-I-restricted TCRs with different ligands, supplemented with biophysical analyses, have revealed a number of important mechanisms that govern TCR mediated antigen recognition. HA1.7 TCR binding to the influenza hemagglutinin antigen (HA306–318) presented by HLA-DR1 or HLA-DR4 represents an ideal system for interrogating pMHC-II antigen recognition. Accordingly, we solved the structure of the unligated HA1.7 TCR and compared it to both complex structures. Despite a relatively rigid binding mode, HA1.7 T-cells could tolerate mutations in key contact residues within the peptide epitope. Thermodynamic analysis revealed that limited plasticity and extreme favorable entropy underpinned the ability of the HA1.7 T-cell clone to cross-react with HA306–318 presented by multiple MHC-II alleles. PMID:22953050

  20. Small heterodimer partner (NROB2) coordinates nutrient signaling and the circadian clock in mice

    Science.gov (United States)

    Circadian rhythm regulates multiple metabolic processes and in turn is readily entrained by feeding-fasting cycles. However, the molecular mechanisms by which the peripheral clock senses nutrition availability remain largely unknown. Bile acids are under circadian control and also increase postprand...

  1. Questionable expression of unstable DQ heterodimer containing HLA-DQA1*01 : 07

    NARCIS (Netherlands)

    Miyadera, H.; Bungener, L. B.; Kusano, S.; Yokoyama, S.; Tokunaga, K.; Hepkema, B. G.

    2015-01-01

    Human leukocyte antigens (HLA)-DQA1*01:07 was identified as an HLA-DQ blank specificity that segregated with the serological HLA-A2, -B7, -DR14, -DR52 haplotype, which carried DQB1*05:03. The blank specificity of DQA1*01:07-DQB1*05:03 may be because of lack of reactivity of available typing sera, or

  2. Production in Pichia pastoris of protein-based polymers with small heterodimer-forming blocks

    NARCIS (Netherlands)

    Domeradzka, N.E.; Werten, M.W.T.; Vries, de R.J.; Wolf, de F.A.

    2016-01-01

    Some combinations of leucine zipper peptides are capable of forming a-helical heterodimeric coiled coils with very high affinity. These can be used as physical cross-linkers in the design of protein-based polymers that form supramolecular structures, for example hydrogels, upon mixing solutions

  3. Atomistic Simulations of Complex DNA DSBs and the Interactions with Ku70/80 Heterodimer

    Science.gov (United States)

    Hu, Shaowen; Cucinotta, Francis A.

    2011-01-01

    Compared to DNA with simple DSBs, the complex lesions can enhance the hydrogen bonds opening rate at the DNA terminus, and increase the mobility of the whole duplex. Binding of Ku drastically reduces the structural disruption and flexibility caused by the complex lesions. In all complex DSBs systems, the binding of DSB terminus with Ku70 is softened while the binding of the middle duplex with Ku80 is tightened. Binding of Ku promotes the rigidity of DNA duplexes, due to the clamp structure of the inner surface of the rings of Ku70/80.

  4. Tomenphantadenine, an unprecedented germacranolide-adenine hybrid heterodimer from the medicinal plant Elephantopus tomentosus L.

    Science.gov (United States)

    Guo, Zhi Kai; Wang, Bei; Cai, Cai Hong; Huang, Sheng Zhuo; Yuan, Jing Zhe; Mei, Wen Li; Dai, Hao Fu

    2018-03-01

    An unusual adenine-substituted germacrane sesquiterpene lactone, tomenphantadenine (1), has been isolated from the whole plant of Elephantopus tomentosus L. The structure of this compound was established by comprehensive spectroscopic analysis including high resolution (HR) ESI-MS, 1D and 2D nuclear magnetic resonance (NMR) spectroscopic data. This compound features novel hybrid pattern of germacrane sesquiterpene with adenine through C-N linkage, and a possible biosynthetic pathway for it was proposed. Compound 1 showed potent antibacterial activity against the gram-positive Staphylococcus aureus and weak acetylcholinesterase (AChE) inhibitory activity. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. The Role of BRCA1/BARD1 Heterodimers in the Mitosis-Interphase Transition

    National Research Council Canada - National Science Library

    Joukov, Vladimir

    2007-01-01

    ... and ovarian tumor suppressor BRCA1 and its hetorodimerizing partner, BARD1. Experiments using both egg extracts and cultured mammalian cells revealed a previously unknown role of BRCA1/BARD1 in the mitotic spindle assembly...

  6. The Ku Heterodimer and the Metabolism of Single-Ended DNA Double-Strand Breaks

    NARCIS (Netherlands)

    A. Balestrini (Alessia); D. Ristic (Dejan); I. Dionne (Isabelle); X.Z. Liu (Xiao); C. Wyman (Claire); R.J. Wellinger (Raymund); J.H.J. Petrini (John)

    2013-01-01

    textabstractSingle-ended double-strand breaks (DSBs) are a common form of spontaneous DNA break, generated when the replisome encounters a discontinuity in the DNA template. Given their prevalence, understanding the mechanisms governing the fate(s) of single-ended DSBs is important. We describe the

  7. Material influence on hot spot distribution in the nanoparticle heterodimer on film

    Science.gov (United States)

    Chen, Fang; Huang, Yingzhou; Wei, Hua; Wang, Shuxia; Zeng, Xiping; Cao, Wenbin; Wen, Weijia

    2018-04-01

    The metal nanoparticle aggregated on film, as an effective plasma enhancement pathway, has been widely used in various surface plasmon-related fields. In this study, the hot spots on the metal nanoparticle dimer composed of different materials (Agsbnd Au, Agsbnd Pd, and Agsbnd Cu) on metal (Au) film were investigated with finite element method. Based on the results, the hot spot distribution affected by the material can be confirmed by the electric field distribution of the metal nanoparticle dimer on the film. The aggregation effects of Au and Ag nanoparticles in Ausbnd Ag dimer system are not significant. However, for the Pdsbnd Ag dimer system, the hot spot aggregation effect is slightly larger than that of the Pd nanoparticle under the Ag nanoparticle. Besides, the non-uniform hot spots would bring about the light focusing phenomenon that the light intensity under Ag nanoparticle is almost 100 times greater than that under Cu nanoparticle in Agsbnd Cu dimer system. These results were further confirmed by the surface charge distribution, and analyzed based on the plasmonic hybridization theory. The data about the nanoparticle dimer on the dielectric (Si) film demonstrate the importance of induced image charges on the film surface in such a light focusing phenomenon. Our findings can enhance the understanding of the surface plasmon coupling in different materials, which may have great application prospects in surface plasmon-related fields, such as SERS, plasmonic enhanced solar cell, and plasmonic sensoring, etc.

  8. Spectroscopic study of jet-cooled heterodimers of salicylic acid with acetic and trifluoroacetic acids

    Science.gov (United States)

    Lahmani, F.; Zehnacker-Rentien, A.

    1997-06-01

    The photophysical properties of the intermolecular hydrogen-bonded complexes of salicylic acid with acetic acid and trifluoroacetic acid have been investigated in a supersonic expansion. The fluorescence excitation spectra are characterized by a long harmonic progression upon a low frequency mode and their origin is blue-shifted with respect to that of pure salicylic acid. The emission spectra exhibit a single broad band peaking at 360 and 390 nm respectively for the complex with trifluoroacetic and acetic acids and are not dependent on the excitation wavelength. The results have been rationalized in terms of a single minimum energy curve in both the ground and excited states.

  9. Role of ERalpha-ERRalpha Heterodimers in Tamoxifen-Resistant Breast Cancers

    Science.gov (United States)

    2012-04-01

    purified from Saccharomyces cerevisiae is required for methylation of histone H3, Proc. Natl. Acad. Sci. USA 99 (2002) 90–94. [46] J. Laganiere, G.B...with chromatin obtained from MCF-7 cells grown in standard medium and serum. They found that our ERRα-specific mAb 2ERR7 met their “gold standard” for...left. A.M. Esch et al. / Protein Expression and Purification 84 (2012) 47–58 49formed bacteria were cultured in 500 mL of Luria–Bertani (LB) medium

  10. ETUDE THEORIQUE ET EXPERIMENTALE DU SECHAGE SOLAIRE DES FEUILLES DE LA MENTHE VERTE (MENTHA VIRIDIS).

    OpenAIRE

    BOUMEDIENE, TOUATI

    2014-01-01

    LES PLANTES MÉDICINALES ET AROMATIQUES ET EN PARTICULIER LES FEUILLES DE LA MENTHE VERTE ONT BEAUCOUP D'IMPORTANCE POUR LA PHARMACOPÉE, LA PARFUMERIE ,LA CONFISERIE ET LA LIQUORISTE RIE . CE TRAVAIL ENTRE DANS LE CADRE DE LA VALORISATION DE CETTE PLANTE PRODUITE EN GRANDE QUANTITÉ DANS LE SUD ET LE SUD-OUEST ALGÉRIEN .IL S'AGIT RÉÉTUDIER LE SÉCHAGE DE CETTE PLANTE ET DE DÉVELOPPER L'UTILISATION DE L’ÉNERGIE POUR SE'CHER LA MENTHE VIRIDES.

  11. Preparation of Nanoparticles by Electroagulation From Soluble Exopolysaccharide Produced by Claviceps viridis

    Czech Academy of Sciences Publication Activity Database

    Flieger, Miroslav; Kantorová, Michaela; Benada, Oldřich; Kofroňová, Olga; Sobotka, Miroslav; Cvak, Jan; Votruba, Jaroslav

    2004-01-01

    Roč. 85, č. 2 (2004), s. 234-236 ISSN 0006-3592 R&D Projects: GA ČR GA525/00/1283 Institutional research plan: CEZ:AV0Z5020903 Keywords : electroagulation * exopolysaccharides * nanoparticles Subject RIV: EE - Microbiology, Virology Impact factor: 2.216, year: 2004

  12. Antifouling activity of Indian marine invertebrate against the green mussel Perna viridis L.

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Jayasree, V.; Naik, C.G.; Parameswaran, P.S.; Raveendran, T.V.; Kamat, S.Y.

    Development, New Delhi, for financial assistance. References Bakus GT (1981) Chemical defence mechanisms and fish behaviour on the Great Barrier Reef, Australia. Science 211:497–499 Bakus GT, Green (1974) Toxicity in sponges and holothurians: A geo- graphic...

  13. Cytogenetic studies in green mussel, Perna viridis (Mytiloida: Pteriomorphia), from West Coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Iqbal, A.N.M.Z.; Khan, M.S.; Goswami, U.

    ) Chromosome number and karyotype of Donax trunculus L. (Mollusca, Bivalvia, Tellinacea). Genetica 82(2):93–97 Cross I, Dı´az E, Sa´nchez I, Rebordinos L (2005) Molecular and cytogenetic characterization of Crassostrea angulata chromo- somes. Aquaculture 247... maximus and Mimachlamys varia (Bivalvia: Pectinidae). Genetica 126(3):291–301 Justo CC, Murofushi, Maida K, Hanyu I (1991) Karyological studies on the freshwater prawn Macrobrachium rosenbergii. Aquacul- ture 97:327–334 Levan A, Fredga K, Sandberg AA (1964...

  14. Proximate biochemical composition and caloric potential in the raft-grown green mussel Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Parulekar, A

    .5-34.2 and 3.1-21.2% respectively. Major biochemical constituents were found to be influenced by phytoplankton abundance and were also found to vary with maturation and spawning cycle. The caloric potential in the raft-grown mussel varied from 3.33 to 4.9 K cal...

  15. Antioxidative potential of Perna viridis and its protective role against ROS induced lipidperoxidation and protein carbonyl

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Jagtap, T.G.; Verlecar, X.N.

    ) represent various forms of oxygen centered molecules (1). In living beings, ROS are formed endogenously during normal cellular metabolism. Exogenously ROS is obtained during exposure to ionization radiations and many xenobiotic substances (1). In cellular... atherogenicity. New England Journal of Medicine, 320: 915-924. 6. Muramatsu, H., Kogawa, K., Tanaka, M., Okumura, K., Koike, K. and Kuga, T. (1995) Superoxide dismutase in SAS human tongue carcinoma cell line is a factor defining invasiveness and cell motility...

  16. Extract of Indian green mussel, Perna viridis (L.) shows inhibition of blood capillary formation in vitro

    Digital Repository Service at National Institute of Oceanography (India)

    Mirshahi, M.; Mirshahi, P.; Negro, S.; Soria, J.; Sreekumar, P.K.; Kotnala, S.; Therwath, A.; Chatterji, A.

    , in these fractions, was done using the matrigel bi-dimensional models. Bi-dimensional Angiogenesis Assay In the bi-dimensional model (matrigel which is a standardized cancer cell extra-cellular matrix), the endothelial cells were seeded on the matrigel..., are useful in cancer therapy. Anti-angiogenic substances can be used to inhibit the growth of tumour mass by preventing neo-vascularization of an early developing tumour. Therefore, such substances are of importance, not only to prevent the development...

  17. Modulation of antioxidant defences in digestive gland of Perna viridis (L.), on mercury exposures

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    , and mixtures of B[a]P and Aroclor 1254. Mar. Pollut. Bull. 46, 1285–1293. Sweetman, S.F., Strain, J.J., McKelvey-Martin, V.J., 1997. Effect of antioxidant vitamin supplementation on DNA damage and repair in human lymphoblastoid cells. Nutrit. Cancer 27, 122...

  18. DNA damage in male gonad cells of Green mussel (Perna viridis) upon exposure to tobacco products

    Digital Repository Service at National Institute of Oceanography (India)

    Nagarajappa; Ganguly, A.; Goswami, U.

    , heavy metals, etc. Some of these chemicals are known genotoxicants and can cause damage to the genetic material of the exposed organism (Shugart, 1990). Damaged DNA may potentiate subsequent deleterious cellular events such as disease (e.g., cancer...

  19. Biomarkers of petroleum contamination in the digestive gland of Perna viridis (L.)

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Desai, S.R.; Das, P.B.; Chainy, G.B.N.

    lipid peroxidation, protein carbonyl, DNA integrity, and hydrogen peroxide in WAF-exposed specimens are indicative of oxidative damage due to dissolved petroleum extracts. A consistent increase in superoxide dismutase, catalase, glutathione peroxidase...

  20. Growth parameters in the cultured green mussel Perna viridis L. from the Zuari Estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Sreepada, R.A.; Parulekar, A.H.

    inverse relationship. In contrast, growth expressed in terms of weight was significantly influencEd. by chl-a and DO. It was also observed that chl-a either singly or in combination with particulate organic matter had significant effect on growth...

  1. Relative toxicity of oil dispersants to Mytilus viridis and Macrobrachium idella

    Digital Repository Service at National Institute of Oceanography (India)

    DeSilva, C.; Row, A.

    There was a great variation in the relative toxicity of different oil dispersants. Dispersant IB 2/80 was most toxic and dispersant IB 11/80 was not lethal at the highest concentration tested. The ranking order of the emulsions (oil dispersant...

  2. Tumours of reptiles 4. Multiple osteomas in the lizard Laceria viridis

    NARCIS (Netherlands)

    Stolk, A.

    1958-01-01

    Whereas in fishes several osteomas (Bell, 1793; Gervais, 1875; Bland-Sutton, 1885 ; Plehn, 1906 ; Schroeders, 1908 ; Fiebiger, 1909 ; Williamson, 1913 ; Beatti, 1916 ; Kazama, 1924 ; Sagawa, 1925; Williams, 1929; Takahashi, 1929; Thomas, 1932, 1933; Lucké and Schlumberger, not published, see the

  3. [Chemically induced ectropodia in the Lacerta viridis embryo and formation of styliform limbs in reptiles].

    Science.gov (United States)

    Raynaud, A; Clergue-Gazeau, M

    1984-01-01

    Administered into the eggs of Lacerta virifis on days 10 and 11 of incubation (at 25 degrees C), Cytosine-arabinofuranoside induces ectropodia in embryos, with a high frequency, which may reach 66%. The resulting styliform limbs display a general structure similar to that of the limbs of several species of serpentiform Reptilia.

  4. Growth of the green mussel, Perna viridis L., in a sea water circulating system

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterji, A.; Ansari, Z.A.; Ingole, B.S.; Parulekar, A.H.

    parameters did not show any marked correlation with growth rate, which was chiefly influenced by the availability of food. A significant relationship was noted between the shell length and total weight of the mussel, i.e. W = 3.7522 L sup(1.3007). The maximum...

  5. Radioprotection against DNA damage by an extract of Indian green mussel, Perna viridis (L.)

    Digital Repository Service at National Institute of Oceanography (India)

    Kumaran, S.P.; Kutty, B.C.; Chatterji, A.; Parameswaran, P.S.; Mishra, K.P.

    studies by trypan blue dye exclusion and MTT assay showed that pre incubation of mice splenic lymphocytes with MH protected them from Gamma-radiation mediated killing Moreover, the presence of MH during irradiation of isolated mice lymphocytes...

  6. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis)

    OpenAIRE

    Horváth, Gergely; Mészáros, Boglárka; Urszán, Tamás János; Bajer, Katalin; Molnár, Orsolya; Garamszegi, László Zsolt; Herczeg, Gábor

    2017-01-01

    Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality) or across multiple (behavioural syndrome) behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age) and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body con...

  7. Biochemical markers of oxidative stress in Perna viridis exposed to mercury and temperature

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    lipid peroxidation in mussels Perna perna exposed to different metals, Mar.Poll.Bull. 49 (2004) 386-392. [27] K. D. Oakes, G. J. V.D. Kraak, Utility of the TBARS assay in detecting oxidative stress in white sucker (Catostomus commersoni...

  8. Could photosynthesis function on Proxima Centauri b?

    Science.gov (United States)

    Ritchie, Raymond J.; Larkum, Anthony W. D.; Ribas, Ignasi

    2018-04-01

    Could oxygenic and/or anoxygenic photosynthesis exist on planet Proxima Centauri b? Proxima Centauri (spectral type - M5.5 V, 3050 K) is a red dwarf, whereas the Sun is type G2 V (5780 K). The light regimes on Earth and Proxima Centauri b are compared with estimates of the planet's suitability for Chlorophyll a (Chl a) and Chl d-based oxygenic photosynthesis and for bacteriochlorophyll (BChl)-based anoxygenic photosynthesis. Proxima Centauri b has low irradiance in the oxygenic photosynthesis range (400-749 nm: 64-132 µmol quanta m-2 s-1). Much larger amounts of light would be available for BChl-based anoxygenic photosynthesis (350-1100 nm: 724-1538 µmol quanta m-2 s-1). We estimated primary production under these light regimes. We used the oxygenic algae Synechocystis PCC6803, Prochlorothrix hollandica, Acaryochloris marina, Chlorella vulgaris, Rhodomonas sp. and Phaeodactylum tricornutum and the anoxygenic photosynthetic bacteria Rhodopseudomonas palustris (BChl a), Afifella marina (BChl a), Thermochromatium tepidum (BChl a), Chlorobaculum tepidum (BChl a + c) and Blastochloris viridis (BChl b) as representative photosynthetic organisms. Proxima Centauri b has only ~3% of the PAR (400-700 nm) of Earth irradiance, but we found that potential gross photosynthesis (P g) on Proxima Centauri b could be surprisingly high (oxygenic photosynthesis: earth ~0.8 gC m-2 h-1 Proxima Centauri b ~0.14 gC m-2 h-1). The proportion of PAR irradiance useable by oxygenic photosynthetic organisms (the sum of Blue + Red irradiance) is similar for the Earth and Proxima Centauri b. The oxygenic photic zone would be only ~10 m deep in water compared with ~200 m on Earth. The P g of an anoxic Earth (gC m-2 h-1) is ~0.34-0.59 (land) and could be as high as ~0.29-0.44 on Proxima Centauri b. 1 m of water does not affect oxygenic or anoxygenic photosynthesis on Earth, but on Proxima Centauri b oxygenic P g is reduced by ~50%. Effective elimination of near IR limits P g by photosynthetic

  9. Multi-target-directed therapeutic potential of 7-methoxytacrine-adamantylamine heterodimers in the Alzheimer's disease treatment

    Czech Academy of Sciences Publication Activity Database

    Gažová, Z.; Soukup, O.; Šepsová, V.; Šipošová, K.; Drtinová, L.; Jošt, P.; Spilovská, K.; Korábečný, J.; Nepovímová, E.; Fedunová, D.; Horák, Martin; Kaniaková, Martina; Wang, Z. J.; Hamouda, A. K.; Kuča, K.

    2017-01-01

    Roč. 1863, č. 2 (2017), s. 607-619 ISSN 0925-4439 R&D Projects: GA ČR(CZ) GA16-08554S Institutional support: RVO:67985823 Keywords : amyloid * aggregation * muscarinic/nicotinic acetylcholine receptor antagonist * N-Methyl-d-aspartate receptor antagonist * Alzheimer's disease * A beta peptide * beta-secretase inhibitor Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology Impact factor: 5.476, year: 2016

  10. Structures of self-assembled amphiphilic peptide-heterodimers: effects of concentration, pH, temperature and ionic strength

    KAUST Repository

    Luo, Zhongli

    2010-01-01

    The amphiphilic double-tail peptides AXG were studied regarding secondary structure and self-assembly in aqueous solution. The two tails A = Ala 6 and G = Gly6 are connected by a central pair X of hydrophilic residues, X being two aspartic acids in ADG, two lysines in AKG and two arginines in ARG. The peptide AD (Ala6Asp) served as a single-tail reference. The secondary structure of the four peptides was characterized by circular dichroism spectroscopy under a wide range of peptide concentrations (0.01-0.8 mM), temperatures (20-98 °C), pHs (4-9.5) and ionic strengths. In salt-free water both ADG and AD form a β-sheet type of structure at high concentration, low pH and low temperature, in a peptide-peptide driven assembly of individual peptides. The transition has a two-state character for ADG but not for AD, which indicates that the added tail in ADG makes the assembly more cooperative. By comparison the secondary structures of AKG and ARG are comparatively stable over the large range of conditions covered. According to dynamic light scattering the two-tail peptides form supra-molecular aggregates in water, but high-resolution AFM-imaging indicate that ordered (self-assembled) structures are only formed when salt (0.1 M NaCl) is added. Since the CD-studies indicate that the NaCl has only a minor effect on the peptide secondary structure we propose that the main role of the added salt is to screen the electrostatic repulsion between the peptide building blocks. According to the AFM images ADG and AKG support a correlation between nanofibers and a β-sheet or unordered secondary structure, whereas ARG forms fibers in spite of lacking β-sheet structure. Since the AKG and ARG double-tail peptides self-assemble into distinct nanostructures while their secondary structures are resistant to environment factors, these new peptides show potential as robust building blocks for nano-materials in various medical and nanobiotechnical applications. © 2010 The Royal Society of Chemistry.

  11. Protection of Arabidopsis Blunt-Ended Telomeres Is Mediated by a Physical Association with the Ku Heterodimer.

    Science.gov (United States)

    Valuchova, Sona; Fulnecek, Jaroslav; Prokop, Zbynek; Stolt-Bergner, Peggy; Janouskova, Eliska; Hofr, Ctirad; Riha, Karel

    2017-06-01

    Telomeres form specialized chromatin that protects natural chromosome termini from being recognized as DNA double-strand breaks. Plants possess unusual blunt-ended telomeres that are unable to form t-loops or complex with single-strand DNA binding proteins, raising the question of the mechanism behind their protection. We have previously suggested that blunt-ended telomeres in Arabidopsis thaliana are protected by Ku, a DNA repair factor with a high affinity for DNA ends. In nonhomologous end joining, Ku loads onto broken DNA via a channel consisting of positively charged amino acids. Here, we demonstrate that while association of Ku with plant telomeres also depends on this channel, Ku's requirements for DNA binding differ between DNA repair and telomere protection. We show that a Ku complex proficient in DNA loading but impaired in translocation along DNA is able to protect blunt-ended telomeres but is deficient in DNA repair. This suggests that Ku physically sequesters blunt-ended telomeres within its DNA binding channel, shielding them from other DNA repair machineries. © 2017 American Society of Plant Biologists. All rights reserved.

  12. Many de novo donor‐specific antibodies recognize β2‐microglobulin‐free, but not intact HLA heterodimers

    Science.gov (United States)

    Michel, K.; Santella, R.; Steers, J.; Sahajpal, A.; Downey, F. X.; Thohan, V.

    2016-01-01

    Abstract Solid‐phase single antigen bead (SAB) assays are standard of care for detection and identification of donor‐specific antibody (DSA) in patients who receive solid organ transplantation (SOT). While several studies have documented the reproducibility and sensitivity of SAB testing for DSA, there are little data available concerning its specificity. This study describes the identification of antibodies to β2‐microglobulin‐free human leukocyte antigen (β2‐m‐fHLA) heavy chains on SAB arrays and provides a reassessment of the clinical relevance of DSA testing by this platform. Post‐transplant sera from 55 patients who were positive for de novo donor‐specific antibodies on a SAB solid‐phase immunoassay were tested under denaturing conditions in order to identify antibodies reactive with β2‐m‐fHLA or native HLA (nHLA). Antibodies to β2‐m‐fHLA were present in nearly half of patients being monitored in the post‐transplant period. The frequency of antibodies to β2‐m‐fHLA was similar among DSA and HLA antigens that were irrelevant to the transplant (non‐DSA). Among the seven patients with clinical or pathologic antibody‐mediated rejection (AMR), none had antibodies to β2‐m‐fHLA exclusively; thus, the clinical relevance of β2‐m‐fHLA is unclear. Our data suggests that SAB testing produces false positive reactions due to the presence of β2‐m‐fHLA and these can lead to inappropriate assignment of unacceptable antigens during transplant listing and possibly inaccurate identification of DSA in the post‐transplant period. PMID:27060279

  13. Sodium dodecyl sulfate-resistant HLA-DR "superdimer" bands are in some cases class II heterodimers bound to antibody

    NARCIS (Netherlands)

    Hitzel, C.; Grüneberg, U.; van Ham, M.; Trowsdale, J.; Koch, N.

    1999-01-01

    The detection of dimers of dimers in MHC class II crystals has excited speculation about their possible functions in T cell Ag recognition. Biochemical evidence for the existence of DR superdimers falls short of proof and is controversial. To monitor B lymphoma cells for high m.w. complexes of

  14. Influence of rearing water temperature on induced gonadal development and spawning behaviour of tropical green mussel, Perna viridis

    Directory of Open Access Journals (Sweden)

    Parathattil Rathan Sreedevi

    2014-09-01

    Conclusion: According to the present study temperature induced spawning method is very simple and cost effective and can accelerate the production of mussel seeds in hatchery units and further stock improvement through genetic manipulation.

  15. BUDIDAYA KERANG HIJAU (Perna viridis L. DENGAN METODE DAN KEPADATAN BERBEDA DI PERAIRAN PESISIR KUALA LANGSA, ACEH

    Directory of Open Access Journals (Sweden)

    Andi Sagita

    2017-05-01

    Full Text Available Kerang hijau merupakan komoditas budidaya laut yang sangat prospektif untuk dikembangkan pada suatu sistem budidaya, karena dapat dilakukan dengan biaya produksi yang rendah namun menghasilkan profitabilitas yang tinggi. Penelitian ini bertujuan untuk mengetahui metode dan kepadatan yang paling optimal untuk budidaya kerang hijau di perairan pesisir Kuala Langsa, Aceh. Metode penelitian menggunakan rancangan acak lengkap faktorial yang terdiri atas faktor metode (long line dan stick dan faktor kepadatan (20, 30, dan 40 individu/kantong 5,30 L, masing-masing diulang sebanyak empat kali. Berdasarkan sidik ragam data Specific Growth Rate (SGR dari panjang (SGL L dan bobot (SGR W menunjukkan semua perlakuan metode, kepadatan dan interaksi berbeda signifikan pada taraf uji 5% (P<0,05, di mana perlakuan yang paling optimal yaitu perlakuan metode long line dengan kepadatan 20 individu/kantong 5,30 L diperoleh rata-rata nilai SGR (L sebesar 0,86 ± 0,01%/hari dan SGR (W sebesar 1,18 ± 0,04%/hari dengan sintasan mencapai 92,50 ± 2,89%. Parameter kualitas perairan selama periode budidaya masih sesuai untuk mendukung kehidupan kerang hijau di mana suhu berkisar 27,5-34,0°C; salinitas 28,5-33,0 ppt; pH 7,8-8,6; dan oksigen terlarut 4,5-6,5 mg/L; serta kecepatan arus 0,1-0,3 m/s. Budidaya kerang hijau dengan metode long line pada kepadatan 20 individu/kantong 5,30 L merupakan pola budidaya yang paling optimal untuk diterapkan di perairan pesisir Kuala Langsa, Aceh. Green mussel is a very prospective marine aquaculture commodity due to its low cost production but with high profitability. This research aimed to determine the most optimal method and densities for green mussel culture in coastal waters of Kuala Langsa, Aceh. The research used a completely randomized factorial design consisting of methods factor (long line and stick and densities factor (20, 30, and 40 individuals/basket 5.30 L, each repeated four times. Based on the variance analysis of specific growth rate (SGR data of the length (SGR L and weight (SGR W, all treatments of different methods and densities as well as their interactions were significant different (P<0.05. This study suggested that long line method with a densities of 20 individuals/basket 5.30 L was found to be the most optimal treatment for green mussel culture in coastal waters of Kuala Langsa. With this long line method an average SGR (L value of 0.86 ± 0.01%/day, SGR (W value of 1.18 ± 0.04%/day, and survival rate of 92.50 ± 2.89% were obtained. Water quality parameters during the culture period are still within the suitable range for green mussel culture, with the range of temperature 27.5-34.0°C, salinity 28.5-33.0 ppt, pH 7.8-8.6, dissolved oxygen 4.5-6.5 mg/L, and current velocity 0.1-0.3 m/s.

  16. Seasonal variation of oxidative biomarkers in gills and digestive gland of green-lipped mussel Perna viridis from Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    as nmol TBARS formed per mg protein. 2.6.Antioxidant enzymes The activity of total SOD was determined by the method of Paoletti et al. (1990) by monitoring rate of oxidation of NADH. One unit of SOD activity was defined as 50 % inhibition of oxidation...) and endogenous factors such as reproductive cycle (Filho et al., 2001). It is difficult therefore to draw exact conclusion as to which parameter is most effective to bring the changes in the antioxidant observed. However it is clear from the data...

  17. Biometric and morphometric studies of Perna viridis and Perna indica along the southwest coast of India: a statistical approach

    Digital Repository Service at National Institute of Oceanography (India)

    Jayalakshmy, K.V.; Nair, M.; DileepKumar, R.; Vijayan, M.

    of India (Figure 1) and the samples were immediately taken for morphometric measurements. This involves the measurement of Shell Length (LT), Height (HT), Width (WI), Volume (VL), Shell weight (empty shell weight without organism) (WT), Wet weight... (weight of the organism alone) (WW), Total weight (weight of shell and organism) (TW) and Dry weight (weight of dried organism) (DW) of the two mussel species. LT, HT and WI were measured in the laboratory using the vernier calipers accurate to 0.01cm...

  18. Strategi Pemanfaatan Perairan Pesisir untuk Budi Daya Kerang Hijau (Perna viridis L. di Kuala Langsa, Provinsi Aceh

    Directory of Open Access Journals (Sweden)

    Andi Sagita

    2017-12-01

    Full Text Available Development of green mussel culture currently still requires the determination of strategies in accordance with the potential and conditions of coastal areas as well as management culture system. This research aims to formulate strategies of the utilization coastal waters for green mussel culture in coastal Kuala Langsa, Aceh Province. Data collected to identify internal factors and external, including primary and secondary data, while the determination of respondents using purposive sampling method. SWOT Analysis is used for strategy determined while prioritizing strategy using Quantitative Strategies Planning Matrix (QSPM analysis. Based on SWOT analysis, identified 9 strength factors, 4 weakness factors, 6 opportunity factors, and 5 threat factors and 8 strategies, then the priority of strategies is determined with QSPM analysis, the sequence of the most important priority is: counseling and training to improve the management of green mussel culture for coastal communities (WO1; green mussel culture can be integrated with the involvement of coastal communities as stakeholders (WO2; optimization of coastal waters for green mussel culture is supported by ecology conditions (SO1; green mussel culture can be done with longline method with a density of 20 individuals/basket 5.30 l (SO3; site selection for culture and spat collection of green mussel should consider coastal oceanographic factors (ST1; controlling the level of waste disposal from the mainland so as not to pollute coastal areas (ST2; and to formulate practical guidance of management of green mussel culture based on the food security principle.

  19. Responses of neurons of lizard's, Lacerta viridis, vestibular nuclei to electrical stimulation of the ipsi- and contralateral VIIIth nerves.

    Science.gov (United States)

    Richter, A; Precht, W; Ozawa, S

    1975-03-22

    Field and intracellular potentials were recorded in the vestibular nuclei of the lizard following stimulation of the ipsi- and contralateral vestibular nerves. The field potentials induced by ipsilateral VIIIth nerve stimulation consisted of an early negative or positive-negative wave (presynaptic component) followed by a slow negativity (transsynaptic component). The spatial distribution of the field potential complex closely paralleled the extension of the vestibular nuclei. Mono- and polysynaptic EPSPs were recorded from vestibular neurons after ipsilateral VIIIth nerve stimulation. In some neurons early depolarizations preceded the EPSPs. These potentials may be elicited by electrical transmission. Often spikelike partial responses were superimposed on the EPSPs. It is assumed that these potentials represent dendritic spikes. Contralateral VIIIth nerve stimulation generated disynaptic and polysynaptic IPSPs in some neurons and EPSPs in others. The possible role of commissural inhibition in phylogeny is discussed. In a group of vestibular neurons stimulation of the ipsilateral VIIIth nerve evoked full action potentials with latencies ranging from 0.25-1.1msec. These potentials are caused by antidromic activation of neurons which send their axons to the labyrinth.

  20. Detection of maltodextrin and its discrimination from sucrose are independent of the T1R2 + T1R3 heterodimer.

    Science.gov (United States)

    Smith, Kimberly R; Spector, Alan C

    2017-10-01

    Maltodextrins, such as Maltrin and Polycose, are glucose polymer mixtures of varying chain lengths that are palatable to rodents. Although glucose and other sugars activate the T1R2 + T1R3 "sweet" taste receptor, recent evidence from T1R2- or T1R3-knockout (KO) mice suggests that maltodextrins, despite their glucose polymer composition, activate a separate receptor mechanism to generate a taste percept qualitatively distinguishable from that of sweeteners. However, explicit discrimination of maltodextrins from prototypical sweeteners has not yet been psychophysically tested in any murine model. Therefore, mice lacking T1R2 + T1R3 and wild-type controls were tested in a two-response taste discrimination task to determine whether maltodextrins are 1 ) detectable when both receptor subunits are absent and 2 ) perceptually distinct from that of sucrose irrespective of viscosity, intensity, and hedonics. Most KO mice displayed similar Polycose sensitivity as controls. However, some KO mice were only sensitive to the higher Polycose concentrations, implicating potential allelic variation in the putative polysaccharide receptor or downstream pathways unmasked by the absence of T1R2 + T1R3. Varied Maltrin and sucrose concentrations of approximately matched viscosities were then presented to render the oral somatosensory features, intensity, and hedonic value of the solutions irrelevant. Although both genotypes competently discriminated Maltrin from sucrose, performance was apparently driven by the different orosensory percepts of the two stimuli in control mice and the presence of a Maltrin but not sucrose orosensory cue in KO mice. These data support the proposed presence of an orosensory receptor mechanism that gives rise to a qualitatively distinguishable sensation from that of sucrose. Copyright © 2017 the American Physiological Society.

  1. The light-harvesting complexes of higher plant Photosystem I: Lhca1/4 and Lhca2/3 form two red-emitting heterodimers

    NARCIS (Netherlands)

    Wientjes, I.E.; Croce, R.

    2011-01-01

    The outer antenna of higher-plant PSI (Photosystem I) is composed of four complexes [Lhc (light-harvesting complex) a1-Lhca4] belonging to the light-harvesting protein family. Difficulties in their purification have so far prevented the determination of their properties and most of the knowledge

  2. Solution study of the Escherichia coli DNA polymerase III clamp loader reveals the location of the dynamic ψχ heterodimer

    Directory of Open Access Journals (Sweden)

    Farzaneh Tondnevis

    2015-09-01

    Full Text Available Several X-ray crystal structures of the E. coli core clamp loader containing the five core (δ′, δ, and three truncated γ subunits have been determined, but they lack the ψ and χ subunits. We report the first solution structure of the complete seven-subunit clamp loader complex using small angle X-ray scattering. This structure not only provides information about the location of the χ and ψ subunits but also provides a model of the dynamic nature of the clamp loader complex.

  3. Different features of the MHC class I heterodimer have evolved at different rates. Chicken B-F and beta 2-microglobulin sequences reveal invariant surface residues

    DEFF Research Database (Denmark)

    Kaufman, J; Andersen, R; Avila, D

    1992-01-01

    molecules and the MHC-encoded nonclassical molecules more than CD1 or the class I-like FcR. In contrast, the chicken alpha 3 domain is equally homologous to all alpha 3 domains, to beta 2m and to class II beta 2 domains. For each pair of extracellular domains (alpha 1 vs alpha 2, alpha 3 vs beta 2m...... of small exons in the cytoplasmic region. The cDNA sequences were compared to turkey beta 2m, the apparent allele B-F12 alpha and other vertebrate homologs, using the 2.6 A structure of the human HLA-A2 molecule as a model. Both chicken alpha 1 and alpha 2 domains resemble mammalian classical class I...... the ends of the peptide, two residues that bind CD8, and three residues that are phosphorylated. The positions of the allelic residues are conserved. There are other patches of invariant residues on alpha 1, alpha 2, and beta 2m; these might bind TCR or other molecules involved in class I function...

  4. Spectral shift between the near-field and far-field optoplasmonic response in gold nanospheres, nanoshells, homo- and hetero-dimers

    Science.gov (United States)

    Cacciola, A.; Iatì, M. A.; Saija, R.; Borghese, F.; Denti, P.; Maragò, O. M.; Gucciardi, P. G.

    2017-07-01

    We investigate the shift between near- and far-field spectral properties in a set of different gold nanostructures using the multipole expansion of the electromagnetic fields. The optical behavior of isolated spheres, gold-silica nanoshells, homo- and hetero-di7mers is studied computationally as a function of the particle size. We show that in isolated nanospheres, both homogeneous and shell-like, the red-shift between near- and far-field peak intensities increases with nanoparticle dimension and has a universal character that can be attributed to the different spectral behavior of the radial component of the enhanced field, dominating in the near-field, with respect to its transverse part, which determines the far-field properties. Calculations on dimers of closely separated nanospheres, instead, highlight that the spectral shift between the maximum field intensity, calculated at the dimer nanocavity center, and the maximum extinction or scattering, computed in the far-field, strongly depends on both the radius of the monomers and the gap distance. The shift can turn from positive (i.e. red-shift) to negative (i.e.blue-shift) depending on the values of the nanostructure parameters. Our results call into question the universality of the energy red-shift, with relevant implications for the optimization of the efficiency in surface enhanced spectroscopies.

  5. Different features of the MHC class I heterodimer have evolved at different rates. Chicken B-F and beta 2-microglobulin sequences reveal invariant surface residues

    DEFF Research Database (Denmark)

    Kaufman, J; Andersen, R; Avila, D

    1992-01-01

    of small exons in the cytoplasmic region. The cDNA sequences were compared to turkey beta 2m, the apparent allele B-F12 alpha and other vertebrate homologs, using the 2.6 A structure of the human HLA-A2 molecule as a model. Both chicken alpha 1 and alpha 2 domains resemble mammalian classical class I......Chicken beta 2-microglobulin (beta 2m) and class I (B-F19 alpha chain) cDNA clones were isolated and the sequences compared to those of B-F Ag isolated from chicken E. These clones represent the major expressed class I molecules on E, with B-F alpha size variants evidently due to alternative use...... composition in B-F compared to class I molecules from other taxa. Many of the surface residues are quite diverged, particularly in alpha 3 and beta 2m. There are fewer changes in intra- and interdomain contact sites. Some residues with important functions are invariant, including seven residues that bind...

  6. Emergence of state at Fermi level due to the formation of In-Sn heterodimers on Si(100)-2×1

    Czech Academy of Sciences Publication Activity Database

    Sobotík, P.; Setvín, M.; Zimmermann, P.; Kocán, P.; Ošt'ádal, I.; Mutombo, Pingo; Ondráček, Martin; Jelínek, Pavel

    2013-01-01

    Roč. 88, č. 20 (2013), "205406-1"-"205406-7" ISSN 1098-0121 R&D Projects: GA ČR(CZ) GPP204/11/P578; GA ČR GAP204/10/0952 Grant - others:GA AV ČR(CZ) M100101207 Institutional support: RVO:68378271 Keywords : STM * STS * DFT * 1D metallic chains Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.664, year: 2013 http://link. aps .org/doi/10.1103/PhysRevB.88.205406

  7. Identification and characterization of Rvs162/Rvs167-3, a novel N-BAR heterodimer in the human fungal pathogen Candida albicans

    NARCIS (Netherlands)

    Gkourtsa, Areti; van den Burg, Janny; Strijbis, Karin; Avula, Teja; Bijvoets, Sietske; Timm, Dave; Hochstenbach, Frans; Distel, Ben

    Membrane reshaping resides at the core of many important cellular processes and amongst its mediators are the BAR (Bin, Amphiphysin, Rvs) domain-containing proteins. We have explored the diversity and function of the Rvs BAR proteins in Candida albicans and identified a novel family member, Rvs167-3

  8. Identification and characterization of Rvs162/Rvs167-3, a novel N-BAR heterodimer in the human fungal pathogen Candida albicans

    NARCIS (Netherlands)

    Gkourtsa, Areti; van den Burg, Janny; Strijbis, Karin; Avula, Teja; Bijvoets, Sietske; Timm, Dave; Hochstenbach, Frans; Distel, Ben

    2015-01-01

    Membrane reshaping resides at the core of many important cellular processes, and among its mediators are the BAR (Bin, Amphiphysin, Rvs) domain-containing proteins. We have explored the diversity and function of the Rvs BAR proteins in Candida albicans and identified a novel family member, Rvs167-3

  9. Pan-HER - an antibody mixture targeting EGFR, HER2, and HER3 abrogates preformed and ligand-induced EGFR homo- and heterodimers

    DEFF Research Database (Denmark)

    Ellebaek, Sofie; Pedersen, Susanne Brix; Grandal, Michael

    2016-01-01

    The human epidermal growth factor receptor (HER)-family is involved in development of many epithelial cancers. Therefore, HER-family members constitute important targets for anti-cancer therapeutics such as monoclonal antibodies (mAbs). A limitation to the success of single HER-targeting m...... with Pan-HER were investigated by in situ proximity ligation assay and co-immunoprecipitation, demonstrating that Pan-HER and the EGFR-targeting mAb mixture efficiently down-regulate basal EGFR homo- and heterodimerization in two tested cell lines, whereas single mAbs had limited effects. Pan...... development of Pan-HER in resistant settings. This article is protected by copyright. All rights reserved....

  10. PE2 cleavage mutants of Sindbis virus : Correlation between viral infectivity and pH-dependent membrane fusion activation of the spike heterodimer

    NARCIS (Netherlands)

    Smit, JM; Klimstra, WB; Ryman, KD; Bittman, R; Johnston, RE; Wilschut, J

    2001-01-01

    The spike glycoprotein E2 of Sindbis virus (SIN) is synthesized in the infected cell as a PE2 precursor protein, which matures through cleavage by a cellular furin-like protease. Previous work has shown that SIN mutants impaired in PE2 cleavage are noninfectious on BHK-21 cells, the block in

  11. The Yersinia enterocolitica phage shock proteins B and C can form homodimers and heterodimers in vivo with the possibility of close association between multiple domains.

    Science.gov (United States)

    Gueguen, Erwan; Flores-Kim, Josué; Darwin, Andrew J

    2011-10-01

    The Yersinia enterocolitica phage shock protein (Psp) stress response is essential for virulence and for survival during the mislocalization of outer membrane secretin proteins. The cytoplasmic membrane proteins PspB and PspC are critical components involved in regulating psp gene expression and in facilitating tolerance to secretin-induced stress. Interactions between PspB and PspC monomers might be important for their functions and for PspC stability. However, little is known about these interactions and there are conflicting reports about the ability of PspC to dimerize. To address this, we have used a combination of independent approaches to systematically analyze the ability of PspB and PspC to form dimers in vivo. Formaldehyde cross-linking of the endogenous chromosomally encoded proteins in Y. enterocolitica revealed discrete complexes corresponding in size to PspB-PspB, PspC-PspC, and PspB-PspC. Bacterial two-hybrid analysis corroborated these protein associations, but an important limitation of the two-hybrid approach was uncovered for PspB. A series of PspB and PspC proteins with unique cysteine substitutions at various positions was constructed. In vivo disulfide cross-linking experiments with these proteins further supported close association between PspB and PspC monomers. Detailed cysteine substitution analysis of predicted leucine zipper-like amphipathic helices in both PspB and PspC suggested that their hydrophobic faces could form homodimerization interfaces.

  12. The Yersinia enterocolitica Phage Shock Proteins B and C Can Form Homodimers and Heterodimers In Vivo with the Possibility of Close Association between Multiple Domains▿ †

    Science.gov (United States)

    Gueguen, Erwan; Flores-Kim, Josué; Darwin, Andrew J.

    2011-01-01

    The Yersinia enterocolitica phage shock protein (Psp) stress response is essential for virulence and for survival during the mislocalization of outer membrane secretin proteins. The cytoplasmic membrane proteins PspB and PspC are critical components involved in regulating psp gene expression and in facilitating tolerance to secretin-induced stress. Interactions between PspB and PspC monomers might be important for their functions and for PspC stability. However, little is known about these interactions and there are conflicting reports about the ability of PspC to dimerize. To address this, we have used a combination of independent approaches to systematically analyze the ability of PspB and PspC to form dimers in vivo. Formaldehyde cross-linking of the endogenous chromosomally encoded proteins in Y. enterocolitica revealed discrete complexes corresponding in size to PspB-PspB, PspC-PspC, and PspB-PspC. Bacterial two-hybrid analysis corroborated these protein associations, but an important limitation of the two-hybrid approach was uncovered for PspB. A series of PspB and PspC proteins with unique cysteine substitutions at various positions was constructed. In vivo disulfide cross-linking experiments with these proteins further supported close association between PspB and PspC monomers. Detailed cysteine substitution analysis of predicted leucine zipper-like amphipathic helices in both PspB and PspC suggested that their hydrophobic faces could form homodimerization interfaces. PMID:21856846

  13. Structural Insight Into the Role of Mutual Polymorphism and Conservatism in the Contact Zone of the NFR5–K1 Heterodimer With the Nod Factor

    Directory of Open Access Journals (Sweden)

    A. A. Igolkina

    2018-04-01

    Full Text Available Sandwich-like docking configurations of the heterodimeric complex of NFR5 and K1 Vicia sativa receptor-like kinases together with the putative ligand, Nod factor (NF of Rhizobium leguminosarum bv. viciae, were modeled and two of the most probable configurations were assessed through the analysis of the mutual polymorphisms and conservatism. We carried out this analysis based on the hypothesis that in a contact zone of two docked components (proteins or ligands the population polymorphism or conservatism is mutual, i.e., the variation in one component has a reflected variation in the other component. The population material of 30 wild-growing V. sativa (leaf pieces was collected from a large field (uncultivated for the past 25-years and pooled; form this pool, 100 randomly selected cloned fragments of NFR5 gene and 100 of K1 gene were sequenced by the Sanger method. Congruence between population trees of NFR5 and K1 haplotypes allowed us to select two respective haplotypes, build their 3D structures, and perform protein–protein docking. In a separate simulation, the protein-ligand docking between NFR5 and NF was carried out. We merged the results of the two docking experiments and extracted NFR5–NF–K1 complexes, in which NF was located within the cavity between two receptors. Molecular dynamics simulations indicated two out of six complexes as stable. Regions of mutual polymorphism in the contact zone of one complex overlapped with known NF structural variations produced by R. leguminosarum bv. viciae. A total of 74% of the contact zone of another complex contained mutually polymorphic and conservative areas. Common traits of the obtained two stable structures allowed us to hypothesize the functional role of three-domain structure of plant LysM-RLKs in their heteromers.

  14. Structures and functions of crotoxin-like heterodimers and acidic phospholipases A2 from Gloydius intermedius venom: Insights into the origin of neurotoxic-type rattlesnakes.

    Science.gov (United States)

    Yang, Zhang-Min; Guo, Qian; Ma, Zhao-Rui; Chen, Yu; Wang, Zhe-Zhi; Wang, Xu-Min; Wang, Ying-Ming; Tsai, Inn-Ho

    2015-01-01

    The cDNAs encoding four major phospholipases A2 (PLA2s) were sequenced while the expressed sequence tags of Gloydius intermedius venom glands were constructed. These PLA2s were designated as Gintexin-A precursor, Gintexin-B, Gin-E6a and Gin-E6b, respectively. The deduced amino acid sequences of the former two PLA2s are 80% and 90% identical to those of crotoxin-A-precursor and crotoxin-B1, respectively. We also purified Gintexin-A, Gintexin-B, Gin-E6a and Gin-E6b like PLA2 from the venom. The latter three PLA2s are enzymatically active but not strongly anticoagulant for human plasma. Gin-E6a and E6b-like PLA2s induced mouse platelet aggregation but inhibited rabbit platelet aggregation. The isolated Gintexin, a 1:1 complex of Gintexin-A and Gintexin-B, blocked the twitch of chick biventer cervicis tissue presynaptically. Results of N-terminal sequencing and peptide mass fingerprinting reveal that Gintexin-A undergoes proteolytic processing similar to crotoxin-A. This is the first time heterodimeric β-neurotoxins are found in Asian pitviper venom, and incompatible neurotoxic- and hemorrhagic-type venoms are found to evolve in parallel within the genus Gloydius, like in Crotalus. Thus, G. intermedius probably is the ancestor of rattlesnakes with type-II venom, and characterization of its venomics helps us to understand the evolution of heterodimeric neurotoxic PLA2s and the paedomorphic trend observed in Neotropical rattlesnake venoms. For the first time, a heterodimeric neurotoxic PLA2 (designated as Gintexin) has been isolated from the venom of an Asian pitviper, which shows a characteristic venom gland transcriptome similar to those of the neurotoxic type rattlesnakes. The fact that the venom of G. intermedius is less hemorrhagic than those of other Gloydius species, reveals that incompatible neurotoxic- and hemorrhagic-type venoms have evolved in parallel within the genus Gloydius, like the genus Crotalus. Our findings suggest that G. intermedius is the most probable ancestor of some Neotropical rattlesnakes. The results may revolutionize the theory regarding the origin of type-II rattlesnakes and assist with the diagnosis and clinical management of G. intermedius bites. Furthermore, the possibility of using the currently available antivenoms of Neotropical rattlesnakes to treat G. intermedius bites seems feasible. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. The exotic invasive plant, Amaranthus viridis, suppresses the growth of native acacia by altering soil microbial communities structure and functionalities in a sahelian ecosystem

    International Nuclear Information System (INIS)

    Sanon, A.; Beguiristain, T.; Sylla, S.; Berthelin, J.; Duponnois, R.

    2009-01-01

    The functioning and stability of terrestrial ecosystems are mainly determined by plant specific richness and composition, which in turn, are closely interlinked with soil organisms development, in particular, soil microorganisms. One of the main success ways of invasive plants was these exogenous organisms-mediated modifications in soil microbial communities composition and diversity as well as their functioning, thus compromising native plant survival. (Author)

  16. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis)

    International Nuclear Information System (INIS)

    Davies, Warren R.; Siu, William H.L.; Jack, Ralph W.; Wu, Rudolf S.S.; Lam, Paul K.S.; Nugegoda, Dayanthi

    2005-01-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel

  17. Seasonal variation of major elements (Ca, Mg) and trace metals (Fe, Cu, Zn, Mn) and cultured mussel Perna viridis L. and seawater in the Dona Paula Bay, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Parulekar, A.H.

    The major elements and trace metals were analysed from nussel tissue and the seawater taken from three depths (0, 5 and 9 meters) from the culture site. Range of variation in Ca, Mg, Fe, Cu, Zn and Mn were 226-399; 708-1329; 0.005-0.084; BDL-0...

  18. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis)

    Energy Technology Data Exchange (ETDEWEB)

    Davies, Warren R. [Department of Biotechnology and Environmental Biology, RMIT University, Melbourne, Victoria (Australia)]. E-mail: warren.davies@rmit.edu.au; Siu, William H.L. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Jack, Ralph W. [Department of Microbiology, University of Otago, Dunedin (New Zealand); Wu, Rudolf S.S. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Lam, Paul K.S. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Nugegoda, Dayanthi [Department of Biotechnology and Environmental Biology, RMIT University, Melbourne, Victoria (Australia)

    2005-07-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel.

  19. Strong reproductive barriers in a narrow hybrid zone of West-Mediterranean green toads (Bufo viridis subgroup with Plio-Pleistocene divergence

    Directory of Open Access Journals (Sweden)

    Perrin Nicolas

    2010-07-01

    Full Text Available Abstract Background One key question in evolutionary biology deals with the mode and rate at which reproductive isolation accumulates during allopatric speciation. Little is known about secondary contacts of recently diverged anuran species. Here we conduct a multi-locus field study to investigate a contact zone between two lineages of green toads with an estimated divergence time of 2.7 My, and report results from preliminary experimental crosses. Results The Sicilian endemic Bufo siculus and the Italian mainland-origin B. balearicus form a narrow hybrid zone east of Mt. Etna. Despite bidirectional mtDNA introgression over a ca. 40 km North-South cline, no F1 hybrids could be found, and nuclear genomes display almost no admixture. Populations from each side of the contact zone showed depressed genetic diversity and very strong differentiation (FST = 0.52. Preliminary experimental crosses point to a slightly reduced fitness in F1 hybrids, a strong hybrid breakdown in backcrossed offspring (F1 x parental, with very few reaching metamorphosis and a complete and early mortality in F2 (F1 x F1. Conclusion Genetic patterns at the contact zone are molded by drift and selection. Local effective sizes are reduced by the geography and history of the contact zone, B. balearicus populations being at the front wave of a recent expansion (late Pleistocene. Selection against hybrids likely results from intrinsic genomic causes (disruption of coadapted sets of genes in backcrosses and F2-hybrids, possibly reinforced by local adaptation (the ranges of the two taxa roughly coincide with the borders of semiarid and arid climates. The absence of F1 in the field might be due to premating isolation mechanisms. Our results, show that these lineages have evolved almost complete reproductive isolation after some 2.7 My of divergence, contrasting sharply with evidence from laboratory experiments that some anuran species may still produce viable F1 offspring after > 20 My of divergence.

  20. GEOGRAPHIC INFORMATION SYSTEM-BASED MODELING AND ANALYSIS FOR SITE SELECTION OF GREEN MUSSEL, Perna viridis, MARICULTURE IN LADA BAY, PANDEGLANG, BANTEN PROVINCE

    Directory of Open Access Journals (Sweden)

    I Nyoman Radiarta

    2011-06-01

    Full Text Available Green mussel is one of important species cultured in Lada Bay, Pandeglang. To provide a necessary guidance regarding green mussel mariculture development, finding suitable site is an important step. This study was conducted to identify suitable site for green mussel mariculture development using geographic information system (GIS based models. Seven important parameters were grouped into two submodels, namely environmental (water temperature, salinity, suspended solid, dissolve oxygen, and bathymetry and infrastructural (distance to settlement and pond aquaculture. A constraint data was used to exclude the area from suitability maps that cannot be allowed to develop green mussel mariculture, including area of floating net fishing activity and area near electricity station. Analyses of factors and constraints indicated that about 31% of potential area with bottom depth less than 25 m had the most suitable area. This area was shown to have an ideal condition for green mussel mariculture in this study region. This study shows that GIS model is a powerful tool for site selection decision making. The tool can be a valuable tool in solving problems in local, regional, and/or continent areas.

  1. Divergent Host Plant Adaptation Drives the Evolution of Sexual Isolation in the Grasshopper Hesperotettix viridis (Orthoptera: Acrididae) in the Absence of Reinforcement

    Science.gov (United States)

    The beginning stages of lineage divergence can be difficult to detect, as correlations between altered genotypic and phenotypic attributes are often weak early in the process. Shifts in host plant use and divergence in mating signals can lead to sexual isolation and ultimately speciation. To underst...

  2. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis).

    Science.gov (United States)

    Davies, Warren R; Siu, William H L; Jack, Ralph W; Wu, Rudolf S S; Lam, Paul K S; Nugegoda, Dayanthi

    2005-01-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel.

  3. A structural basis for electron transfer in bacterial photosynthesis

    International Nuclear Information System (INIS)

    Norris, J.R.; DiMagno, T.J.; Angerhofer, A.; Chang, C.H.; El-Kabbani, O.; Schiffer, M.

    1989-01-01

    Triplet data for the primary donor in single crystals of bacterial reaction centers of Rhodobacter sphaeroides and Rhodopseudomonas viridis are interpreted in terms of the corresponding x-ray structures. The analysis of electron paramagnetic resonance data from single crystals (triplet zero field splitting and cation and triplet linewidth of the primary special pair donor of bacterial reaction centers) is extended to systems of a non-crystalline nature. A unified interpretation based on frontier molecular orbitals concludes that the special pair behaves like a supermolecule in all wild-type bacteria investigated here. However, in heterodimers of Rb. capsulatus (His M200 changed to Leu or Phe with the result that the M-half of the special pair is converted to bacteriopheophytin) the special pair possesses the EPR properties more appropriately described in terms of a monomer. In all cases the triplet state and cation EPR properties appear to be dominated by the highest occupied molecular orbitals. These conclusions derived from EPR experiments are supplemented by data from Stark spectroscopy of reaction centers from Rb. capsulatus. 41 refs., 3 tabs

  4. Different role for mouse and human CD3delta/epsilon heterodimer in preT cell receptor (preTCR) function: human CD3delta/epsilon heterodimer restores the defective preTCR function in CD3gamma- and CD3gammadelta-deficient mice

    Czech Academy of Sciences Publication Activity Database

    Pan, Q.; Brodeur, J.F.; Drbal, Karel; Vibhuti, P.D.

    2006-01-01

    Roč. 43, č. 11 (2006), s. 1741-1750 ISSN 0161-5890 Institutional research plan: CEZ:AV0Z50520514 Keywords : CD3 * preTCR * receptor signaling Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.768, year: 2006

  5. Cloning and expression of a b(0,+)-like amino acid transporter functioning as a heterodimer with 4F2hc instead of rBAT. A new candidate gene for cystinuria.

    Science.gov (United States)

    Rajan, D P; Kekuda, R; Huang, W; Wang, H; Devoe, L D; Leibach, F H; Prasad, P D; Ganapathy, V

    1999-10-08

    We have cloned a transporter protein from rabbit small intestine, which, when coexpressed with the 4F2 heavy chain (4F2hc) in mammalian cells, induces a b(0,+)-like amino acid transport activity. This protein (4F2-lc6 for the sixth member of the 4F2 light chain family) consists of 487 amino acids and has 12 putative transmembrane domains. At the level of amino acid sequence, 4F2-lc6 shows significant homology (44% identity) to the other five known members of the 4F2 light chain family, namely LAT1 (4F2-lc1), y(+)LAT1 (4F2-lc2), y(+)LAT2 (4F2-lc3), xCT (4F2-lc4), and LAT2 (4F2-lc5). The 4F2hc/4F2-lc6 complex-mediated transport process is Na(+)-independent and exhibits high affinity for neutral and cationic amino acids and cystine. These characteristics are similar to those of the b(0,+)-like amino acid transport activity previously shown to be associated with rBAT (protein related to b(0,+) amino acid transport system). However, the newly cloned 4F2-lc6 does not interact with rBAT. This is the first report of the existence of a b(0,+)-like amino acid transport process that is independent of rBAT. 4F2-lc6 is expressed predominantly in the small intestine and kidney. Based on the characteristics of the transport process mediated by the 4F2hc/4F2-lc6 complex and the expression pattern of 4F2-lc6 in mammalian tissues, we suggest that 4F2-lc6 is a new candidate gene for cystinuria.

  6. Distribution of virulent and pandemic strains of Vibrio parahaemolyticus in three molluscan shellfish species (Meretrix meretrix, Perna viridis, and Anadara granosa) and their association with foodborne disease in southern Thailand.

    Science.gov (United States)

    Vuddhakul, Varaporn; Soboon, Supatinee; Sunghiran, Wattanee; Kaewpiboon, Sukhon; Chowdhury, Ashrafuzzaman; Ishibashi, Masanori; Nakaguchi, Yoshitsugu; Nishibuchi, Mitsuaki

    2006-11-01

    Distribution of pandemic strains of Vibrio parahaemolyticus in seafood, particularly in molluscan shellfish, and their serological and molecular relationships to clinical strains were examined from Hat Yai City in southern Thailand. During 2000 to 2002, virulent strains (tdh+ or trh+) were isolated from 13 of 230 molluscan shellfish samples using alkaline peptone water enrichment followed by immunomagnetic separation. The isolates included 12 pandemic strains (tdh+, trh-, group-specific PCR positive) from five Oriental hard clam samples, five green mussel samples, and one bloody clam sample. Among the pandemic strains, eight belonged to serogroup O3:K6, three belonged to O1:K25, and one was O1:K untypeable. One hundred eighty-seven strains of V. parahaemolyticus were isolated from clinical specimens obtained from a hospital in this city during 2000 to 2001. The pandemic strains comprised 64 and 68% of the isolates in 2000 and 2001, respectively. Among the serotypes of the pandemic strains, O3:K6 was dominant at 73% in 2000 and 76% in 2001 followed by O1:K25 at 20% in 2000 and 13% in 2001. Pulsed-field gel electrophoresis profiles of the pandemic strains from molluscan shellfish were indistinguishable or very similar to those of patient isolates. Similarity of the serotype distribution and DNA fingerprints occurring between the molluscan shellfish strains and clinical strains suggests that molluscan shellfish may be an important source of pandemic V. parahaemolyticus infection in southern Thailand. For public health, proper cooking of molluscan shellfish in this area is strongly recommended.

  7. Protein (Cyanobacteria): 428318141 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GNDMICGTNRRGFQPPSHSSSRLKPTENSSDDAAGNDMICGTNRRGFQPPSHSSSRLKPTENSSETDVDQLTLQSSFRGLSL ...10 179408:410 ... hypothetical protein Osc7112_3223 Oscillatoria nigro-viridis PCC 7112 MWWQLLRIMPKFAPNLSPDDAT

  8. Effect of cooking methods on the micronutrient profile of selected ...

    African Journals Online (AJOL)

    Effect of cooking methods on the micronutrient profile of selected vegetables: okra fruit ( Abelmoshcus esculentus ), fluted pumpkin ( Telfairia occidentalis ), African spinach ( Amarantus viridis ), and scent leaf ( Ocumum gratissimum.

  9. 76 FR 65985 - Importation of Litchi and Longan Fruit From Vietnam Into the Continental United States

    Science.gov (United States)

    2011-10-25

    ... ombrodelta. Non-Lepidopteran Insect Pests: Bactrocera cucurbitae. Bactrocera dorsalis. Ceroplastes rubens... ombrodelta. Non-Lepidopteran Insect Pests: Bactrocera dorsalis. Ceroplastes rubens. Coccus viridis...

  10. GPCR Interaction: 106 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available hat the oligomerization processes take place early during biosynthesis. Agonists ... homo- and hetero-dimers. In addition, ER fractions include homo- and hetero-dimers. These results suggest t

  11. Single-chain vascular endothelial growth factor variant with antagonist activity

    DEFF Research Database (Denmark)

    Boesen, Thomas P; Soni, Bobby; Schwartz, Thue W

    2002-01-01

    receptor molecules and inducing dimerization. By mixing two vascular endothelial growth factor monomers, each with different substitutions, heterodimers with only one active receptor binding site have previously been prepared. These heterodimers bind the receptor molecule but are unable to induce...... dimerization and activation. However, preparation of heterodimers is cumbersome, involving separate expression of different monomers, refolding the mixture, and separating heterodimers from homodimers. Here we show that a fully functional ligand can efficiently be expressed as a single protein chain containing...

  12. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and P. viridis, ...

  13. PRELIMINARY DATA CONCERNING THE HERPETOFAUNA IN NEAM COUNTY (ROMANIA)

    OpenAIRE

    Sorin ROŞU; Iulian GHERGHEL

    2005-01-01

    In the researched area we identified 14 amphibian species: (Salamandra salamndra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Bombina bombina, Bombina variegata, Bufo bufo, Bufo viridis, Pelobates fuscus, Hyla arborea, Rana ridibunda, Rana dalmatina, Rana temporaria) and 8 reptilian species (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Anguis fragilis, Natrix natrix, Elaphe longissima, Coronella austriaca, Vipera berus). Within the region we identi...

  14. HEAVY METALS (Ni, Cu, Zn AND Cd CONTENT IN SERUM OF RAT FED GREEN MUSSELS

    Directory of Open Access Journals (Sweden)

    Muhammad Yudhistira Azis

    2015-11-01

    Full Text Available Green mussel (Perna viridis can playing role as bio-indicator or biomonitoring agent for heavy-metalcontaminations in the sea. In this research, the concentrations of four elements Ni, Cu, Zn and Cd in P. viridis and in the serum of rat which orally feed by P. viridis were determined by Atomic Absorption Spectrometry (AAS following dry acid digestion. Parameter analysis was evaluated by determining confidence limit for the obtained results. The result showed that there was a sequence of heavy-metal content in green mussels sample and laboratory rats serum, such as Ni < Cd < Cu < Zn. Keywords: heavy metals, green mussels, laboratory rats serum, AAS

  15. Phycopeltis kosteriana sp. n., an epiphyllous alga of the family Chroolepidaceae from Australia

    NARCIS (Netherlands)

    Cribb, A.B.

    1967-01-01

    Phycopeltis kosteriana A. B. Cribb, sp. n. — Thallus pallidus viridis, usque ad 250 μ diam., margine inaequale; filamenta prostrata, inaequaliter radiata, plerumque contigua extra margine; thallus paucis parvis foraminibus; cellulae inaequales, plerumque inaequaliter 1, 2 vel 3-furcatae,

  16. Description d’un Gyrinide nouveau

    NARCIS (Netherlands)

    Régimbart, M.

    1887-01-01

    Oralis, sat elongatus, valde convexus, corpore subtus pedibusque pallide testaceis, supra subtilissime reticulatus, niger, anguste flavolimbatus, in capite et pronoto viridi-aenescens, elytris nigris vix metallicis, in regionibus punctatis brunneotomentosis, costa discoïdali sat lata, ante apicem

  17. Two new Malaysian Lichens

    NARCIS (Netherlands)

    Groenhart, P.

    1958-01-01

    Thallus epilithieus, crustaceus, uniformis, continuus, late expansus (usque ad 1 m latus), sat crassus, griseus, laevigatus, subnitidus, pseudocyphellis punctiformibus verruculiformibusque, albis, numerosis instructus, zona marginali laete viridi cinctus, K sordide aurantiacus, Ca et KCa immutatus;

  18. Commonly Abused Drugs Charts

    Science.gov (United States)

    ... alcohol’s effects on the body . ^ Back to top Ayahuasca A hallucinogenic tea made in the Amazon from ... containing plant ( Psychotria viridis ) along with another vine ( Banisteriopsis caapi ) that contains an MAO inhibitor preventing the ...

  19. Ecology and culturing of edible bivalves in Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.; Nair, S.A.; Ansari, Z.A.; Harkantra, S.N.; Chatterji, A.; Ingole, B.S.; Roy, J.M.

    Environmental characteristics, growth rate, total production and technically feasible methods for the mass cultivation of Meretrix casta, Paphia malabarica, Villorita cyprinoides, Donax incarnatus, Perna viridis, Modiolus metcalfei and Crassostrea...

  20. Protein (Cyanobacteria): 281754 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MLYNNEILPTLTVESSPRSMNILLYKLLSLRRIEYIAVDR...YP_007115817.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  1. Protein (Cyanobacteria): 281805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MYLILPDLYANMTYQIDERLNTSPCGFLSFADDGTIVMVN...YP_007118829.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  2. Protein (Cyanobacteria): 281806 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEE...YP_007117793.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  3. Antifouling activities of marine sedentary invertebrates on some macrofoulers

    Digital Repository Service at National Institute of Oceanography (India)

    Wilsanand, V.; Wagh, A.B.; Bapuji, M.

    that the transient presence of active extracts did not cause irreversible damage to P. viridis. The results indicate the possible potentialities of these extracts as natural non toxic antifouling agents....

  4. Improving the Recreational Fishery on Malmstrom Air Force Base

    Science.gov (United States)

    2010-08-01

    24 miles to the south and into Alberta, Canada. Stratigraphic units important to the framework of the region surrounding Malmstrom AFB range in... ranging from standing water (Pow Wow Pond) to intermittent streambeds that flow only after heavy downpour events (USAF 2008). In most cases, these were...viridis viridis), plains garter snake ( Thamnophis radix), and leopard frog (Rana pipiens) were recorded. Six western painted turtles (Chrysemys picta

  5. Assessinent of streptomycesgriseo viridis (mycostop as a biocontrol agent for fusarium oxysporum f. sp. dianthiin two cultivars of standard carnation under commercial conditions Evaluación de Streptomyces griseoviridis (MYCOSTOP en el control de Fusarium oxysporum f.sp. dianthi, en dos variedades de clavel estándar bajo condiciones comerciales

    Directory of Open Access Journals (Sweden)

    Ortega Luis Miguel

    1994-06-01

    Full Text Available The research was carried out in a commercial farm, located in Madrid, Cundinamarca. The purpose of the study was to established the rate and irequency of application of Streptomyces griseoviridis (Mycostop in the control of vascular wilt of carnation caused by Fusarium oxysporum f.sp. dianthi. Two experiments were conducted to compare three rates of application (0,025;0,05 and 0,01 g/m2 and
    three intervals of application (1,2 and 4 weeks of
    Mycostop, in two standard carnation varieties. Disease
    progress data were analized by comparing their godness of fit to Gompertz and Monomolecular epidemiological models. By using the simpler linear regression model, the rate of inlection (k and the coefficient of determination (Al were calculated.
    Inlection rates were subjected to analysis of variance.
    The results showed no satislactory control of the disease. Rates and frecuencies of applícation of Streptomyces griseoviridis (Mycostop did not show appreciable differences. Epidemiologically, "k" values were highly homogeneous among the different Mycostop treatments. Streptomyces
    griseoviridisis highly dependent upon culture media
    pH, and it grows only at a pH 016,4 or higher, with an optimal growth at a pH 7,0. No relation was detected between growth of the biocontrol organism and levels of electrical conductivity.La investigación se realizó en un cultivo comercial de clavel localizado en el municipio de Madrid (Cundinamarca, con el objetivo de determinar la dosis y la frecuencia de aplicación de Streptomyces griseoviridis (Mycostop en el control del
    marchitamiento vascular ocasionado por Fusarium oxysporom lsp. dianthi. En el campo, se realizaron dos experimentos simultáneos, para probar diferentes dosis (0,025; 0,05 y 0,1 g/m2 y frecuencias (1, 2 y 4 semanas de aplicación de
    Streptomyces griseoviridis Mycostop en dos variedades de clavel estándar. El análisis estadístico consistió en utilizar algunos modelos epidemiológicos de predicción de la enfermedad, con el fin de observar su progreso en los dilerentes tratamientos. Posteriormente, mediante un análisis
    de regresión lineal simple, se calculó la tasa de infección (k y el coeficiente de determinación (R2, el cual indicó el modelo que más se ajustó a la realidad. Por medio de un análisis de varianza, se compararon las tasas de infección. Los resultados de los experimentos no fueron satislactorios en el
    control de la entermedady no se encontraron diferencias signilicativas entre las dosis y las frecuencias de aplicación de Streptomyces gríseovirídís (Mycostop utilizadas. Un
    comportamiento epidemiológico estadísticamente homogéneo se observó en las curvas de predicción de la enfermedad por bloque. Streptomyces griseoviridises muy dependiente de las condiciones de pH del medio de cultivo, pues, sólo se desarrolló a partir de un pH de 6,4 y con un óptimo
    crecimiento, a 7,0. No se observó una relación entre el desarrollo del organismo y la conductividad eléctrica.

  6. Canopy-forming seaweeds in urchin-dominated systems in eastern Canada: structuring forces or simple prey for keystone grazers?

    Directory of Open Access Journals (Sweden)

    Caitlin Blain

    Full Text Available Models of benthic community dynamics for the extensively studied, shallow rocky ecosystems in eastern Canada emphasize kelp-urchin interactions. These models may bias the perception of factors and processes that structure communities, for they largely overlook the possible contribution of other seaweeds to ecosystem resilience. We examined the persistence of the annual, acidic (H2SO4, brown seaweed Desmarestia viridis in urchin barrens at two sites in Newfoundland (Canada throughout an entire growth season (February to October. We also compared changes in epifaunal assemblages in D. viridis and other conspicuous canopy-forming seaweeds, the non-acidic conspecific Desmarestia aculeata and kelp Agarum clathratum. We show that D. viridis can form large canopies within the 2-to-8 m depth range that represent a transient community state termed "Desmarestia bed". The annual resurgence of Desmarestia beds and continuous occurrence of D. aculeata and A. clathratum, create biological structure for major recruitment pulses in invertebrate and fish assemblages (e.g. from quasi-absent gastropods to >150,000 recruits kg(-1 D. viridis. Many of these pulses phase with temperature-driven mass release of acid to the environment and die-off in D. viridis. We demonstrate experimentally that the chemical makeup of D. viridis and A. clathratum helps retard urchin grazing compared to D. aculeata and the highly consumed kelp Alaria esculenta. In light of our findings and related studies, we propose fundamental changes to the study of community shifts in shallow, rocky ecosystems in eastern Canada. In particular, we advocate the need to regard certain canopy-forming seaweeds as structuring forces interfering with top-down processes, rather than simple prey for keystone grazers. We also propose a novel, empirical model of ecological interactions for D. viridis. Overall, our study underscores the importance of studying organisms together with cross-scale environmental

  7. Canopy-Forming Seaweeds in Urchin-Dominated Systems in Eastern Canada: Structuring Forces or Simple Prey for Keystone Grazers?

    Science.gov (United States)

    Blain, Caitlin; Gagnon, Patrick

    2014-01-01

    Models of benthic community dynamics for the extensively studied, shallow rocky ecosystems in eastern Canada emphasize kelp-urchin interactions. These models may bias the perception of factors and processes that structure communities, for they largely overlook the possible contribution of other seaweeds to ecosystem resilience. We examined the persistence of the annual, acidic (H2SO4), brown seaweed Desmarestia viridis in urchin barrens at two sites in Newfoundland (Canada) throughout an entire growth season (February to October). We also compared changes in epifaunal assemblages in D. viridis and other conspicuous canopy-forming seaweeds, the non-acidic conspecific Desmarestia aculeata and kelp Agarum clathratum. We show that D. viridis can form large canopies within the 2-to-8 m depth range that represent a transient community state termed “Desmarestia bed”. The annual resurgence of Desmarestia beds and continuous occurrence of D. aculeata and A. clathratum, create biological structure for major recruitment pulses in invertebrate and fish assemblages (e.g. from quasi-absent gastropods to >150 000 recruits kg−1 D. viridis). Many of these pulses phase with temperature-driven mass release of acid to the environment and die-off in D. viridis. We demonstrate experimentally that the chemical makeup of D. viridis and A. clathratum helps retard urchin grazing compared to D. aculeata and the highly consumed kelp Alaria esculenta. In light of our findings and related studies, we propose fundamental changes to the study of community shifts in shallow, rocky ecosystems in eastern Canada. In particular, we advocate the need to regard certain canopy-forming seaweeds as structuring forces interfering with top-down processes, rather than simple prey for keystone grazers. We also propose a novel, empirical model of ecological interactions for D. viridis. Overall, our study underscores the importance of studying organisms together with cross-scale environmental variability

  8. Individual specialization to non-optimal hosts in a polyphagous marine invertebrate herbivore.

    Science.gov (United States)

    Baumgartner, Finn A; Pavia, Henrik; Toth, Gunilla B

    2014-01-01

    Factors determining the degree of dietary generalism versus specialism are central in ecology. Species that are generalists at the population level may in fact be composed of specialized individuals. The optimal diet theory assumes that individuals choose diets that maximize fitness, and individual specialization may occur if individuals' ability to locate, recognize, and handle different food types differ. We investigate if individuals of the marine herbivorous slug Elysia viridis, which co-occur at different densities on several green macroalgal species in the field, are specialized to different algal hosts. Individual slugs were collected from three original algal host species (Cladophora sericea, Cladophora rupestris and Codium fragile) in the field, and short-term habitat choice and consumption, as well as long-term growth (proxy for fitness), on four algal diet species (the original algal host species and Chaetomorpha melagonium) were studied in laboratory experiments. Nutritional (protein, nitrogen, and carbon content) and morphological (dry weight, and cell/utricle volume) algal traits were also measured to investigate if they correlated with the growth value of the different algal diets. E. viridis individuals tended to choose and consume algal species that were similar to their original algal host. Long-term growth of E. viridis, however, was mostly independent of original algal host, as all individuals reached a larger size on the non-host C. melagonium. E. viridis growth was positively correlated to algal cell/utricle volume but not to any of the other measured algal traits. Because E. viridis feeds by piercing individual algal cells, the results indicate that slugs may receive more cytoplasm, and thus more energy per unit time, on algal species with large cells/utricles. We conclude that E. viridis individuals are specialized on different hosts, but host choice in natural E. viridis populations is not determined by the energetic value of seaweed diets

  9. Individual specialization to non-optimal hosts in a polyphagous marine invertebrate herbivore.

    Directory of Open Access Journals (Sweden)

    Finn A Baumgartner

    Full Text Available Factors determining the degree of dietary generalism versus specialism are central in ecology. Species that are generalists at the population level may in fact be composed of specialized individuals. The optimal diet theory assumes that individuals choose diets that maximize fitness, and individual specialization may occur if individuals' ability to locate, recognize, and handle different food types differ. We investigate if individuals of the marine herbivorous slug Elysia viridis, which co-occur at different densities on several green macroalgal species in the field, are specialized to different algal hosts. Individual slugs were collected from three original algal host species (Cladophora sericea, Cladophora rupestris and Codium fragile in the field, and short-term habitat choice and consumption, as well as long-term growth (proxy for fitness, on four algal diet species (the original algal host species and Chaetomorpha melagonium were studied in laboratory experiments. Nutritional (protein, nitrogen, and carbon content and morphological (dry weight, and cell/utricle volume algal traits were also measured to investigate if they correlated with the growth value of the different algal diets. E. viridis individuals tended to choose and consume algal species that were similar to their original algal host. Long-term growth of E. viridis, however, was mostly independent of original algal host, as all individuals reached a larger size on the non-host C. melagonium. E. viridis growth was positively correlated to algal cell/utricle volume but not to any of the other measured algal traits. Because E. viridis feeds by piercing individual algal cells, the results indicate that slugs may receive more cytoplasm, and thus more energy per unit time, on algal species with large cells/utricles. We conclude that E. viridis individuals are specialized on different hosts, but host choice in natural E. viridis populations is not determined by the energetic value of

  10. Analysis of polyphenolic antioxidants from the fruits of three pouteria species by selected ion monitoring liquid chromatography-mass spectrometry.

    Science.gov (United States)

    Ma, Jun; Yang, Hui; Basile, Margaret J; Kennelly, Edward J

    2004-09-22

    Pouteria campechiana, Pouteria sapota, and Pouteria viridis are tropical plants in the Sapotaceae family that bear edible fruits. The fresh fruits of these three Pouteria species were each extracted, and activity-guided fractionations were performed to identify the antioxidant constituents. Seven polyphenolic antioxidants, gallic acid (1), (+)-gallocatechin (2), (+)-catechin (3), (-)-epicatechin (4), dihydromyricetin (5), (+)-catechin-3-O-gallate (6), and myricitrin (7), were isolated and identified. Extracts of the three Pouteria fruits were analyzed by a selected ion monitoring liquid chromatography-mass spectrometry method to quantify their polyphenolic antioxidants. The highest level of the seven measured polyphenols was found in P. sapota, the second highest in P. viridis, and the lowest in P. campechiana. The levels of the seven polyphenols corresponded with the results of the 1,1-diphenyl-2-picrylhydrazyl assay, by which P. sapota had the highest antioxidant activity, P. viridis the second highest, and P. campechiana the lowest.

  11. Spatial distribution-patterns on the Northern Dobrogean mainland ( of the species belonging to ”green lizards” group of the Lacerta genus

    Directory of Open Access Journals (Sweden)

    TÖRÖK Zsolt

    2009-09-01

    Full Text Available Based on the results of field investigations carried out in 1994 – 2008 period, the author established the general distributional patterns in the northern part of the Dobrogean mainland of three lizard species. The Sand Lizards (Lacerta agilis populates habitats with linear shape, the species being present along river valleys and some roads. The Balkan Green Lizards (L. trilineata and the Green Lizards (L. viridis were recorded mostly nearby or inside the forests (or plantations. In case of L. trilineata and L. viridis there is quite obvious the spatial segregation: in areas where the two species were present, the Balkan Green Lizard (L. trilineata occurs mostly at lower altitudes, meanwhile the Green Lizard (L. viridis was more frequently present at higher altitudes.

  12. [Spatial distribution pattern and allometric growth of three common species on moving sand dunes in Horqin Sandy Land, China].

    Science.gov (United States)

    Jia, Mei-yu; Li, Xue-hua; Oh, Choong-hyeon; Park, Hong-chul; Miao, Chun-ping; Han, Xu

    2015-10-01

    Research on fine scale pattern and characteristics of allometric growth could contribute to better understanding plants' adaptation in moving sandy dunes. The abundance, height and biomass of 3 species Agriophilum aquarrosum, Corispermum candelabrum and Setaria viridis in twenty-eight 1 m x 1 m quadrats of Horqin Sandy Land were identified, mapped and described. The nearest neighbor method and O-ring O(r) function analysis were applied to analyze the spatial patterns. The results showed that the individual spatial pattern was mainly aggregated in 1 m x 1 m quadrat at community level but mainly random at population level. At 0-50 cm individual distance scale, both intraspecific and interspecific relationship were facilitation and aggregated distribution occurred at some scales and varied with increasing plant abundance in 1 m x 1 m quadrat. In 0-40 cm, the aggregated distribution of S. viridis and A. aquarrosum increased obviously; in 10-20 cm, both intraspecific and interspecific aggregation increased; in 10-30 cm, the occurrence possibility of positive correlations between S. viridis and A. aquarrosum, S. viridis and C. candelabrum all increased; in 40-50 cm, the possibility of positive correlations between A. squarrosum and S. viridis, A. squarrosum and C. candelabrum all increased. Research on the three species components indicated that the growth rate of above-ground was faster than that of underground. S. viridis had the highest ratio of under-ground biomass to above-ground biomass but its nutritional organs' biomass ratio was medium. C. candelabrum allocated more biomass to propagative organs and stem, but A. squarrosum allocated more biomass to nutritional organs. Based on the spatial distribution and allometric characteristics, the three common species in moving sand dunes preferred r strategy in their life history.

  13. Ag nanoprisms with Ag₂S attachment.

    KAUST Repository

    Xiong, Shenglin

    2013-01-01

    Triangular Ag nanoprisms are a type of most-studied noble-metal nanostructures over the past decade owing to their special structural architecture and outstanding optical and catalytic properties for a wide range of applications. Nevertheless, in contrast to active research for the synthesis of phase-pure Ag nanoprisms, no asymmetric heterodimers containing Ag prisms have been developed so far, probably due to lack of suitable synthetic methods. Herein, we devise a simple ion-exchange method to synthesize Ag2S/Ag heterodimers at room temperature, through which Ag nanoprisms with controllable size and thickness can be fabricated. Formation chemistry and optical properties of the heterodimers have been investigated. These semiconductor/metal heterodimers have exhibited remarkable bactericidal activity to E. coli cells under visible light illumination.

  14. Identification of estrogen receptor dimer selective ligands reveals growth-inhibitory effects on cells that co-express ERα and ERβ.

    Directory of Open Access Journals (Sweden)

    Emily Powell

    Full Text Available Estrogens play essential roles in the progression of mammary and prostatic diseases. The transcriptional effects of estrogens are transduced by two estrogen receptors, ERα and ERβ, which elicit opposing roles in regulating proliferation: ERα is proliferative while ERβ is anti-proliferative. Exogenous expression of ERβ in ERα-positive cancer cell lines inhibits cell proliferation in response to estrogen and reduces xenografted tumor growth in vivo, suggesting that ERβ might oppose ERα's proliferative effects via formation of ERα/β heterodimers. Despite biochemical and cellular evidence of ERα/β heterodimer formation in cells co-expressing both receptors, the biological roles of the ERα/β heterodimer remain to be elucidated. Here we report the identification of two phytoestrogens that selectively activate ERα/β heterodimers at specific concentrations using a cell-based, two-step high throughput small molecule screen for ER transcriptional activity and ER dimer selectivity. Using ERα/β heterodimer-selective ligands at defined concentrations, we demonstrate that ERα/β heterodimers are growth inhibitory in breast and prostate cells which co-express the two ER isoforms. Furthermore, using Automated Quantitative Analysis (AQUA to examine nuclear expression of ERα and ERβ in human breast tissue microarrays, we demonstrate that ERα and ERβ are co-expressed in the same cells in breast tumors. The co-expression of ERα and ERβ in the same cells supports the possibility of ERα/β heterodimer formation at physio- and pathological conditions, further suggesting that targeting ERα/β heterodimers might be a novel therapeutic approach to the treatment of cancers which co-express ERα and ERβ.

  15. Repeated Clozapine Increases the Level of Serotonin 5-HT1AR Heterodimerization with 5-HT2A or Dopamine D2 Receptors in the Mouse Cortex

    Science.gov (United States)

    Szlachta, Marta; Kuśmider, Maciej; Pabian, Paulina; Solich, Joanna; Kolasa, Magdalena; Żurawek, Dariusz; Dziedzicka-Wasylewska, Marta; Faron-Górecka, Agata

    2018-01-01

    G-protein–coupled receptor (GPCR) heterodimers are new targets for the treatment of schizophrenia. Dopamine D2 receptors and serotonin 5-HT1A and 5-HT2A receptors play an important role in neurotransmission and have been implicated in many human psychiatric disorders, including schizophrenia. Therefore, in this study, we investigated whether antipsychotic drugs (clozapine (CLZ) and haloperidol (HAL)) affected the formation of heterodimers of D2–5-HT1A receptors as well as 5-HT1A–5-HT2A receptors. Proximity ligation assay (PLA) was used to accurately visualize, for the first time, GPCR heterodimers both at in vitro and ex vivo levels. In line with our previous behavioral studies, we used ketamine to induce cognitive deficits in mice. Our study confirmed the co-localization of D2/5-HT1A and 5-HT1A/5-HT2A receptors in the mouse cortex. Low-dose CLZ (0.3 mg/kg) administered repeatedly, but not CLZ at 1 mg/kg, increased the level of D2–5-HT1A and 5-HT1A–5-HT2A heterodimers in the mouse prefrontal and frontal cortex. On the other hand, HAL decreased the level of GPCR heterodimers. Ketamine affected the formation of 5-HT1A–5-HT2A, but not D2–5-HT1A, heterodimers. PMID:29497362

  16. Heterodimerization of wild-type and mutant fibroblast growth factor receptors in cell-derived vesicles

    Science.gov (United States)

    Hristova, Kalina; Del Piccolo, Nuala; Sarabipour, Sarvenaz

    The activity of receptor tyrosine kinases (RTKs) is controlled through their lateral dimerization in the plasma membrane. RTKs are believed to form both homodimers and heterodimers, and the different dimers are believed to play unique roles in cell signaling. However, RTK heterodimers remain poorly characterized, as compared to homodimers, due to limitations in current experimental methods. Here, we develop a Förster Resonance Energy Transfer (FRET)-based methodology to assess the thermodynamics of hetero-interactions in the plasma membrane. To demonstrate the utility of the methodology, we use it to study the hetero-interactions between three Fibroblast Growth Factor Receptors - FGFR1, FGFR2, and FGFR3 - in the absence of ligand. Our results show that all possible FGFR heterodimers form, suggesting that the biological roles of FGFR heterodimers may be as significant as the homodimer roles. We further investigate the effect of two pathogenic point mutations in FGFR3 (A391E and G380R) on heterodimerization. We show that each of these mutations stabilize most of the heterodimers, with the largest effects observed for FGFR3 wild-type/mutant heterodimers. We thus demonstrate that the methodology presented here can yield new knowledge about RTK interactions and can further our understanding of signal transduction across the plasma membrane..

  17. Dicty_cDB: Contig-U08145-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 50 1e-04 AF021822_1( AF021822 |pid:none) Scaptodrosophila lebanonensis supe... ...emonia viridis copper/zinc super... 49 6e-04 AF021824_1( AF021824 |pid:none) Hirtodrosophila pictiventris su

  18. Effect of manures on biomass production and pharmacobiochemical properties of some greens.

    Science.gov (United States)

    Banu, S Naseer; Sivakumar, A; Subramanian, M S

    2003-10-01

    The present paper deals with the study of biomass production of manures in the greens such as Amaranthus polygamus and Amaranthus viridis of the family Amaranthaceae and Spinacea oleracea of the family Chenopodiaceae. The medicinal uses and pharmaco - phytochemical analysis were also carried out for the plant species which are widely used as greens.

  19. EFFECT OF MANURES ON BIOMASS PRODUCTION AND PHARMACOBIOCHEMICAL PROPERTIES OF SOME GREENS

    OpenAIRE

    Banu, S. Naseer; Sivakumar, A.; Subramanian, M. S.

    2003-01-01

    The present paper deals with the study of biomass production of manures in the greens such as Amaranthus polygamus and Amaranthus viridis of the family Amaranthaceae and Spinacea oleracea of the family Chenopodiaceae. The medicinal uses and pharmaco – phytochemical analysis were also carried out for the plant species which are widely used as greens.

  20. Variability of Venom-Neutralizing Properties of Serum from Snakes of the Colubrid Genus Lampropeltis

    Science.gov (United States)

    1992-01-01

    chick in the terciopelo Bothrops asper venom by blood se- zootoxicologic studies on venoms. Copeia 1959: rum of the colubnd snake Cletie dIeia. Toxicon 20...effect of Bothrops jararaca and faded rattlesnake (Crotalus viridis concolor) venom: Waglerophis merremii snake plasma on the coagu- lethal toxicity and

  1. Review of the West Indian genus Monotalla Bechyné (Coleoptera, Chrysomelidae, Galerucinae, Alticini) with description of five new species

    Science.gov (United States)

    Konstantinov, Alexander S.; Linzmeier, Adelita M.; Clark, Shawn M.; Ivie, Michael A.

    2015-01-01

    Abstract The West Indian genus Monotalla Bechyné is reviewed, redescribed and illustrated. Five new species are added: Monotalla dominica sp. n. (Dominica); Monotalla lecticofolia sp. n. (St. Lucia); Monotalla maierae sp. n. (St. Lucia); Monotalla obrienorum sp. n. (Grenada); and Monotalla viridis sp. n. (St. Lucia). A key to Monotalla species is provided. PMID:26052242

  2. On a new species of Lanistes

    NARCIS (Netherlands)

    Schepman, M.M.

    1891-01-01

    Testa sinistrorsa, anguste umbilicata, conico-globosa, aut flavido- aut viridi-olivacea, semper fasciis spiralibus purpureis angustis in anfr. ultimo picta; spira scalaris, magis minusve conica; apex obtusus. Anfr. 5½, superne vel acute angulati vel carinati, supra plani, carina interdum linea

  3. Host species and habitat affect nodulation by specific Frankia genotypes in two species of Alnus in interior Alaska

    Science.gov (United States)

    Michael Damon Anderson; Roger W. Ruess; David D. Myrold; D. Lee. Taylor

    2009-01-01

    This study examined the genetic structure (nifD-K spacer RFLP haplotypes) of Frankia assemblages symbiotic with two species of Alnus (A. tenuifolia and A. viridis) in four successional habitats in interior Alaska. We used one habitat in which both hosts occurred to...

  4. Egg numbers and fecundity traits in nine species of Mantella poison ...

    African Journals Online (AJOL)

    The body size and number of eggs in dissected females were analysed in nine species of the Malagasy frog genus Mantella basing upon preserved specimens. These species were distinguished in terms of habitat and grouped as 'grassland species' (included M. betsileo, M. expectata, M. viridis), and 'rainforest species' ...

  5. Macrofauna Settlement on Pearl Oyster Collectors in Kenya ...

    African Journals Online (AJOL)

    was higher during the northeast monsoon season than the southeast monsoon season. Ascidiians and Sabellidae were significantly more abundant on collectors during the southeast monsoon season. A few bivalve species of commercial value including: P. penguin, Perna viridis and. Anadara antiquata also settled on ...

  6. Volume 9 No. 9 December 2009 POTENTIAL IMPACT ON ...

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... Western Tree- hyrax. Long-tailed/Tree. Pangolin. Dendrohyrax Dorsalis. Manis tricuspis. T. E. C. S. 11. 2. REPTILIA. Reptila. Nile croccodilus. Monitor lizard. Water moccasin. Rock python. Green mamba. Black cobra. Hingeback. Croccodilus niloticus. Veranus niloticus. Python sebae. Dendrospis viridis.

  7. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution.

    Science.gov (United States)

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena

    2015-01-01

    Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements.

  8. Browse Title Index

    African Journals Online (AJOL)

    Vol 7, No 17 (2008), Anti-emetic activity of Grewia lasiodiscus root extract and fractions, Abstract PDF. AY Tijani, SE Okhale, FE Oga, SZ Tags, OA Salawu, BA Chindo. Vol 13, No 27 (2014), Antifouling potential of seaweed, sponge and cashew nut oil extracts against biofilm bacteria and green mussel Perna viridis from ...

  9. Observations on the activity patterns of the lesser yellow house bat ...

    African Journals Online (AJOL)

    lesser yellow house bat, Scotophilus viridis. F.P.D. Cotterill c/o Department of Zoology, University of Cape Town,. Cape Town. S.R. Giddings·. Department of Zoology, University of Pretoria, Pretoria,. 0002 Republic of South Africa. Received 10 June 1986; accepted 23 July 1986. The activity pattems of the lesser yellow ...

  10. On a new species of toad from southern Morocco

    NARCIS (Netherlands)

    Hoogmoed, M.S.

    1972-01-01

    A new species of toad, related with Bufo calamita Laurenti and B. viridis Laurenti, is described from the southern part of Morocco. Combining the data of the available specimens with literature records it was established that the new species probably ranges from the Sous valley southwards to Cape

  11. The placenta and foetal membranes of the lesser yellow house bat ...

    African Journals Online (AJOL)

    1988-06-05

    Jun 5, 1988 ... Scotophilus viridis (Vespertilionidae) in Kruger National. Park, South Africa. J. Mammal. 66(3): 461-468. FENTON, M.B. & RAUTENBACH, I.L. 1986. A comparison of the roosting and foraging behaviour of three species of African insectivorous bats. (Rhinolophidae, Vespertilionidae, and Molossidae). Can.

  12. Effects of sand burial on the survival and physiology of three ...

    African Journals Online (AJOL)

    Corispermum macrocarpum, Setaria viridis and Agriophyllum squarrosum are dominant psammophytes with strong environmental adaptability in Horqin Sandy Land, a typical agro-pastoral ecotone with frequent and intense sand activity in Northern China. We studied the survival rates, activity of antioxidant enzyme ...

  13. Palynomorphs and floral bloom as taxonomic characters in some ...

    African Journals Online (AJOL)

    Fresh flowers of five species of Amaranthus were studied and documented in detail using light microscope to examine their morphology and pollen characteristics in relation to taxonomy. These species include Amaranthus spinosus, A. viridis, A. hybridus, A. australis and A. tricolor. The species showed close relationship in ...

  14. Phytoplankton Community Responses in A Perturbed Tropical ...

    African Journals Online (AJOL)

    Euglena viridis was the only member of the class Euglenophyceae recorded in the river and it occurred only sporadically in station 1. The low fauna diversity experienced in station 2 throughout the period of sampling showed strong evidence of impact arising from the abattoir waste discharge and heavy human activities at ...

  15. Conditional Reduction of Predation Risk Associated with a Facultative Symbiont in an Insect.

    Directory of Open Access Journals (Sweden)

    Sarah Polin

    Full Text Available Symbionts are widespread among eukaryotes and their impacts on the ecology and evolution of their hosts are meaningful. Most insects harbour obligate and facultative symbiotic bacteria that can influence their phenotype. In the pea aphid Acyrthosiphon pisum, an astounding symbiotic-mediated phenotype has been recently observed: when infected with the symbiotic bacteria Rickettsiella viridis, young red aphid larvae become greener at adulthood and even darker green when co-infected with Rickettsiella viridis and Hamiltonella defensa. As body colour affects the susceptibility towards natural enemies in aphids, the influence of the colour change due to these facultative symbionts on the host survival in presence of predators was tested. Our results suggested that the Rickettsiella viridis infection may impact positively host survival by reducing predation risk. Due to results from uninfected aphids (i.e., more green ones attacked, the main assumption is that this symbiotic infection would deter the predatory ladybird feeding by reducing the profitability of their hosts rather than decreasing host detection through body colour change. Aphids co-infected with Rickettsiella viridis and Hamiltonella defensa were, however, more exposed to predation suggesting an ecological cost associated with multiple infections. The underlying mechanisms and ecological consequences of these symbiotic effects are discussed.

  16. Sidi Saâd reservoir

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2012-01-12

    Jan 12, 2012 ... with environmental factors in a semi arid area: Sidi. Saâd reservoir .... between changes in environmental parameters, biological factors and ..... Dinophyceae. Copepoda. Anabaena sp. Gonyaulax sp. Acanthocyclops robustus Acanthocyclops viridis. Chroococcus sp. Gonyaulax spinifera. Gloeothece sp.

  17. William Burroughs: Sailor of the Soul.

    Science.gov (United States)

    Lees, Andrew J

    2017-01-01

    In 1953, William Seward Burroughs made several important and largely unrecognized discoveries relating to the composition and clinical pharmacological effects of the hallucinogenic plant potion known as yagé or ayahuasca. Illustrations of Burroughs' voucher sample of Psychotria viridis and his letter to the father of modern ethnobotany, Richard Evans Schultes, are published here for the very first time.

  18. Antifouling potential of seaweed, sponge and cashew nut oil extracts ...

    African Journals Online (AJOL)

    The seaweeds, Sargassum wightii, Ulva lactuca; sponge Desmopsongiae sp., and cashew nut oil extracts were tested in vitro against ten marine fouling bacteria isolated from test panels and the green mussel Perna viridis. The biofilm bacteria growth was inhibited by methanol extracts of the seaweeds S. wightii, U. lactuca, ...

  19. potential antagonistic fungal species from ethiopia for biological ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Ten commercial products of these three species were developed for controlling diseases on different crops (Frevel et al., 1998). T. harzianum and T. viridi were reported as biocontrol agent for chocolate spot of grape, apple and strawberry caused by B. cinerea. (Sutton et al., 1997; Hjeljord et al., 2001). Other fungi prevalent ...

  20. The status of Vespertilio borbonicus E. Geoffroy, 1803 (Chiroptera: Vespertilionidae)

    NARCIS (Netherlands)

    Hill, J.E.

    1980-01-01

    The taxonomic history of Scotophilus borbonicus (E. Geoffroy, 1803) from Réunion Island is reviewed and summarised, with the designation of a lectotype. The insular form that it represents is considered conspecific with the small Scotophilus viridis (Peters, 1852) of southern Africa. As a result,

  1. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and.

  2. Browse Title Index

    African Journals Online (AJOL)

    Vol 15, No 8 (2016), Antiproliferative activity of protein extracts from the black clam (Chione fluctifraga) on human cervical and breast cancer cell lines, Abstract PDF ... Vol 8, No 10 (2009), Antiproliferative heparin (glycosaminoglycans) isolated from giant clam (Tridacna maxima) and green mussel (Perna viridis), Abstract ...

  3. A note on scavenging behaviour of adult Hermann’s tortoise (Testudo hermanni

    Directory of Open Access Journals (Sweden)

    Nikolić, M.

    2016-09-01

    Full Text Available Report of the first observation of scavenging behaviour in the population of Testudo hermanni boettgeri that has been monitored for six years in the village Kunovica near the city of Niš in Serbia. On 31 May 2015 at 10:18 a.m., the adult tortoise was observed while eating a dead European green lizard (Lacerta viridis.

  4. Parasitic helminths of reptiles (Reptilia) in South Moravia (Czech Republic).

    Science.gov (United States)

    Borkovcová, M; Kopriva, J

    2005-01-01

    An helminthological investigation of 104 reptile species was carried out in south Moravia (Czech Republic). We examined Lacerta viridis, L. agilis, Anguis fragilis, Natrix natrix, Coronella austriaca and Vipera berus. Twelve species of parasites were found. Among these, Nematoda occurred most often, followed by Trematoda and Cestoda. No Acanthocephala were detected.

  5. 78 FR 49251 - Notice of Decision To Authorize the Importation of Fresh Pitayas and Pomegranates From Mexico...

    Science.gov (United States)

    2013-08-13

    ... significance by Mexico's NPPO: Aleurodicus disperses, Ceroplastes rubens, Coccus viridis, Maconellicoccus... . The pests A. disperses, C. rubens, M. hirsutus, and D. neobrevipes are on the regulated pest list for..., actionable organisms. We believe it is appropriate that A. disperses, C. rubens, M. hirsutus, and D...

  6. Uptake and loss of mercury, cadmium and lead in marine organisms

    Digital Repository Service at National Institute of Oceanography (India)

    Kureishy, T.W.; DeSilva, C.

    Experiments were conducted on Tilapia mosambica, Perna viridis and Villorita cyprinoides on the uptake and loss of Hg, Cd and Pb in various tissues of these organisms. Hg was found to be highly toxic to the clams as compared to the fish and mussels...

  7. A Unique Model Platform for C4 Plant Systems and Synthetic Biology

    Science.gov (United States)

    2015-12-10

    mediated transformation of Setaria viridis. Agrobacterium tumefaciens strain GV3101 was transformed by electroporation with pBI 121. Agrobacterium ... agrobacterium mediated transformation 15. SUBJECT TERMS 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT Same as Report (SAR) 18. NUMBER OF...successful agrobacterium mediated transformation 15. SUBJECT TERMS synthetic biology, Systems Biology 16. SECURITY CLASSIFICATION OF

  8. Assessment of uniqueness of bufoviridis (Amphibia: Anura populations in terms of rational ecological ethics

    Directory of Open Access Journals (Sweden)

    M. O. Kravchenko

    2005-12-01

    Full Text Available Substantive provisions of rational environmental ethics are stated. This concept presumes to compare a level of uniqueness of different objects, which forms the establishment for giving the ethical value. The developed approach is used for comparison of 26 populations of Bufo viridis Laurenti, 1768 from Left-bank forest-steppe of Ukraine.

  9. Survival and bioturbation effects of common marine macrofauna in coastal soils newly flooded with seawater

    DEFF Research Database (Denmark)

    Valdemarsen, Thomas Bruun; Quintana, Cintia Organo; Thorsen, Sandra Walløe

    Low-lying coastal soils are at risk of being permanently flooded due to global sea level rise, but how will these areas develop as habitat for marine species? We conducted an experiment to evaluate the habitat quality of flooded soils for common marine polychaetes (Marenzelleria viridis, Nereis d...

  10. [Cadmium bioaccumulation and its toxicity in Babylonia areolata under different nutritional status].

    Science.gov (United States)

    Xue, Ming; Ke, Cai-Huan

    2012-07-01

    An indoor exposure experiment with juvenile Babylonia areolata was conducted to study its survival, growth, cadmium (Cd) accumulation, metallothionein (MT) induction, and glycogen content as well as the DNA integrity of hepatopancreas tissue. The juveniles were starved or fed with mussel (Perna viridis) or clamworm (Perinereis aibuhitensis), and exposed to 50 microg x L(-1) of Cd2+ for 10 weeks. Prolonged starvation and simultaneous exposure to Cd reduced the survival rate of B. areolata, and its glycogen was mobilized in great extent. Feeding with P. viridis or P. aibuhitensis helped the B. areolata to combat Cd toxicity and lessen mortality. After exposed to Cd, the damage of the DNA integrity of hepatopancreas tissue for the B. areolata fed with P. viridis or P. aibuhitensis could be recovered with time, but not for the starved B. areolata. Prolonged starvation caused tissue atrophy and led to Cd accumulation and MT increase, while feeding with P. viridis or P. aibuhitensis increased the B. areolata mass and lowered the Cd accumulation and MT level because of the tissue dilution effect. The B. areolata fed with P. viridis had better growth and lower Cd content than that fed with P. aibuhitensis. This study indicated that starvation intensified the toxicity of Cd to B. areolata, while prey type had significant effects on the growth rate of the B. areolata and indirectly affected its Cd accumulation, MT induction, and glycogen consumption. It was suggested that when using gastropods such as B. areolata as the indicator species to monitor marine environmental pollution, it would be necessary to consider the effects of habitat ecological data including food richness and prey type. Moreover, in the high-density cultivation of B. areolata in factory, rational feeding and periodic measurement of Cd concentration in seawater should be made.

  11. Detection of Borrelia burgdorferi sensu lato in lizards and their ticks from Hungary.

    Science.gov (United States)

    Földvári, Gábor; Rigó, Krisztina; Majláthová, Viktória; Majláth, Igor; Farkas, Róbert; Pet'ko, Branislav

    2009-06-01

    To investigate the involvement of lizard species in the natural cycle of Borrelia burgdorferi sensu lato (s.l.) in Hungary, a total of 186 reptiles belonging to three species--126 green lizards (Lacerta viridis), 40 Balkan wall lizards (Podarcis taurica), and 20 sand lizards (Lacerta agilis)--were captured in 2007 and 2008. All ticks removed from the lizards were Ixodes ricinus, either larvae (324/472; 68.6%) or nymphs (148/472; 31.4%). More than half (66/126; 52.4%) of L. viridis individuals were infested, and the prevalence of tick infestation on both the other two species was 35% each. All 472 I. ricinus ticks and tissue samples collected from 134 collar scales and 62 toe clips of lizards were further analyzed for the presence of B. burgdorferi s.l. with polymerase chain reaction. The amplification of B. burgdorferi s.l. DNA was successful in 8% (n = 92) of L. viridis, 9% (n = 32) of P. taurica, and 10% (n = 10) of L. agilis tissue samples. Restriction fragment length polymorphism genotyping identified the species Borrelia lusitaniae in all tested lizard samples. Prevalence of B. burgdorferi s.l. in ticks collected from L. viridis, P. taurica, and L. agilis was 8%, 2%, and 0%, respectively. Most of the infected ticks carried B. lusitaniae (74% of genotyped positives); however, Borrelia afzelii (5%) and B. burgdorferi sensu stricto (21%) were detected in ticks removed from green lizards and Balkan wall lizards, respectively. We conclude that lizards, particularly L. viridis, can be important hosts for I. ricinus larvae and nymphs; thus, they can be regarded as reservoirs of these important pathogen vectors. The role of green lizards has been confirmed, and the implication of Balkan wall lizards is suggested in the natural cycle of B. lusitaniae at our study site.

  12. Heterodimeric coiled-coil interactions of human GABAB receptor.

    Science.gov (United States)

    Burmakina, Svetlana; Geng, Yong; Chen, Yan; Fan, Qing R

    2014-05-13

    Metabotropic GABAB receptor is a G protein-coupled receptor that mediates inhibitory neurotransmission in the CNS. It functions as an obligatory heterodimer of GABAB receptor 1 (GBR1) and GABAB receptor 2 (GBR2) subunits. The association between GBR1 and GBR2 masks an endoplasmic reticulum (ER) retention signal in the cytoplasmic region of GBR1 and facilitates cell surface expression of both subunits. Here, we present, to our knowledge, the first crystal structure of an intracellular coiled-coil heterodimer of human GABAB receptor. We found that polar interactions buried within the hydrophobic core determine the specificity of heterodimer pairing. Disruption of the hydrophobic coiled-coil interface with single mutations in either subunit impairs surface expression of GBR1, confirming that the coiled-coil interaction is required to inactivate the adjacent ER retention signal of GBR1. The coiled-coil assembly buries an internalization motif of GBR1 at the heterodimer interface. The ER retention signal of GBR1 is not part of the core coiled-coil structure, suggesting that it is sterically shielded by GBR2 upon heterodimer formation.

  13. Efeito do bentazon e bentazon + dichlorprop na cultura do arroz irrigado e sobre as plantas daninhas Effect of bentazon and bentazon + dichlorprop on irrigated rice and weeds

    Directory of Open Access Journals (Sweden)

    C.A.L. dos Santos

    1979-06-01

    Full Text Available Foi instalado um experimento de campo, em solo barrento, com a finalidade de se verificar o efeito do bentazon e da mistura de bentazon + dichlorprop sobre o desenvolvimento do arroz em cultura irrigada e sobre o controle das plantas daninhas. Os tratamentos utilizados foram os seguintes: bentazon á 0,75-1,00 e1,50 kg/ha; bentazon + dichlorprop a 0,80 + 1,00 e 1,00 + 1,40 kg/ha; propanil a 4,20 kg/ha (tratamento padrão; testemunha capinada e testemunha sem capina. Todas as pulverizações foram realizadas em pósemergência. As plantas daninhas encontradas no experimento foram: capituva - Echinochloa colonum (L Link, tiririca amarela - Cyperus esculentus L., beldroega - Portulaca oleracea L. e carurú comum - Amaranthus viridis L. Bentazon a 1,00 e 1,50 kg/ha e bentazon + dichlorprop a 1,00 + 1,40 kg/ha foram eficientes no controle de P. oleracea, A. viridis e C. esculentus; já a dose menor de bentazon apresentou bons resultados contra P. oleracea e A. viridis, enquanto que a dose menor de bentazon + dichlorprop controlou apenas P. oleracea. Propanil, de uma maneira geral, proporcionou eficiente ação sobre as plantas daninhas. Nas condições em que foi realizado o experimento nenhum dos herbicidas, nas suas respectivas doses, apresentou fitotoxicidade para as plantas de arroz da variedade IAC-435 ou prejudicou a produção da cultura.Bentazon at 0.75 - 1.00 and 1.50 kg/ha a.i ., bentazon + dichlorprop at 0.80 + 1.00 and 1.00 + 1.40 kg and propanil at 4.20 kg were applied in post-emergence on irrigated rice, against the following weeds: Echinochloa colonum (L. Link, Cy-perus esc-ulentus L., Portulaca oleracea L. and Amaranthus viridis L. Bentazon at 1.00 - 1.50 kg and bentazon + dichlorprop at 1.00 + 1.40 kg gave good control of P. oleracea, A. viridis and C. esculentus; bentazon at 0.75 kg controlled P. oleracea and A. viridis; bentazon + dichlorprop at 0.80 + 1.00 kg only showed effeciency for P. oleracea; propanil, in general, gave good

  14. Effect of radio frequency waves of electromagnetic field on the tubulin.

    Science.gov (United States)

    Taghi, Mousavi; Gholamhosein, Riazi; Saeed, Rezayi-Zarchi

    2013-09-01

    Microtubules (MTs) are macromolecular structures consisting of tubulin heterodimers and present in almost every eukaryotic cell. MTs fulfill all conditions for generation of electromagnetic field and are electrically polar due to the electrical polarity of a tubulin heterodimer. The calculated static electric dipole moment of about 1000 Debye makes them capable of being aligned parallel to the applied electromagnetic field direction. In the present study, the tubulin heterodimers were extracted and purified from the rat brains. MTs were obtained by polymerization in vitro. Samples of microtubules were adsorbed in the absence and in the presence of electromagnetic fields with radio frequency of 900 Hz. Our results demonstrate the effect of electromagnetic field with 900 Hz frequency to change the structure of MTs. In this paper, a related patent was used that will help to better understand the studied subject.

  15. Heterodimerization of the prostaglandin E2 receptor EP2 and the calcitonin receptor CTR.

    Directory of Open Access Journals (Sweden)

    Shin Matsubara

    Full Text Available G protein-coupled receptors (GPCRs have been found to form heterodimers and modulate or fine-tune the functions of GPCRs. However, the involvement of GPCR heterodimerization and its functional consequences in gonadal tissues, including granulosa cells, have been poorly investigated, mainly due to the lack of efficient method for identification of novel GPCR heterodimers. In this paper, we identified a novel GPCR heterodimer between prostaglandin E2 (PGE2 receptor 2 (EP2 and calcitonin (CT receptor (CTR. High-resolution liquid chromatography (LC-tandem mass spectrometry (MS/MS of protease-digested EP2-coimmunoprecipitates detected protein fragments of CTR in an ovarian granulosa cell line, OV3121. Western blotting of EP2- and CTR-coimmunoprecipitates detected a specific band for EP2-CTR heterodimer. Specific heterodimerization between EP2 and CTR was also observed by fluorescence resonance energy transfer analysis in HEK293MSR cells expressing cyan- and yellow-fluorescent protein-fused EP2 and CTR, respectively. Collectively, these results provided evidence for heterodimerization between EP2 and CTR. Moreover, Ca2+ mobilization by CT was approximately 40% less potent in HEK293MSR cells expressing an EP2-CTR heterodimer, whereas cAMP production by EP2 or CT was not significantly altered compared with cells expressing EP2- or CTR alone. These functional analyses verified that CTR-mediated Ca2+ mobilization is specifically decreased via heterodimerization with EP2. Altogether, the present study suggests that a novel GPCR heterodimer, EP2-CTR, is involved in some functional regulation, and paves the way for investigation of novel biological roles of CTR and EP2 in various tissues.

  16. The Risk and Clinical/Molecular Characteristics of Breast Cancer in Women with Neurofibromatosis Type 1

    Science.gov (United States)

    2015-09-01

    and thus activates MAPK14/p38-MAPK 1165 MSH3 Forms a heterodimer with MSH2 to form MutS beta, part of the post-replicative DNA mismatch repair ...system 1166 MSH3 Forms a heterodimer with MSH2 to form MutS beta, part of the post-replicative DNA mismatch repair system 14 Table 2. Germline...glioma (OPG). European Americans (EA) are more likely to develop CNS tumor and/or OPG than African Americans (AA). Aim 2 investigated the NF1 gene

  17. PRELIMINARY DATA CONCERNING THE HERPETOFAUNA IN NEAM COUNTY (ROMANIA

    Directory of Open Access Journals (Sweden)

    Sorin ROŞU

    2005-05-01

    Full Text Available In the researched area we identified 14 amphibian species: (Salamandra salamndra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Bombina bombina, Bombina variegata, Bufo bufo, Bufo viridis, Pelobates fuscus, Hyla arborea, Rana ridibunda, Rana dalmatina, Rana temporaria and 8 reptilian species (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Anguis fragilis, Natrix natrix, Elaphe longissima, Coronella austriaca, Vipera berus. Within the region we identified species quoted (Coglniceanu et al. 2000 to have the lowest altitudinal limit of their spreading area at much higher altitudes. The species Triturus montandoni was identified at 320 m altitude at Agârcia and Doamna. Most of the amphibian and reptilian species are not endangered in the researched area.

  18. Physical Non-Contact Communication between Microscopic Aquatic Species: Novel Experimental Evidences for an Interspecies Information Exchange

    Directory of Open Access Journals (Sweden)

    Daniel Fels

    2016-01-01

    Full Text Available Previous experiments on physical non-contact communication within same species gave rise to test for this type of communication also across the species border, which was the aim of the present study. It was found that autotrophic unicellular organisms (Euglena viridis, separated by cuvettes, affected the proliferation rate of heterotrophic unicellular organisms (Paramecium caudatum. Further, the heterotrophic unicellular organism affected also the proliferation rate of a multicellular heterotrophic organism (Rotatoria sp. and vice versa. In the case when populations (of Euglena viridis and Paramecium caudatum were shielded against electromagnetic fields in the optical spectrum from each other, no effects were measured. The results may support the notion that the organisation of ecosystems relies also on the exchange of electromagnetic fields from their constituting biosystems.

  19. The effect of UV-B radiation on plant growth and development

    International Nuclear Information System (INIS)

    Zuk-Golaszewska, K.; Golaszewski, J.; Upadhyaya, M.K.

    2003-01-01

    In the experiment conducted in the greenhouse, the different doses of UV-B radiation applied to the two species Avena fatua and Setaria viridis induced changes in leaf and plant morphology. It was a decrease of plant height, fresh mass of leaves, shoots and roots as well as leaf area. Besides, it caused the leaf curling in both of the species. The significant differences between Avena fatua and Setaria viridis in the studied traits were mainly due to the tillering ability of the species. The content of chlorophyll varied considerably. The average values of leaf greenness (SPAD units) for oats were about 43 while for green foxtail 32, respectively. U-VB did not reduce leaf weight ratio, shoot dry matter, shoot to root ratio and leaf area ratio

  20. Weed Hosts of Meloidogyne arenaria and M. incognita Common in Tobacco Fields in South Carolina.

    Science.gov (United States)

    Tedford, E C; Fortnum, B A

    1988-10-01

    Thirty-two weed species common in South Carolina and one cultivar of tobacco were evaluated as hosts of Meloidogyne arenaria race 2 and M. incognita race 3 in the greenhouse. Egg mass production and galling differed (P Rumex crispus, Amaranthus hybridus, Ambrosia artemisiifolia, lpomoea hederacea var. integriuscula, Setaria lutescens, Sida spinosa, Portulaca oleracea, and Rumex acetosella were moderate hosts. Taraxacum officinale, Ipomoea hederacea, Cyperus esculentus, Cynodon dactyIon, Echinochloa crus-galli, Eleusine indica, Sorghum halepense, Setaria viridis, Digitaria sanguinalis, and Datura stramonium were poor hosts for M. arenaria. Amaranthus palmeri, Amaranthus hybridus, Chenopodium album, Euphorbia maculata, Setaria lutescens, Vicia villosa, Sida spinosa, Rumex crispus, and Portulaca oleracea were moderate hosts and Ipomoea hederacea var. integriuscula, Xanthium strumarium, Cyperus esculentus, Cynodon dactylon, Paspalum notatum, Eleusine indica, Setaria viridis, and Rumex acetosella were poor hosts for M. incognita. None of the above were good hosts for M. incognita. Tobacco 'PD4' supported large numbers of both nematode species.

  1. 239Pu contamination in snakes inhabiting the Rocky Flats Plant site

    International Nuclear Information System (INIS)

    Geiger, R.A.; Winsor, T.F.

    1975-01-01

    For approximately four years studies have been under way at the Rocky Flats plant to determine contamination patterns and concentrations of Pu in the biota. Contamination of the Rocky Flats environs has resulted from at least three incidents, a September 1957 fire, a May 1969 fire, and leaking barrels containing plutonium-laden cutting oil. The latter incident was considered by far the major source of the plutonium contamination. Results are reported from a study conducted to determine whether snake tissues of the area contained detectable amounts of 239 Pu and, if so, at what concentrations. Eastern yellow-bellied racers (Coluber constrictor flaviventris, bullsnakes (Pituophis melanoleucus sayi, and prairie rattlesnakes (Crotalus viridis viridis, were collected for 239 Pu bioassay of lung, liver, and bone tissues. Snakes were captured using drift fences terminating in funnel traps and by opportunistic sampling. Results led to the conclusion that snakes are not an important organism in the redistribution of 239 Pu

  2. /sup 239/Pu contamination in snakes inhabiting the Rocky Flats Plant site

    Energy Technology Data Exchange (ETDEWEB)

    Geiger, R.A.; Winsor, T.F.

    1975-01-01

    For approximately four years studies have been under way at the Rocky Flats plant to determine contamination patterns and concentrations of Pu in the biota. Contamination of the Rocky Flats environs has resulted from at least three incidents, a September 1957 fire, a May 1969 fire, and leaking barrels containing plutonium-laden cutting oil. The latter incident was considered by far the major source of the plutonium contamination. Results are reported from a study conducted to determine whether snake tissues of the area contained detectable amounts of /sup 239/Pu and, if so, at what concentrations. Eastern yellow-bellied racers (Coluber constrictor flaviventris, bullsnakes (Pituophis melanoleucus sayi, and prairie rattlesnakes (Crotalus viridis viridis, were collected for /sup 239/Pu bioassay of lung, liver, and bone tissues. Snakes were captured using drift fences terminating in funnel traps and by opportunistic sampling. Results led to the conclusion that snakes are not an important organism in the redistribution of /sup 239/Pu. (CH)

  3. Burial of Zostera marina seeds in sediment inhabited by three polychaetes: laboratory and field studies

    DEFF Research Database (Denmark)

    Delefosse, Matthieu; Kristensen, Erik

    2012-01-01

    passively by sedimentation or actively through sediment reworking by benthic fauna.We evaluated the effect of three polychaetes on the burial rate and depth of eelgrass seeds. Burial was first measured in controlled laboratory experiments using different densities of Nereis (Hediste) diversicolor (400......–3200 ind m −2), Arenicola marina (20–80 ind m−2), and the invasive Marenzelleria viridis (400–1600 ind m −2). The obtained results were subsequently compared with burial rates of seed mimics in experimental field plots (1m2) dominated by the respective polychaetes. High recovery of seeds in the laboratory....... At their highest abundance, A. marina andM. viridis buried seeds to amedian depth of 6.7 cmand 0.5 cm, respectively, after amonth. The burial efficiency and depth of these species were, in contrast to N. diversicolor, dependent on animal abundance. Only 2% of seed mimics casted in the field plots were recovered...

  4. Species distribution modeling techniques as a tool in preliminary assessment of special nature reserve ,,Goč-Gvozdac’’

    Directory of Open Access Journals (Sweden)

    Čubrić, T.

    2016-09-01

    Full Text Available Effective conservation actions such as defining new nature reserve require accurate estimates of the spatial distributions of the target species. Species distribution models provide habitat suitability maps for studied species. In this paper we used Maxent software to estimate the distribution and extent of potential suitable habitat of five amphibian and reptilian species (Mesotriton alpestris, Bombina variegata, Testudo hermanni, Lacerta viridis and Vipera ammodytes in the special nature reserve “Goč-Gvozdac” (Central Serbia in order to assess how much of the potential habitats is included in this reserve. Comparing produced suitable habitat maps of the species with a map of the special nature reserve “Goč – Gvozdac” we concluded that the reserve boundaries do not coincide with the proposed distribution of suitable habitats for M. alpestris, T. hermanni, L. viridis and V. ammodytes, and therefore this reserve does not contribute much to the protection of local populations of these species.

  5. Acute toxicity of Amanranthus viridus extract on guppies, Poecilia reticulata.

    Science.gov (United States)

    Arsirapoj, S; Sudthonghong, C; Bullangpoti, V

    2010-01-01

    Many Thai plant species shows the responsible for controlling insects from the host plants. To avoid potential toxic pollutant contaminating aquatic ecosystems, this present study was investigated for acute toxicity from Amaranthus viridis to Guppy fish (Poecilia reticulata) were selected for the bioassay experiments. The experiments were repeated 5 times and the 1-, 3- and 24-h LC50 was determined for the guppies. The acute toxicity experiments were carried out by static method and behavioral changes in guppies were determined for Amaranthus viridis concentration extract which extracted by Soxhlet's extraction method with ethanol as solvent. Water temperature was regulated at 20 +/- 1 degrees C. Data obtained from the acute toxicity tests were evaluated using the Probit analysis statistical method. The 24-h LC50 value for guppy was estimated as ca. 947 mg L(-1) (r2 = 0.95). However, in this concentration, no mortality was observed at higher concentration for 30 second.

  6. Relações de interferência entre plantas daninhas e a cultura do grão-de-bico

    OpenAIRE

    Amaral, Carita Liberato do [UNESP; Pavan, Guilherme Bacarim [UNESP; Souza, Marcelo Claro de; Martins, José Valcir Fidelis [UNESP; Alves, Pedro Luis da Costa Aguiar [UNESP

    2015-01-01

    The grains of chickpea consumed in Brazil are almost entirely imported. Considering that chickpeas presents conditions to be cultivated in some regions of Brazil, this study aimed to study interference of six weed plants (Amaranthus viridis, Bidens pilosa, Raphanus raphanistrum, Cyperus rotundus, Digitaria nuda and Eleusine indica) on the vegetative development of chickpeas. Thus, we evaluated the shoot length, number of leaves, leaf area, chlorophyll content and dry weight of leaves, stem an...

  7. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    OpenAIRE

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

  8. Inhibition of alpha oscillations through serotonin-2A receptor activation underlies the visual effects of ayahuasca in humans

    OpenAIRE

    Valle, Marta; Ana Elda, Maqueda; Rabella, Mireia; Rodríguez Pujadas, Aina; Antonijoan Arbós, Rosa Maria; Romero Lafuente, Sergio; Alonso López, Joan Francesc; Mañanas Villanueva, Miguel Ángel; Barker, Steven; Friedlander, Pablo; Feilding, Amanda; Riba, Jordi

    2016-01-01

    Ayahuasca is an Amazonian psychotropic plant tea typically obtained from two plants, Banisteriopsis caapi and Psychotria viridis. It contains the psychedelic 5-HT2A and sigma-1 agonist N,N-dimethyltryptamine (DMT) plus ß-carboline alkaloids with monoamine-oxidase (MAO)-inhibiting properties. Although the psychoactive effects of ayahuasca have commonly been attributed solely to agonism at the 5-HT2A receptor, the molecular target of classical psychedelics, this has not been tested experimental...

  9. Rend Lake, Illinois (Operation and Maintenance).

    Science.gov (United States)

    1976-12-01

    Lippia lanc6Tahta Foxtail, Bristly Setaria Faberfi Foxtail, Green Setaria viridis Foxtail, Yellow Setaria lutescens Galingale C Verus strigosus Garlic...altissima Redtop Agrostis alba Reed Phracjmites coinunis Reedgrass, Wood Cinna arundinacea 397 Ribgrass Plantago lanceolata Richweed Pie uia Rock-Cress Arbis...terweed Elodea canadensisWitch-Grass Pa-nicum capillare Yam Dioscorea villosaYarrow, common Chillea miifoiumYerba-de-Tago Eclipta alba 399 APPENDIX B-3

  10. LPS-induced NO inhibition and antioxidant activities of ethanol extracts and their solvent partitioned fractions from four brown seaweeds

    Science.gov (United States)

    Cho, Myoung Lae; Lee, Dong-Jin; Lee, Hyi-Seung; Lee, Yeon-Ju; You, Sang Guan

    2013-12-01

    The nitric oxide inhibitory (NOI) and antioxidant (ABTS and DPPH radical scavenging effects with reducing power) activities of the ethanol (EtOH) extracts and solvent partitioned fractions from Scytosiphon lomentaria, Chorda filum, Agarum cribrosum, and Desmarestia viridis were investigated, and the correlation between biological activity and total phenolic (TP) and phlorotannin (TPT) content was determined by PCA analysis. The yield of EtOH extracts from four brown seaweeds ranged from 2.6 to 6.6% with the highest yield from D. viridis, and the predominant compounds in their solvent partitioned fractions had medium and/or less polarity. The TP and TPT content of the EtOH extracts were in the ranges of 25.0-44.1 mg GAE/g sample and 0.2-4.6 mg PG/g sample, respectively, which were mostly included in the organic solvent partitioned fractions. Strong NOI activity was observed in the EtOH extracts and their solvent partitioned fractions from D. viridis and C. filum. In addition, the EtOH extract and its solvent partitioned fractions of D. viridis exhibited little cytotoxicity to Raw 264.7 cells. The most potent ABTS and DPPH radical scavenging capacity was shown in the EtOH extracts and their solvent partitioned fractions from S. lomentaria and C. filum, and both also exhibited strong reducing ability. In the PCA analysis the content of TPT had a good correlation with DPPH ( r = 0.62), ABTS ( r = 0.69) and reducing power ( r = 0.65), however, an unfair correlation was observed between the contents of TP and TPT and NOI, suggesting that the phlorotannins might be responsible for the DPPH and ABTS radical scavenging activities.

  11. Chemical Composition and Quality Characteristics of Wheat Bread Supplemented with Leafy Vegetable Powders

    OpenAIRE

    Odunlade, T. V.; Famuwagun, A. A.; Taiwo, K. A.; Gbadamosi, S. O.; Oyedele, D. J.; Adebooye, O. C.

    2017-01-01

    The study investigated the effect of supplementation of the leaf powders of Telfairia occidentalis, Amaranthus viridis, and Solanum macrocarpon on the chemical composition and the quality characteristics of wheat bread. The bread samples were supplemented with each of the vegetable leaf powders at 1%, 2%, and 3% during preparation. The bread samples were assayed for proximate composition, mineral composition, physical, sensory, and antioxidant properties using standard methods. The addition o...

  12. Review of world genera of Ceinae, with the description of two new Palaearctic species of Spalangiopelta Masi (Hymenoptera, Chalcidoidea, Pteromalidae

    Directory of Open Access Journals (Sweden)

    Mircea-Dan Mitroiu

    2016-12-01

    Full Text Available The paper provides the first illustrated key to all described genera of Ceinae, i.e., Bohpa Darling, 1991, Cea Walker, 1837, and Spalangiopelta Masi, 1922. Based on the study of the original material, the genus Diparisca Hedqvist, 1964 stat. nov. is removed from the synonymy with Spalangiopelta and its higher classification is discussed. Spalangiopelta rameli sp. nov. and S. viridis sp. nov. are described from Greece and the Canary Islands, respectively.

  13. Bio-accumulation kinetics of radioruthenium in marine bivalves. Laboratory study

    International Nuclear Information System (INIS)

    Mu, D.H.; Yan, S.P.; Gu, Y.J.; Li, D.J.; Du, J.Z.

    2007-01-01

    Three kinds of marine bivalves (wild Saccostrea cucullata, aquacultured Perna viridis and aquacultured Pinctada martens), collected from Daya Bay, the South China Sea, were used to investigate the bio-accumulation of radioruthenium in the glass aquarium with natural seawater (pH 8.20, 35 per mille salinity, filtered by 0.45 μm) at ambient temperature under laboratory feeding conditions. The experimental results show that the stead-state of biology concentration factor (BCF, ml/g) of radioruthenium was approached around 6 days for most species of bivalves. The values of BCF in shells are the highest in organs all the three bivalves. The orders of BCF values (ml x g -1 ) are as: Perna viridis (33.2) < Saccostrea cucullata (47.0) < Pinctada martensi (208.4) for shells and Saccostrea cucullata (1.5) < Pinctada martensi (2.2) ∼ Perma viridis (2.4) for soft tissues, respectively, after exposed for 14 days. The rate constants of uptake and elimination of radioruthenium on marine bivalves were also discussed by first-order kinetics model. The Pinctada martensi may be applicable to be an indictor for monitoring radioruthenium among the three bivalves. (author)

  14. Cryo-mesh: a simple alternative cryopreservation protocol.

    Science.gov (United States)

    Funnekotter, B; Bunn, E; Mancera, R L

    The continued development of new cryopreservation protocols has improved post-cryogenic success rates for a wide variety of plant species. Methods like the cryo-plate have proven beneficial in simplifying the cryopreservation procedure. This study assessed the practicality of a stainless steel mesh strip (cryo-mesh) for cryopreserving shoot tips from Anigozanthos viridis. Shoot tips of A. viridis (Kangaroo Paw) were precultured on 0.4 M sucrose medium for 48 h. Precultured shoot tips were coated in a 2% alginate solution and placed onto the cryo-mesh (a 25 x 7 mm, 0.4 mm aperture, 0.224 mm diameter wire stainless steel mesh strip). The alginate was set for 20 min in a loading solution containing 100 mM CaCl2, anchoring the shoot tips to the cryo-mesh. The cryo-mesh was then transferred to PVS2 on ice for 20, 30 or 40 min prior to plunging the cryo-mesh into liquid nitrogen. The cryo-mesh protocol was compared to the droplet-vitrification protocol. A maximum of 83% post-cryogenic regeneration was achieved with the cryo-mesh when exposed to PVS2 for 30 min. No significant difference in post-cryogenic regeneration was observed between the cryo-mesh and droplet-vitrification protocols. Anigozanthos viridis shoot tips were successfully cryopreserved utilising the new cryo-mesh. The cryo-mesh thus provides a simple and successful alternative for cryopreservation.

  15. Interaction of nemertines and their prey on tidal flats

    Science.gov (United States)

    Thiel, Martin; Reise, Karsten

    Two common nemertines of the European Wadden Sea, Lineus viridis and Amphiporus lactifloreus, occur preferentially in clusters of mussels, spread over sedimentary flats in the upper intertidal near the island of Sylt. The heteronemertine L. viridis preys mainly on the polychaete Nereis diversicolor. The hoplonemertine A. lactifloreus feeds almost exclusively on the amphipod Gammarus locusta. Abundance of both predators and their respective prey in the field showed inverse relationships. Experimentally increased numbers of L. viridis in clusters of mussels caused a gradual decrease of nereid abundance in the sediment underneath over a period of 1 month, suggesting that losses of individuals were caused by prey capture. Experimentally increased numbers of A. lactifloreus were followed by an escape response of gammarids from clusters of mussels within 2 d. In aquaria, both prey species exhibited prolonged swimming activity when their respective predators lurked at the bottom. We conclude that escape behaviour in N. diversicolor may be only effective during its migrant phases, while G. locusta is permanently on the alert to avoid encounters with its predator. This refuging behaviour in response to endobenthic predators has strong implications on prey distribution, while the actual consumption of prey may be relatively modest. Enclosure experiments in the field and in aquaria lead to overestimates of prey capture when refuging behaviour is not accounted for.

  16. Investigation of molecular size of transcription factor TFIIE in solution.

    Science.gov (United States)

    Itoh, Yoshiyuki; Unzai, Satoru; Sato, Mamoru; Nagadoi, Aritaka; Okuda, Masahiko; Nishimura, Yoshifumi; Akashi, Satoko

    2005-11-15

    Human general transcription factor IIE (TFIIE), a component of a transcription preinitiation complex associated with RNA polymerase II, was characterized by size-exclusion chromatography, mass spectrometry, analytical ultracentrifugation, and small-angle X-ray scattering (SAXS). Recombinant human TFIIE was purified to homogeneity and shown to contain equimolar amounts of TFIIEalpha (50 kDa) and TFIIEbeta (35 kDa) by SDS-PAGE. In the analysis of size-exclusion chromatography of the purified sample, as already reported, TFIIE was shown to be a 170-kDa alpha(2)beta(2) heterotetramer. However, by using electrospray ionization mass spectrometry the purified sample gave the molecular mass of 84,152 +/- 5, indicating that TFIIE is an alphabeta heterodimer but not a heterotetramer. Analytical ultracentrifugation experiment of TFIIE provided that only a single component with the molecular mass of ca. 80,000 existed in solution, also suggesting an alphabeta heterodimer. In addition, its extraordinarily rod-like molecular shape was confirmed by SAXS. It is likely that the rod-like molecular shape of TFIIE has misled larger molecular size in size-exclusion chromatography, which was calibrated by globular proteins. It is demonstrated that TFIIE exists as a heterodimer under our present conditions in solution, although two molecules of heterodimer might be required for the formation of the preinitiation complex with RNA polymerase II for starting the transcription process. (c) 2005 Wiley-Liss, Inc.

  17. Differential binding and transcriptional behaviour of two highly related orphan receptors, ROR alpha(4) and ROR beta(1).

    NARCIS (Netherlands)

    Gawlas, K.; Stunnenberg, H.G.

    2000-01-01

    Nuclear receptors are ligand-inducible transcription factors that can be classified into two major groups according to their DNA-binding properties. Members of the first group bind to DNA as dimers, either homo- or heterodimers; members of the second group are also able to bind as monomers. While

  18. Novel primary thymic defect with T lymphocytes expressing gamma delta T cell receptor

    DEFF Research Database (Denmark)

    Geisler, C; Pallesen, G; Platz, P

    1989-01-01

    . Immunoprecipitation and sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) showed that most of the gamma delta T cell receptors existed as disulphide-linked heterodimers. Proliferative responses to mitogens were severely reduced, but specific antibody responses after vaccination could be detected...

  19. New diagnostic and therapeutic tools for tuberculosis using anti-ESAT-6/CFP-10 aptamers

    CSIR Research Space (South Africa)

    Rotherham, L

    2008-11-01

    Full Text Available to form the heterodimer in vitro. The scientists test the ability of the apmaters to: 1) be used as TB diagnostics tools by detecting the presence of ESAT-6 and/or CFP-10 in blood or sputum samples; 2) inhibit the virulence of M. tuberculosis in vitro...

  20. Structural basis for signaling by exclusive EDS1 heteromeric complexes with SAG101 or PAD4 in plant innate immunity.

    Science.gov (United States)

    Wagner, Stephan; Stuttmann, Johannes; Rietz, Steffen; Guerois, Raphael; Brunstein, Elena; Bautor, Jaqueline; Niefind, Karsten; Parker, Jane E

    2013-12-11

    Biotrophic plant pathogens encounter a postinfection basal resistance layer controlled by the lipase-like protein enhanced disease susceptibility 1 (EDS1) and its sequence-related interaction partners, senescence-associated gene 101 (SAG101) and phytoalexin deficient 4 (PAD4). Maintainance of separate EDS1 family member clades through angiosperm evolution suggests distinct functional attributes. We report the Arabidopsis EDS1-SAG101 heterodimer crystal structure with juxtaposed N-terminal α/β hydrolase and C-terminal α-helical EP domains aligned via a large conserved interface. Mutational analysis of the EDS1-SAG101 heterodimer and a derived EDS1-PAD4 structural model shows that EDS1 signals within mutually exclusive heterocomplexes. Although there is evolutionary conservation of α/β hydrolase topology in all three proteins, a noncatalytic resistance mechanism is indicated. Instead, the respective N-terminal domains appear to facilitate binding of the essential EP domains to create novel interaction surfaces on the heterodimer. Transitions between distinct functional EDS1 heterodimers might explain the central importance and versatility of this regulatory node in plant immunity. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. Arabidopsis rad23-4 gene is required for pollen development under ...

    African Journals Online (AJOL)

    Nucleotide excision repair (NER) is a highly conserved DNA repair pathway for correcting DNA lesions that cause distortion of the double helical structure. The protein heterodimer Rad23 is involved in recognition and binding to such lesions. Here, we showed that rad23-4 (AT5g38470) was expressed in the roots, mature ...

  2. Ab initio study of 1:1 complexes of nitrogen trifluoride with nitrous ...

    Indian Academy of Sciences (India)

    Quantum chemical calculations are carried out in order to investigate the heterodimers of NF3 with isoelectronic and isostructure species of N2O ... found to reduce the rate of damage in the atmosphere.9. With respect to more traditional ... tremendous global warming potential (GWP). When it compared to carbon dioxide ...

  3. Low-resolution molecular models reveal the oligomeric state of the PPAR and the conformational organization of its domains in solution.

    Directory of Open Access Journals (Sweden)

    Amanda Bernardes

    Full Text Available The peroxisome proliferator-activated receptors (PPARs regulate genes involved in lipid and carbohydrate metabolism, and are targets of drugs approved for human use. Whereas the crystallographic structure of the complex of full length PPARγ and RXRα is known, structural alterations induced by heterodimer formation and DNA contacts are not well understood. Herein, we report a small-angle X-ray scattering analysis of the oligomeric state of hPPARγ alone and in the presence of retinoid X receptor (RXR. The results reveal that, in contrast with other studied nuclear receptors, which predominantly form dimers in solution, hPPARγ remains in the monomeric form by itself but forms heterodimers with hRXRα. The low-resolution models of hPPARγ/RXRα complexes predict significant changes in opening angle between heterodimerization partners (LBD and extended and asymmetric shape of the dimer (LBD-DBD as compared with X-ray structure of the full-length receptor bound to DNA. These differences between our SAXS models and the high-resolution crystallographic structure might suggest that there are different conformations of functional heterodimer complex in solution. Accordingly, hydrogen/deuterium exchange experiments reveal that the heterodimer binding to DNA promotes more compact and less solvent-accessible conformation of the receptor complex.

  4. A novel functional screening assay to monitor sweet taste receptor activation in vitro

    NARCIS (Netherlands)

    Bastiaan-Net, Shanna; Berg-Somhorst, van den Dianne B.P.M.; Ariëns, Renata M.C.; Paques, Marcel; Mes, Jurriaan J.

    2018-01-01

    The human sweet taste receptor is a heterodimer comprised of the class C G protein-coupled receptor (GPCR) subunits TAS1R2 and TAS1R3. A wide collection of sweet tasting compounds and modulators of sweet taste interact with this receptor. Although TAS1R2/TAS1R3-mediated signaling is well-studied,

  5. The Effects of Ppar Delta and Alpha Agonist on Fatty Acid and ...

    African Journals Online (AJOL)

    The peroxisome proliferator-activated receptors of the nuclear receptor superfamily are het-erodimers with the 9-cis retinoic acid receptor and bind to specific peroxisome proliferators re-sponse elements to regulate the transcription of their target genes resulting in the regulation of lipid, metabolism, glucose homeostasis ...

  6. Epigenetics of dominance for enzyme activity

    Indian Academy of Sciences (India)

    We have isolated and purified two parental homodimers and a unique heterodimer of acid phosphatase [coded by Acph-11.05() and Acph-10.95()] from isogenic homozygotes and heterozygotes of Drosophila malerkotliana. and produce qualitatively different allozymes and the two alleles are expressed equally ...

  7. A multi-tiered, in vivo, quantitative assay suite for environmental disruptors of thyroid hormone signaling

    NARCIS (Netherlands)

    Mengeling, Brenda J.; Wei, Yuzhu; Dobrawa, Lucia N.; Streekstra, Mischa; Louisse, Jochem; Singh, Vikrant; Singh, Latika; Lein, Pamela J.; Wulff, Heike; Murk, Tinka; Furlow, J.D.

    2017-01-01

    The essential role of thyroid hormone (TH) signaling in mammalian development warrants the examination of man-made chemicals for its disruption. Among vertebrate species, the molecular components of TH signaling are highly conserved, including the thyroid hormone receptors (TRs), their heterodimer

  8. Dramatic synergistic effects between hydroquinone and resorcinol derivatives for the organocatalyzed reduction of dioxygen by diethylhydroxylamine.

    Science.gov (United States)

    Lebeuf, Raphaël; Nardello-Rataj, Véronique; Aubry, Jean-Marie

    2014-01-25

    Diethylhydroxylamine reduces dioxygen in the presence of catalytic amounts of hydroquinone. A great improvement is achieved by adding resorcinol derivatives as co-catalysts. Though the formation of heterodimers does not seem to be the sole cause of the synergy, such products constitute a new class of powerful organocatalysts for dioxygen scavenging.

  9. Experiment list: SRX190201 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available imers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles...antibody targetdescription=Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles

  10. Na,K-ATPase mutations in familial hemiplegic migraine lead to functional inactivation.

    NARCIS (Netherlands)

    Koenderink, J.B.; Zifarelli, G.; Qiu, L.Y.; Schwarz, W.; Pont, J.J.H.H.M. de; Bamberg, E.; Friedrich, T.

    2005-01-01

    The Na,K-ATPase is an ion-translocating transmembrane protein that actively maintains the electrochemical gradients for Na+ and K+ across the plasma membrane. The functional protein is a heterodimer comprising a catalytic alpha-subunit (four isoforms) and an ancillary beta-subunit (three isoforms).

  11. Alternation and tunable composition in hydrogen bonded supramolecular copolymers.

    Science.gov (United States)

    Felder, Thorsten; de Greef, Tom F A; Nieuwenhuizen, Marko M L; Sijbesma, Rint P

    2014-03-07

    Sequence control in supramolecular copolymers is limited by the selectivity of the associating monomer end groups. Here we introduce the use of monomers with aminopyrimidinone and aminohydroxynaphthyridine quadruple hydrogen bonding end groups, which both homodimerize, but form even stronger heterodimers. These features allow the formation of supramolecular copolymers with a tunable composition and a preference for alternating sequences.

  12. Subunit Arrangement and Function in NMDA Receptors

    Energy Technology Data Exchange (ETDEWEB)

    Furukawa,H.; Singh, S.; Mancusso, R.; Gouaux, E.

    2005-01-01

    Excitatory neurotransmission mediated by NMDA (N-methyl-D-aspartate) receptors is fundamental to the physiology of the mammalian central nervous system. These receptors are heteromeric ion channels that for activation require binding of glycine and glutamate to the NR1 and NR2 subunits, respectively. NMDA receptor function is characterized by slow channel opening and deactivation, and the resulting influx of cations initiates signal transduction cascades that are crucial to higher functions including learning and memory. Here we report crystal structures of the ligand-binding core of NR2A with glutamate and that of the NR1-NR2A heterodimer with glutamate and glycine. The NR2A-glutamate complex defines the determinants of glutamate and NMDA recognition, and the NR1-NR2A heterodimer suggests a mechanism for ligand-induced ion channel opening. Analysis of the heterodimer interface, together with biochemical and electrophysiological experiments, confirms that the NR1-NR2A heterodimer is the functional unit in tetrameric NMDA receptors and that tyrosine 535 of NR1, located in the subunit interface, modulates the rate of ion channel deactivation.

  13. Analysis of HLA and Non-HLA Alleles Can Identify Individuals at High Risk for Celiac Disease

    NARCIS (Netherlands)

    Romanos, Jihane; Van Diemen, Cleo C.; Nolte, Ilja M.; Trynka, Gosia; Zhernakova, Alexandra; Fu, Jingyuan; Bardella, Maria Teresa; Barisani, Donatella; Mcmanus, Ross; Van Heel, David A.; Wijmenga, Cisca

    BACKGROUND & AIMS: Celiac disease (CD) is a common chronic disorder of the small intestine, resulting from aberrant cellular responses to gluten peptides, and often remains undiagnosed. It is a complex genetic disorder, although 95% of the patients carry the risk heterodimer human leukocyte antigen

  14. Clipboard

    Indian Academy of Sciences (India)

    Unknown

    S heteromultimers. That HET-s and HET-S can form both homo- and heterodimers was established by using a yeast two- hybrid assay (Coustou et al 1997). 4. Purified recombinant HET-s protein forms amyloid-like aggregates. A recombinant ...

  15. Radiation-induced apoptosis in human myeloma cell line increases BCL-2/BAX dimer formation and does not result in BAX/BAX homodimerization.

    Science.gov (United States)

    Filippovich, I V; Sorokina, N I; Lisbona, A; Chérel, M; Chatal, J F

    2001-06-01

    A popular model of BCL-2 and BAX involvement in apoptosis suggests that upon apoptosis induction cytosolic BAX translocates to the mitochondria, where it displays the pro-apoptotic function, which involves its homodimerization. BCL-2 exerts anti-apoptotic function by forming heterodimers with BAX, thus neutralizing the pro-apoptotic activity of the latter. We have shown that irradiation of the human myeloma cell line RPMI-8226 induced apoptosis as determined by DNA degradation, cytochrome c release into cytoplasm and BCL-2 caspase-mediated cleavage. BCL-2 protein was present only in the membrane fraction, whereas BAX was found both in cytosol and membranes isolated from non-irradiated cells. Radiation induced moderate redistribution of BAX from cytosol to membranes with a concomitant increase in BCL-2/BAX heterodimer formation. Rapid and transient BCL-2 phosphorylation in membrane fractions of irradiated cells did not affect BCL-2/BAX heterodimerization. We failed to detect any BAX/BAX homodimers in apoptotic cells. Our findings show that in irradiated RPMI-8226 cells the formation of BCL-2/BAX heterodimers correlates with apoptosis. We conclude that BCL-2/BAX heterodimers are negative regulators of death protection, and our data agree with those who propose that BCL-2 does not require BAX to exert its survival function. Copyright 2001 Wiley-Liss, Inc.

  16. The Ku80 carboxy terminus stimulates joining and artemis-mediated processing of DNA ends

    DEFF Research Database (Denmark)

    Weterings, Eric; Verkaik, Nicole S; Keijzers, Guido

    2008-01-01

    Repair of DNA double-strand breaks (DSBs) is predominantly mediated by nonhomologous end joining (NHEJ) in mammalian cells. NHEJ requires binding of the Ku70-Ku80 heterodimer (Ku70/80) to the DNA ends and subsequent recruitment of the DNA-dependent protein kinase catalytic subunit (DNA-PK(CS)) an...

  17. The DNA damage repair protein Ku70 interacts with FOXO4 to coordinate a conserved cellular stress response

    NARCIS (Netherlands)

    A.B. Brenkman (Arjan); N.J.F. van den Broek (Niels); P.L.J. de Keizer (Peter); D.C. van Gent (Dik); B.M. Burgering (Boudewijn)

    2010-01-01

    textabstractIn this study, we searched for proteins regulating the tumor suppressor and life-span regulator FOXO4. Through an unbiased tandem-affinity purification strategy combined with mass spectrometry, we identified the heterodimer Ku70/Ku80 (Ku), a DNA double-strand break repair component.

  18. Genome-wide profiling of PPARgamma:RXR and RNA polymerase II occupancy reveals temporal activation of distinct metabolic pathways and changes in RXR dimer composition during adipogenesis

    DEFF Research Database (Denmark)

    Nielsen, Ronni; Pedersen, Thomas Askov; Hagenbeek, Dik

    2008-01-01

    in adipocytes and show that during early stages of differentiation, many of these are preoccupied by non-PPARgamma RXR-heterodimers. Different temporal and compositional patterns of occupancy are observed. In addition, we detect co-occupancy with members of the C/EBP family. Analysis of RNAPII occupancy...

  19. Human TFDP3, a novel DP protein, inhibits DNA binding and transactivation by E2F

    DEFF Research Database (Denmark)

    Qiao, Huan; Di Stefano, Luisa; Tian, Chan

    2006-01-01

    The two known DP proteins, TFDP1 and -2, bind E2Fs to form heterodimers essential for high affinity DNA binding and efficient transcriptional activation/repression. Here we report the identification of a new member of the DP family, human TFDP3. Despite the high degree of sequence similarity, TFD...

  20. Interaction of the phosphorylated DNA-binding domain in nuclear receptor CAR with its ligand-binding domain regulates CAR activation.

    Science.gov (United States)

    Shizu, Ryota; Min, Jungki; Sobhany, Mack; Pedersen, Lars C; Mutoh, Shingo; Negishi, Masahiko

    2018-01-05

    The nuclear protein constitutive active/androstane receptor (CAR or NR1I3) regulates several liver functions such as drug and energy metabolism and cell growth or death, which are often involved in the development of diseases such as diabetes and hepatocellular carcinoma. CAR undergoes a conversion from inactive homodimers to active heterodimers with retinoid X receptor α (RXRα), and phosphorylation of the DNA-binding domain (DBD) at Thr-38 in CAR regulates this conversion. Here, we uncovered the molecular mechanism by which this phosphorylation regulates the intramolecular interaction between CAR's DBD and ligand-binding domain (LBD), enabling the homodimer-heterodimer conversion. Phosphomimetic substitution of Thr-38 with Asp increased co-immunoprecipitation of the CAR DBD with CAR LBD in Huh-7 cells. Isothermal titration calorimetry assays also revealed that recombinant CAR DBD-T38D, but not nonphosphorylated CAR DBD, bound the CAR LBD peptide. This DBD-LBD interaction masked CAR's dimer interface, preventing CAR homodimer formation. Of note, EGF signaling weakened the interaction of CAR DBD T38D with CAR LBD, converting CAR to the homodimer form. The DBD-T38D-LBD interaction also prevented CAR from forming a heterodimer with RXRα. However, this interaction opened up a CAR surface, allowing interaction with protein phosphatase 2A. Thr-38 dephosphorylation then dissociated the DBD-LBD interaction, allowing CAR heterodimer formation with RXRα. We conclude that the intramolecular interaction of phosphorylated DBD with the LBD enables CAR to adapt a transient monomer configuration that can be converted to either the inactive homodimer or the active heterodimer.

  1. Liquid secondary ion mass spectrometry of methyl glycosides of oligosaccharides using matrices containing carboxamides.

    Science.gov (United States)

    Kovácik, V; Hirsch, J; Zorić, S; Grützmacher, H F

    1996-01-01

    Intense cluster ions corresponding to proton-bound hetero-dimers of an amide molecule and an oligosaccharide molecule are observed in the liquid secondary ion mass spectra of methyl glycosides of oligoxylans if a solution of an aliphatic carboxamide in glycerol is used as the liquid matrix. These cluster ions are particularly abundant and persist for a long period if urea (U) or thiourea (TU) is used as the matrix additive. In these cases, cluster ions containing more than one molecule of U or TU and two oligosaccharide molecules are also observed. The intense signal due to the proton-bound hetero-dimer between U or TU and the oligosaccharide can be used with advantage for a molecular weight determination. The bonding interactions between a protonated saccharide molecule and a molecule U or TU in the proton-bound hetero-dimers are so strong that the urea molecules remain attached to the fragment ions during the decay of metastable cluster ions and even during collision-induced dissociation. Thus, the mass-analysed ion kinetic energy spectra of these proton-bound hetero-dimers are dominated by abundant cluster ions [Bn+U] and [Ym+U] arising from cleavage of the glycosidic bonds within the oligosaccharides. The collisionally-activated mass spectra of the proton-bound hetero-dimers additionally contain peaks of the free ions Bn and Ym. Therefore, these spectra clearly reflect the arrangement of the monosaccharide residues in the oligosaccharide and can be used conveniently for structural analysis.

  2. Identification of Ku70 and Ku80 homologues in Arabidopsis thaliana: evidence for a role in the repair of DNA double-strand breaks.

    Science.gov (United States)

    Tamura, Katsunori; Adachi, Yugo; Chiba, Keiko; Oguchi, Keiko; Takahashi, Hideo

    2002-03-01

    In higher organisms such as mammals and plants, DNA double-strand breaks (DSBs) are repaired preferentially by non-homologous end joining (NHEJ) rather than by homologous recombination. The NHEJ pathway is mediated by Ku, a heterodimer of approximately 70 and 80 kDa subunits, which contributes to various aspects of the metabolism of DNA ends in eukaryotic cells. On the basis of their predicted sequence similarity to human Ku70 and Ku80, cDNAs encoding the first plant homologues of these proteins (AtKu70 and AtKu80, respectively) have now been isolated from Arabidopsis thaliana. AtKu70 and AtKu80 share 28.6 and 22.5% amino acid sequence identity with human Ku70 and Ku80, respectively. Yeast two-hybrid analysis demonstrated that AtKu70 and AtKu80 form a heterodimer, and electrophoretic mobility-shift assays revealed that this heterodimer binds to double-stranded telomeric and non-telomeric DNA sequences, but not to single-stranded DNA. The AtKu heterodimer also possesses single-stranded DNA-dependent ATPase and ATP-dependent DNA helicase activities. Reverse transcription and the polymerase chain reaction revealed that AtKu70 and AtKu80 genes are expressed widely but at low levels in plant tissues. The expression of these two genes in cultured cells was markedly increased in response to the generation of DSBs by bleomycin or methylmethane sulfonate. These results suggest that the evolutionarily conserved Ku70-Ku80 heterodimer functions in DSB repair by the NHEJ pathway in A. thaliana.

  3. Basic Concepts in G-Protein-Coupled Receptor Homo- and Heterodimerization

    Directory of Open Access Journals (Sweden)

    Rafael Franco

    2007-01-01

    Full Text Available Until recently, heptahelical G-protein-coupled receptors (GPCRs were considered to be expressed as monomers on the cell surface of neuronal and non-neuronal cells. It is now becoming evident that this view must be overtly changed since these receptors can form homodimers, heterodimers, and higher-order oligomers on the plasma membrane. Here we discuss some of the basics and some new concepts of receptor homo- and heteromerization. Dimers-oligomers modify pharmacology, trafficking, and signaling of receptors. First of all, GPCR dimers must be considered as the main molecules that are targeted by neurotransmitters or by drugs. Thus, binding data must be fitted to dimer-based models. In these models, it is considered that the conformational changes transmitted within the dimer molecule lead to cooperativity. Cooperativity must be taken into account in the binding of agonists-antagonists-drugs and also in the binding of the so-called allosteric modulators. Cooperativity results from the intramolecular cross-talk in the homodimer. As an intramolecular cross-talk in the heterodimer, the binding of one neurotransmitter to one receptor often affects the binding of the second neurotransmitter to the partner receptor. Coactivation of the two receptors in a heterodimer can change completely the signaling pathway triggered by the neurotransmitter as well as the trafficking of the receptors. Heterodimer-specific drugs or dual drugs able to activate the two receptors in the heterodimer simultaneously emerge as novel and promising drugs for a variety of central nervous system (CNS therapeutic applications.

  4. Applicability Of A Semi-Automated Clinical Chemistry Analyzer In Determining The Antioxidant Concentrations Of Selected Plants

    Directory of Open Access Journals (Sweden)

    Allan L. Hilario

    2017-07-01

    Full Text Available Plants are rich sources of antioxidants that are protective against diseases associated to oxidative stress. There is a need for high throughput screening method that should be useful in determining the antioxidant concentration in plants. Such screening method should significantly simplify and speed up most antioxidant assays. This paper aimed at comparing the applicability of a semi-automated clinical chemistry analyzer Pointe Scientific MI USA with the traditional standard curve method and using a Vis spectrophotometer in performing the DPPH assay for antioxidant screening. Samples of crude aqueous leaf extract of kulitis Amaranthus viridis Linn and chayote Sechium edule Linn were screened for the Total Antioxidant Concentration TAC using the two methods. Results presented in mean SD amp956gdl were compared using unpaired Students t-test P0.05. All runs were done in triplicates. The mean TAC of A. viridis was 646.0 45.5 amp956gdl using the clinical chemistry analyzer and 581.9 19.4 amp956gdl using the standard curve-spectrophotometer. On the other hand the mean TAC of S. edule was 660.2 35.9 amp956gdl using the semi-automated clinical chemistry analyzer and 672.3 20.9 amp956gdl using the spectrophotometer. No significant differences were observed between the readings of the two methods for A. viridis P0.05 and S. edible P0.05. This implies that the clinical chemistry analyzer can be an alternative method in conducting the DPPH assay to determine the TAC in plants. This study presented the applicability of a semi-automated clinical chemistry analyzer in performing the DPPH assay. Further validation can be conducted by performing other antioxidant assays using this equipment.

  5. Evidence for the late origin of introns in chloroplast genes from an evolutionary analysis of the genus Euglena.

    Science.gov (United States)

    Thompson, M D; Copertino, D W; Thompson, E; Favreau, M R; Hallick, R B

    1995-01-01

    The origin of present day introns is a subject of spirited debate. Any intron evolution theory must account for not only nuclear spliceosomal introns but also their antecedents. The evolution of group II introns is fundamental to this debate, since group II introns are the proposed progenitors of nuclear spliceosomal introns and are found in ancient genes from modern organisms. We have studied the evolution of chloroplast introns and twintrons (introns within introns) in the genus Euglena. Our hypothesis is that Euglena chloroplast introns arose late in the evolution of this lineage and that twintrons were formed by the insertion of one or more introns into existing introns. In the present study we find that 22 out of 26 introns surveyed in six different photosynthesis-related genes from the plastid DNA of Euglena gracilis are not present in one or more basally branching Euglena spp. These results are supportive of a late origin for Euglena chloroplast group II introns. The psbT gene in Euglena viridis, a basally branching Euglena species, contains a single intron in the identical position to a psbT twintron from E.gracilis, a derived species. The E.viridis intron, when compared with 99 other Euglena group II introns, is most similar to the external intron of the E.gracilis psbT twintron. Based on these data, the addition of introns to the ancestral psbT intron in the common ancester of E.viridis and E.gracilis gave rise to the psbT twintron in E.gracilis. Images PMID:8532514

  6. Preliminary data concerning the distribution of amphibian fauna in Suceava county (Romania

    Directory of Open Access Journals (Sweden)

    Alexandru STRUGARIU

    2006-05-01

    Full Text Available The present study focused upon an area in which the herpetofauna had previously been very poorly studied and aimed to identify the species of amphibians from the research area and to establish distribution areas. In the 54 investigated localities 16 species of amphibians (Salamandra salamandra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Pelobates fuscus, Bombina bombina, Bombina variegata, Hyla arborea, Bufo bufo, Bufo viridis, Rana dalmatina, Rana temporaria, Rana arvalis, Rana ridibunda & Rana lessonae and 2 hybrids (Bombina bombina X Bombina variegata & Rana kl. esculanta have been identified. Of these, the Bombina hybrids have been identified for the first time in the studied region.

  7. Novel genomes and genome constitutions identified by GISH and 5S rDNA and knotted1 genomic sequences in the genus Setaria.

    Science.gov (United States)

    Zhao, Meicheng; Zhi, Hui; Doust, Andrew N; Li, Wei; Wang, Yongfang; Li, Haiquan; Jia, Guanqing; Wang, Yongqiang; Zhang, Ning; Diao, Xianmin

    2013-04-11

    The Setaria genus is increasingly of interest to researchers, as its two species, S. viridis and S. italica, are being developed as models for understanding C4 photosynthesis and plant functional genomics. The genome constitution of Setaria species has been studied in the diploid species S. viridis, S. adhaerans and S. grisebachii, where three genomes A, B and C were identified respectively. Two allotetraploid species, S. verticillata and S. faberi, were found to have AABB genomes, and one autotetraploid species, S. queenslandica, with an AAAA genome, has also been identified. The genomes and genome constitutions of most other species remain unknown, even though it was thought there are approximately 125 species in the genus distributed world-wide. GISH was performed to detect the genome constitutions of Eurasia species of S. glauca, S. plicata, and S. arenaria, with the known A, B and C genomes as probes. No or very poor hybridization signal was detected indicating that their genomes are different from those already described. GISH was also performed reciprocally between S. glauca, S. plicata, and S. arenaria genomes, but no hybridization signals between each other were found. The two sets of chromosomes of S. lachnea both hybridized strong signals with only the known C genome of S. grisebachii. Chromosomes of Qing 9, an accession formerly considered as S. viridis, hybridized strong signal only to B genome of S. adherans. Phylogenetic trees constructed with 5S rDNA and knotted1 markers, clearly classify the samples in this study into six clusters, matching the GISH results, and suggesting that the F genome of S. arenaria is basal in the genus. Three novel genomes in the Setaria genus were identified and designated as genome D (S. glauca), E (S. plicata) and F (S. arenaria) respectively. The genome constitution of tetraploid S. lachnea is putatively CCC'C'. Qing 9 is a B genome species indigenous to China and is hypothesized to be a newly identified species. The

  8. First record of a Neozygites species (Zygomycetes:Entomophthorales) infecting springtails (Insecta:Collembola)

    DEFF Research Database (Denmark)

    Steenberg, T.; Eilenberg, J.; Bresciani, J.

    1996-01-01

    succumbed to fungal disease following incubation in the laboratory. Based on these preliminary morphological studies the fungus appears to be an undescribed species of Neozygites. Field studies showed the fungus to be enzootic with a widespread geographical distribution in Denmark. At one location fungus......A fungal pathogen from the Entomophthorales (Zygomycetes) was discovered in populations of the lucerne flea Sminthurus viridis (Collembola) collected from grassland and leguminous crops in Denmark during July to October. The morphology of the fungus was studied in springtails, collected live, which...

  9. Nouvelles contributions a la connaisance de l'histoire de la vegetation holocene des Monts Rodnei (Carpates Orientales

    Directory of Open Access Journals (Sweden)

    Ioan Tant̡ău

    2004-09-01

    Full Text Available New Contributions to the Knowledge of the Holocene Vegetation History of Rodnei Mountains. Two sequences originating from one peat bog in Poiana Ştiol (Rodnei Mts. were pollen analyzed. The vegetation history is described since the Atlantic period. In this period the vegetation is dominated by Picea together with Corylus, Ulmus and Alnus viridis. The components frequencies of the Quercetum mixtum (Quercus, Fraxinus, Tilia, Corylus rarely exceed 10%. The vegetation of the Subboreal period is dominated by the Carpinus and that of the Subatlantic is dominated by Fagus. Picea pollen is well represented belong the entire sequences.

  10. Herbicide-induced changes in 14CO2 uptake of leaves of some crop and weed species

    International Nuclear Information System (INIS)

    Santakumari, M.; Rama Das, V.S.

    1980-01-01

    The effect of diuron or atrazine on the rate of photosynthetic 14 CO 2 uptake of two each crop (Pisum Sativum and Pennisetum typhoides) and weed species (Amaranthus viridis and Cyperus rotundus) was studied. The results indicated a marked inhibition of 14 CO 2 fixation of leaves within two hours after diuron or atrazine treatment. However the resistant plants were able to exhibit a recovery of the net photosynthetic rate subsequently while the susceptible plants failed to recover. The results suggested that even with fully open stomata and available NADPH, the normal CO 2 fixation was not restored by herbicide treated leaves. (author)

  11. Acute Intoxication following Dimethyltryptamine Ingestion

    Directory of Open Access Journals (Sweden)

    Matthew H. Bilhimer

    2018-01-01

    Full Text Available Ayahuasca is a hallucinogenic tea that is most commonly comprised of the vine Banisteriopsis caapi alone or in combination with other plants such as Psychotria viridis. This concoction results in an orally active form of dimethyltryptamine (DMT, a hallucinogenic amine. Despite use in South America as a medicinal agent and component in religious ceremonies, interest in its recreational use and spiritual effects has led to increased use in the United States. We describe a unique case following ingestion of ayahuasca tea in a patient with history of schizophrenia resulting in personal injury and property damage. A review of ayahuasca toxicity and evaluation of serious adverse effects is also presented.

  12. Acute Intoxication following Dimethyltryptamine Ingestion

    Science.gov (United States)

    Higgs, Kristan V.; Wiegand, Timothy J.; Gorodetsky, Rachel M.

    2018-01-01

    Ayahuasca is a hallucinogenic tea that is most commonly comprised of the vine Banisteriopsis caapi alone or in combination with other plants such as Psychotria viridis. This concoction results in an orally active form of dimethyltryptamine (DMT), a hallucinogenic amine. Despite use in South America as a medicinal agent and component in religious ceremonies, interest in its recreational use and spiritual effects has led to increased use in the United States. We describe a unique case following ingestion of ayahuasca tea in a patient with history of schizophrenia resulting in personal injury and property damage. A review of ayahuasca toxicity and evaluation of serious adverse effects is also presented. PMID:29682363

  13. Final Environmental Assessment Addressing Construction, Operation, and Maintenance of a Hot Cargo Pad at Kirtland Air Force Base, New Mexico

    Science.gov (United States)

    2011-01-01

    natural origins, with a flow direction to the southeast, and is not used for any purpose. The presence of faults has a direct bearing on the movement...filifolia), needle -and-thread grass (Stipa comata), globemallows (Sphaeralcea spp.), Siberian elm (Ulmus pumila), Mormon tea (Ephedra viridis), New...10 acres (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) Paver 1 3.83 0.37 2.06 0.28 0.35 0.34 401.93 Roller 1 4.82 0.44 2.51 0.37

  14. A keystone mutualism drives pattern in a power function.

    Science.gov (United States)

    Vandermeer, John; Perfecto, Ivette

    2006-02-17

    Data that can be described by a power function are ubiquitous in nature. Although there is consensus that such data frequently emerge generally from nonlinear complex systems, a variety of specific mechanisms may be responsible for creating the pattern in particular cases. Here, we report on the distribution of a scale insect (Coccus viridis) that is a common agricultural pest. Its distribution in an organic coffee farm in southern Mexico generally follows a power function, but there are subtle deviations from that function. We offer a biological explanation for both adherence to the power functions and associated deviations, along with supporting evidence.

  15. Genome sequencing and annotation of Amycolatopsis vancoresmycina strain DSM 44592T

    Directory of Open Access Journals (Sweden)

    Navjot Kaur

    2014-12-01

    Full Text Available We report the 9.0-Mb draft genome of Amycolatopsis vancoresmycina strain DSM 44592T, isolated from Indian soil sample; produces antibiotic vancoresmycin. Draft genome of strain DSM44592T consists of 9,037,069 bp with a G+C content of 71.79% and 8340 predicted protein coding genes and 57 RNAs. RAST annotation indicates that strains Streptomyces sp. AA4 (score 521, Saccharomonospora viridis DSM 43017 (score 400 and Actinosynnema mirum DSM 43827 (score 372 are the closest neighbors of the strain DSM 44592T.

  16. Padrão inverso - elemento indígena toma forma urbana - o caso da ayahuasca

    OpenAIRE

    Carlos Eduardo Pacheco

    2012-01-01

    O presente projeto tem como tema principal a "circularidade cultural” que existe em torno da ayahuasca, uma bebida produzida através da mistura de duas plantas amazônicas: a bannisteriopsis caapi, chamado cipó-mariri, e a psychotria viridis, popularmente conhecida como chacrona. A pesquisa pretende compreender a relação de circularidade entre a cultura popular (indígena) e a cultura erudita (ocidental) deste patrimônio imaterial, que parece seguir um caminho contrário ao processo comum seguid...

  17. Bioactivity of Phycocolloids against the Mediterranean Protozoan Leishmania infantum: An Inceptive Study

    Directory of Open Access Journals (Sweden)

    Simona Armeli Minicante

    2016-11-01

    Full Text Available Sulfated polysaccharides from marine macroalgae have been shown to possess a variety of biological activities against fungi, bacteria, viruses, and protozoa. In this study, the in vitro activity of algal polysaccharides against Leishmania infantum (Kinetoplastida: Trypanosomatidae was investigated. The polysaccharides were extracted from different macroalgae of the Mediterranean Sea: Chaetomorpha linum, Agardhiella subulata, Gracilaria viridis, Gracilaria bursa-pastoris, Hypnea cornuta, Sargassum muticum, and Undaria pinnatifida. Preliminary results showed a good anti-leishmanial activity of the investigated species, encouraging the focus on their use as natural resources in order to match integrated management strategies for the employment of local macroalgae.

  18. A checklist of malacofauna of the Vellar Estuarine Mangroves, India

    Directory of Open Access Journals (Sweden)

    K. Kesavan

    2009-07-01

    Full Text Available A survey conducted to know the diversity of malacofauna in Vellar estuarine mangroves (southeast coast of India. In this study, 13 species of molluscs (10 species of gastropods - Melampus ceylonicus, Cerithidea cingulata, Cassidula nucleus, Pythia plicata, Neritina (Dostia violacea, Littorina scabra, Littorina melanostoma, Ellobium aurisjudae, C. obtusa T. telescopium and Assiminea nitida and 3 species of bivalves - Perna viridis, Crassostrea madrasensis and Modiolus metcalfei were recorded. M. pulchella, C. obtusa, L. scabra and N. violacea were found arboreal. T. telescopium, C. cingulata and E. aurisjudae were found crawling on the intertidal mud.

  19. Contact Dermatitis Due to Plants

    Directory of Open Access Journals (Sweden)

    A K Bajaj

    1982-01-01

    Full Text Available Forty-seven cases of suspected plant dermatitis were patch tested with extracts of various plants. Twenty-six showed positive patch tests to one or more plant antigens. Parthenium sensitivity was observed in nine cases. Trianthema monogyna, Carissa, carandus, Amaranthus viridis, Amaranthus spinosus, Euphorbia hirta, Euphorbia thymibolia, Salvia plebia, lantana camera and pennisetum typhoides were other important plants founds to be responsible for contact sensitivity. Majority of the patients were from rural areas and most of them showed exacerbation of the dermatitis during rainy season. Males and females were equally affected.

  20. [Spread of hemoparasites in reptiles and amphibians in Italy].

    Science.gov (United States)

    Ricci, M

    1999-12-01

    Hemoparasites were harvested from 993 individuals belonging to 15 reptilian and 1 amphibian species, from various Italian localities. Hemogregarins were found in 10 reptilian species while a flagellate and microfilariae were found only in Tarentola mauritanica from Lampedusa. For each host species and place of origin the frequencies of hemogregarins are reported and discussed. Longitudinal studies with periodical thin smears were carried out on 5 Tarentola mauritanica, 4 Lacerta viridis, 26 Podarcis filfolensis, 10 Podarcis muralis, 38 Podarcis sicula, 8 Chalcides ocellatus. This material, whose study has not yet been completed, is made available by the author who strongly encourages further investigations on this subject.

  1. REPRODUCTIVE FEATURES OF SEVERAL UKRAINIAN TRUE LIZARDS (LACERTIDAE

    Directory of Open Access Journals (Sweden)

    Karmishev Yu.

    2013-04-01

    Full Text Available This work presents data on reproductive features of Ukrainian fauna Lacertidae lizards in laboratory conditions and comparative data on lizards clutches in wild nature. Terms of egg incubation of these lizards in the laboratory in a stable, relatively low temperatures can significantly exceed those in nature, which allows to obtain embryonic material with a smooth, long process of development. The most prolific representatives of different majortypes - green lizard (Lacerta viridis and nimble (Lacerta agilis. Females sand lizard can be aggressive towards other females clutches, which is manifested in the destruction of nests.

  2. Фаунистический обзор ящериц Чехии

    OpenAIRE

    Кучера, Я.

    2009-01-01

    Приводятся данные о распространении, биотопическом распределении и численности 5 видов ящериц (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Podarcis muralis, Anguis fragilis) в Чехии.

  3. Toxinas proteicas del veneno de serpientes del género Dendroaspis que reconocen receptores colinérgicos muscarínicos

    OpenAIRE

    Kornisiuk, Edgar E.

    1998-01-01

    Hace diez años se reportó la existencia de dos proteínas, MTx1 y MTx2, del veneno de la mamba verde oriental (Dendroaspis angusticeps) que inhibieron la unión de ligandos muscarínicos en cerebro de rata. Actualmente se han aislado más de diez toxinas muscarínicas (MTxs) de la mamba verde oriental, la mamba negra (D. polylepis) y la mamba verde occidental (D. viridis). Estas toxinas poseen 65-66 aminoácidos, con cuatro puentes disulfirro que les confieren una estructura de "tres dedos", tal co...

  4. Molecular discrimination of Perna (Mollusca: Bivalvia) species using the polymerase chain reaction and species-specific mitochondrial primers

    DEFF Research Database (Denmark)

    Blair, D.; Waycott, M.; Byrne, L.

    2006-01-01

    This work was prompted by the need to be able to identify the invasive mussel species, Perna viridis, in tropical Australian seas using techniques that do not rely solely on morphology. DNA-based molecular methods utilizing a polymerase chain reaction (PCR) approach were developed to distinguish...... designed that can act as a forward primer in PCRs for any Perna species. Four reverse primers have also been designed, based on nad4 and intergenic spacer sequences, which yield species-specific products of different lengths when paired with the conserved forward primer. A further pair of primers has been...

  5. New records of Decapod Crustaceans (Decapoda: Pontoniinae and Inachidae associated with sea anemones in Turkish waters

    Directory of Open Access Journals (Sweden)

    Z. DURIS

    2013-10-01

    Full Text Available Three anemone-associated decapod crustaceans, two shrimp species, Periclimenes amethysteus and P. aegylios (Caridea: Palaemonidae: Pontoniinae, and the crab Inachus phalangium (Brachyura: Inachidae, all collected from the Dardanelles, are reported for the first time from Turkish coasts. Another inachid crab, Macropodia czernjawskii is also reported for the first time to occur in association with the sea anemone, Anemonia viridis. Periclimenes scriptus was the fifth decapod species recorded associated with sea anemones within the present study, and while this species has already been reported from Turkish waters, this is the first time it is recorded from the Dardanelles (the Turkish Straits System.

  6. Colloidosome-based synthesis of a multifunctional nanostructure of silver and hollow iron oxide nanoparticles

    KAUST Repository

    Pan, Yue

    2010-03-16

    Nanoparticles that self-assemble on a liquid-liquid interface serve as the building block for making heterodimeric nanostructures. Specifically, hollow iron oxide nanoparticles within hexane form colloidosomes in the aqueous solution of silver nitrate, and iron oxide exposed to the aqueous phase catalyzes the reduction of silver ions to afford a heterodimer of silver and hollow iron oxide nanoparticles. Transmission electron microscopy, selected area electron diffraction, energy-dispersive X-ray spectrometry, X-ray diffraction, UV-vis spectroscopy, and SQUID were used to characterize the heterodimers. Interestingly, the formation of silver nanoparticles helps the removal of spinglass layer on the hollow iron oxide nanoparticles. This work demonstrates a powerful yet convenient strategy for producing sophisticated, multifunctional nanostructures. © 2010 American Chemical Society.

  7. Crystal structure of the platelet activator convulxin, a disulfide-linked alpha4beta4 cyclic tetramer from the venom of Crotalus durissus terrificus.

    Science.gov (United States)

    Murakami, M T; Zela, S P; Gava, L M; Michelan-Duarte, S; Cintra, A C O; Arni, R K

    2003-10-17

    Convulxin (CVX), a C-type lectin, isolated from the venom of the South American rattlesnake Crotalus durissus terrificus, causes cardiovascular and respiratory disturbances and is a potent platelet activator which binds to platelet glycoprotein GPVI. The structure of CVX has been solved at 2.4A resolution to a crystallographic residual of 18.6% (R(free)=26.4%). CVX is a disulfide linked heterodimer consisting of homologous alpha and beta chains. The heterodimers are additionally linked by disulfide bridges to form cyclic alpha(4)beta(4)heterotetramers. These domains exhibit significant homology to the carbohydrate-binding domains of C-type lectins, to the factor IX-binding protein (IX-bp), and to flavocetin-A (Fl-A) but sequence and structural differences are observed in both the domains in the putative Ca(2+)and carbohydrate binding regions.

  8. A theoretical and spectroscopic study of co-amorphous naproxen and indomethacin

    DEFF Research Database (Denmark)

    Löbmann, Korbinian; Laitinen, Riikka; Grohganz, Holger

    2013-01-01

    . In this study, the co-amorphous drug mixture containing naproxen (NAP) and indomethacin (IND) was investigated using infrared spectroscopy (IR) and quantum mechanical calculations. The structures of both drugs were optimized as monomer, homodimer and heterodimer using density functional theory and used...... for the calculation of IR spectra. Conformational analysis confirmed that the optimized structures were suitable for the theoretical prediction of the spectra. Vibrational modes from the calculation could be matched with experimentally observed spectra for crystalline and amorphous NAP and IND, and it could be shown...... that NAP and IND exist as heterodimers in the co-amorphous mixture when quench cooled together from the melt in a 1:1 molar ratio....

  9. The transcription factor Rbf1 is the master regulator for b-mating type controlled pathogenic development in Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    Kai Heimel

    Full Text Available In the phytopathogenic basidiomycete Ustilago maydis, sexual and pathogenic development are tightly connected and controlled by the heterodimeric bE/bW transcription factor complex encoded by the b-mating type locus. The formation of the active bE/bW heterodimer leads to the formation of filaments, induces a G2 cell cycle arrest, and triggers pathogenicity. Here, we identify a set of 345 bE/bW responsive genes which show altered expression during these developmental changes; several of these genes are associated with cell cycle coordination, morphogenesis and pathogenicity. 90% of the genes that show altered expression upon bE/bW-activation require the zinc finger transcription factor Rbf1, one of the few factors directly regulated by the bE/bW heterodimer. Rbf1 is a novel master regulator in a multilayered network of transcription factors that facilitates the complex regulatory traits of sexual and pathogenic development.

  10. A monomeric G protein-coupled receptor isolated in a high-density lipoprotein particle efficiently activates its G protein

    DEFF Research Database (Denmark)

    Whorton, Matthew R; Bokoch, Michael P; Rasmussen, Søren Gøgsig Faarup

    2007-01-01

    G protein-coupled receptors (GPCRs) respond to a diverse array of ligands, mediating cellular responses to hormones and neurotransmitters, as well as the senses of smell and taste. The structures of the GPCR rhodopsin and several G proteins have been determined by x-ray crystallography, yet...... the organization of the signaling complex between GPCRs and G proteins is poorly understood. The observations that some GPCRs are obligate heterodimers, and that many GPCRs form both homo- and heterodimers, has led to speculation that GPCR dimers may be required for efficient activation of G proteins. However......, technical limitations have precluded a definitive analysis of G protein coupling to monomeric GPCRs in a biochemically defined and membrane-bound system. Here we demonstrate that a prototypical GPCR, the beta2-adrenergic receptor (beta2AR), can be incorporated into a reconstituted high-density lipoprotein...

  11. Identification of Bexarotene as a PPARγ Antagonist with HDX

    Directory of Open Access Journals (Sweden)

    David P. Marciano

    2015-01-01

    Full Text Available The retinoid x receptors (RXRs are the pharmacological target of Bexarotene, an antineoplastic agent indicated for the treatment of cutaneous T cell lymphoma (CTCL. The RXRs form heterodimers with several nuclear receptors (NRs, including peroxisome proliferator-activated receptor gamma (PPARγ, to regulate target gene expression through cooperative recruitment of transcriptional machinery. Here we have applied hydrogen/deuterium exchange (HDX mass spectrometry to characterize the effects of Bexarotene on the conformational plasticity of the intact RXRα:PPARγ heterodimer. Interestingly, addition of Bexarotene to PPARγ in the absence of RXRα induced protection from solvent exchange, suggesting direct receptor binding. This observation was confirmed using a competitive binding assay. Furthermore, Bexarotene functioned as a PPARγ antagonist able to alter rosiglitazone induced transactivation in a cell based promoter:reporter transactivation assay. Together these results highlight the complex polypharmacology of lipophilic NR targeted small molecules and the utility of HDX for identifying and characterizing these interactions.

  12. Preparation of Homogeneous Nanostructures in 5 Minutes for Cancer Cells Capture

    Directory of Open Access Journals (Sweden)

    Lixue Wang

    2015-01-01

    Full Text Available Grafting aptamers on nanostructured substrates has shown ultrasensitivity in isolation of circulating tumor cells (CTCs. Here, we report that over 80 cm2 of homogenous nanostructured surface on glass substrates can be prepared in 5 min after one-step dry etching. The surface area was doubled; the average diameter of nanostructures is approximately 374 nm, which is more close to the nanostructures of natural extracellular matrix. Antiepithelial cell adhesion molecule aptamers grafted nanostructured glass substrates captured over 76% of PC3 cells compared to 30% of planar substrates. Bispecific aptamers cofunctionalized nanostructured substrates, however, fail to capture cancer cells probably due to the formation of heterodimers. This limitation reveals that multispecific aptamers, when applied to cell isolation, must be analyzed to exclude any potential formation of heterodimers due to complementary sequence matching.

  13. A non-typical cyclobutane dimer photoproduct from 5-ethylorotate

    International Nuclear Information System (INIS)

    Kulikowska, E.; Miura, I.; Nakanishi, K.; Zawadzki, Z.; Shugar, D.

    1984-01-01

    One of the two major photoproducts resulting from the irradiation of 5-ethylorotate in neutral aqueous medium has been identified as an unusual cyclobutane photodimer formed from the 5.6 bond of the parent 5-ethylorotate and the exocyclic C-5-C 8 bond of 5-ethylidenehydroorotate the initial photoproduct of 5-ethylorotate. Irradiation at 254 nm in neutral aqueous medium causes the heterodimer to photodissociate to the two parent monomers with a quantum yield of 0.28. The heterodimer also hydrolyzes to the parent monomers in aqueous base at room temperature or by heating in the solid state. A scheme for the major photochemical transformation of 5-ethylorotate is presented. (author)

  14. Structure-function studies of nucleocytoplasmic transport of retroviral genomic RNA by mRNA export factor TAP

    Science.gov (United States)

    Teplova, Marianna; Wohlbold, Lara; Khin, Nyan W.; Izaurralde, Elisa; Patel, Dinshaw J.

    2011-01-01

    Messenger RNA export is mediated by the TAP-p15 heterodimer, which belongs to the family of NTF2-like export receptors. TAP-p15 heterodimers also bind to the constitutive transport element (CTE) present in simian type D retroviral RNAs, and mediate export of viral unspliced RNAs to the host cytoplasm. We have solved the crystal structure of the RNA recognition and leucine-rich repeat motifs of TAP bound to one symmetrical-half of CTE RNA. L-shaped conformations of protein and RNA are involved in a mutual molecular embrace on complex formation. We have monitored the impact of structure-guided mutations on binding affinities in vitro and transport assays in vivo. Our studies define the principles by which CTE RNA subverts the mRNA export receptor TAP, thereby facilitating nuclear export of viral genomic RNAs, and more generally, provide insights on cargo RNA recognition by mRNA export receptors. PMID:21822283

  15. The Escherichia coli BolA Protein IbaG Forms a Histidine-Ligated [2Fe-2S]-Bridged Complex with Grx4.

    Science.gov (United States)

    Dlouhy, Adrienne C; Li, Haoran; Albetel, Angela-Nadia; Zhang, Bo; Mapolelo, Daphne T; Randeniya, Sajini; Holland, Ashley A; Johnson, Michael K; Outten, Caryn E

    2016-12-13

    Two ubiquitous protein families have emerged as key players in iron metabolism, the CGFS-type monothiol glutaredoxins (Grxs) and the BolA proteins. Monothiol Grxs and BolA proteins form heterocomplexes that have been implicated in Fe-S cluster assembly and trafficking. The Escherichia coli genome encodes members of both of these proteins families, namely, the monothiol glutaredoxin Grx4 and two BolA family proteins, BolA and IbaG. Previous work has demonstrated that E. coli Grx4 and BolA interact as both apo and [2Fe-2S]-bridged heterodimers that are spectroscopically distinct from [2Fe-2S]-bridged Grx4 homodimers. However, the physical and functional interactions between Grx4 and IbaG are uncharacterized. Here we show that co-expression of Grx4 with IbaG yields a [2Fe-2S]-bridged Grx4-IbaG heterodimer. In vitro interaction studies indicate that IbaG binds the [2Fe-2S] Grx4 homodimer to form apo Grx4-IbaG heterodimer as well as the [2Fe-2S] Grx4-IbaG heterodimer, altering the cluster stability and coordination environment. Additionally, spectroscopic and mutagenesis studies provide evidence that IbaG ligates the Fe-S cluster via the conserved histidine that is present in all BolA proteins and by a second conserved histidine that is present in the H/C loop of two of the four classes of BolA proteins. These results suggest that IbaG may function in Fe-S cluster assembly and trafficking in E. coli as demonstrated for other BolA homologues that interact with monothiol Grxs.

  16. Analysis of RXR/THR and RXR/PPARG2 heterodimerization by bioluminescence resonance energy transfer (BRET.

    Directory of Open Access Journals (Sweden)

    Miquel Mulero

    Full Text Available BACKGROUND: Nuclear receptors (NR regulate transcription of genes involved in many biological processes such as development, cell proliferation, differentiation and cell death. Amongst them, PPARG2 and THR control tissue glucose and lipid homeostasis which are deregulated in severe pathophysiological conditions such as metabolic syndromes. METHODOLOGY/PRINCIPAL FINDINGS: Here, we describe a real time BRET approach to monitor heterodimerization between RXR and PPARG2 or THR in vitro or in living cells. The presence of a specific DNA target was required to induce in vitro a BRET shift reflecting heterodimerization of RXR/PPARG2 or RXR/THR. As in electrophoretic mobility shift assay (EMSA, the stringency and specificity of the BRET shift assay depended upon assay condition optimization including MgCl2 concentration. For the nuclear receptors, we found by mutagenesis analysis that each heterodimer partner must harbor an intact DNA binding domain to induce BRET and heterodimerization on a DNA target. Moreover the interaction between the PPARG2 ligand binding domain and the RXR DNA binding domain stabilized the heterodimer on its DNA target. BRET microscopy in living cells highlighted the heterodimerization of RXR/PPARG2 within the nucleus clustered in discrete foci that may represent active target gene transcription regulation regions. BRET imaging also suggested that heterodimerization between RXR and PPARG2 required the DNA binding of PPARG2. CONCLUSIONS/SIGNIFICANCE: The BRET approach described here allowed us to study the dynamic interactions which exist between NR in vitro or in living cells and can provide important information on heterodimerization modes, affinity with a given RE and subcellular localization of the heterodimers. This method could be used to study real time changes of NR heterodimers occurring on DNA depending upon cell activation, chromatin state and help to define the mechanisms of ligands or drug action designed to target

  17. High-resolution crystal structures of Colocasia esculenta tarin lectin.

    Science.gov (United States)

    Pereira, Patricia R; Meagher, Jennifer L; Winter, Harry C; Goldstein, Irwin J; Paschoalin, Vânia M F; Silva, Joab T; Stuckey, Jeanne A

    2017-01-01

    Tarin, the Colocasia esculenta lectin from the superfamily of α-d-mannose-specific plant bulb lectins, is a tetramer of 47 kDa composed of two heterodimers. Each heterodimer possesses homologous monomers of ~11.9 (A chain) and ~12.7 (B chain) kDa. The structures of apo and carbohydrate-bound tarin were solved to 1.7 Å and 1.91 Å, respectively. Each tarin monomer forms a canonical β-prism II fold, common to all members of Galanthus nivalis agglutinin (GNA) family, which is partially stabilized by a disulfide bond and a conserved hydrophobic core. The heterodimer is formed through domain swapping involving the C-terminal β-strand and the β-sheet on face I of the prism. The tetramer is assembled through the dimerization of the B chains from heterodimers involving face II of each prism. The 1.91 Å crystal structure of tarin bound to Manα(1,3)Manα(1,6)Man reveals an expanded carbohydrate-binding sequence (QxDxNxVxYx 4/6 WX) on face III of the β-prism. Both monomers possess a similar fold, except for the length of the loop, which begins after the conserved tyrosine and creates the binding pocket for the α(1,6)-terminal mannose. This loop differs in size and amino-acid composition from 10 other β-prism II domain proteins, and may confer carbohydrate-binding specificity among members of the GNA-related lectin family. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  18. Protease-resistant modified human β-hexosaminidase B ameliorates symptoms in GM2 gangliosidosis model

    OpenAIRE

    Kitakaze, Keisuke; Mizutani, Yasumichi; Sugiyama, Eiji; Tasaki, Chikako; Tsuji, Daisuke; Maita, Nobuo; Hirokawa, Takatsugu; Asanuma, Daisuke; Kamiya, Mako; Sato, Kohei; Setou, Mitsutoshi; Urano, Yasuteru; Togawa, Tadayasu; Otaka, Akira; Sakuraba, Hitoshi

    2016-01-01

    GM2 gangliosidoses, including Tay-Sachs and Sandhoff diseases, are neurodegenerative lysosomal storage diseases that are caused by deficiency of β-hexosaminidase A, which comprises an αβ heterodimer. There are no effective treatments for these diseases; however, various strategies aimed at restoring β-hexosaminidase A have been explored. Here, we produced a modified human hexosaminidase subunit β (HexB), which we have termed mod2B, composed of homodimeric β subunits that contain amino acid se...

  19. The structure of the GemC1 coiled coil and its interaction with the Geminin family of coiled-coil proteins

    Energy Technology Data Exchange (ETDEWEB)

    Caillat, Christophe; Fish, Alexander [The Netherlands Cancer Institute, 1066 CX Amsterdam (Netherlands); Pefani, Dafni-Eleftheria; Taraviras, Stavros; Lygerou, Zoi [University of Patras, 26505 Rio, Patras (Greece); Perrakis, Anastassis, E-mail: a.perrakis@nki.nl [The Netherlands Cancer Institute, 1066 CX Amsterdam (Netherlands)

    2015-10-31

    The GemC1 coiled-coil structure has subtle differences compared with its homologues Geminin and Idas. Co-expression experiments in cells and biophysical stability analysis of the Geminin-family coiled coils suggest that the GemC1 coiled coil alone is unstable. GemC1, together with Idas and Geminin, an important regulator of DNA-replication licensing and differentiation decisions, constitute a superfamily sharing a homologous central coiled-coil domain. To better understand this family of proteins, the crystal structure of a GemC1 coiled-coil domain variant engineered for better solubility was determined to 2.2 Å resolution. GemC1 shows a less typical coiled coil compared with the Geminin homodimer and the Geminin–Idas heterodimer structures. It is also shown that both in vitro and in cells GemC1 interacts with Geminin through its coiled-coil domain, forming a heterodimer that is more stable that the GemC1 homodimer. Comparative analysis of the thermal stability of all of the possible superfamily complexes, using circular dichroism to follow the unfolding of the entire helix of the coiled coil, or intrinsic tryptophan fluorescence of a unique conserved N-terminal tryptophan, shows that the unfolding of the coiled coil is likely to take place from the C-terminus towards the N-terminus. It is also shown that homodimers show a single-state unfolding, while heterodimers show a two-state unfolding, suggesting that the dimer first falls apart and the helices then unfold according to the stability of each protein. The findings argue that Geminin-family members form homodimers and heterodimers between them, and this ability is likely to be important for modulating their function in cycling and differentiating cells.

  20. Regulation of CCR7-dependent cell migration through?CCR7 homodimer formation

    OpenAIRE

    Kobayashi, Daichi; Endo, Masataka; Ochi, Hirotaka; Hojo, Hironobu; Miyasaka, Masayuki; Hayasaka, Haruko

    2017-01-01

    The chemokine receptor CCR7 contributes to various physiological and pathological processes including T cell maturation, T cell migration from the blood into secondary lymphoid tissues, and tumor cell metastasis to lymph nodes. Although a previous study suggested that the efficacy of CCR7 ligand-dependent T cell migration correlates with CCR7 homo- and heterodimer formation, the exact extent of contribution of the CCR7 dimerization remains unclear. Here, by inducing or disrupting CCR7 dimers,...