WorldWideScience

Sample records for bk post trasplante

  1. Diagnóstico y clasificación molecular del virus BK en receptores de trasplante renal

    OpenAIRE

    Riva, Omar; Cobos, Marisa; Clemente, J

    2010-01-01

    La infección primaria por virus BK ocurre durante la infancia permaneciendo latente en el tracto urogenital. En individuos que presentan alteraciones en la inmunidad celular, el virus se reactiva haciendo posible su detección en orina y sangre. En receptores de trasplante renal, la nefropatía producida por el virus BK puede llevar a la pérdida de la función del injerto. El virus BK es miembro de la familia Polyomaviridae, presenta un genoma de ADN circular doble cadena unido en forma covalent...

  2. Factores asociados y consecuencias clínicas de la anemia post trasplante renal

    Directory of Open Access Journals (Sweden)

    Mónica Freiberg

    2013-04-01

    Full Text Available Un porcentaje considerable de pacientes presentan anemia post trasplante renal. Su origen es multifactorial y sus principales etiologías dependen de la etapa post trasplante que se considere. Estudiamos en un grupo de 134 pacientes los factores asociados con anemia tardía (6 meses post trasplante y sus implicaciones clínicas a mediano plazo. En el análisis de regresión múltiple, la duración de la oliguria post trasplante y el número de episodios de rechazo fueron las variables significativamente asociadas con esta complicación. La supervivencia del órgano mostró una diferencia significativa a los 36 meses entre los grupos (83% en los anémicos versus 96% de los no anémicos p < 0.01. No observamos diferencias en mortalidad o eventos cardiovasculares. Concluimos que la presencia de anemia al sexto mes post trasplante renal está independiente y significativamente asociada con factores que condicionan la masa renal funcionante que explicarían además la menor supervivencia del injerto renal observada en estos pacientes.

  3. Association of renal adenocarcinoma and BK virus nephropathy post transplantation.

    Science.gov (United States)

    Kausman, Joshua Yehuda; Somers, Gino Rene; Francis, David Michael; Jones, Colin Lindsay

    2004-04-01

    While most BK virus infections are asymptomatic, immunosuppression has been associated with BK virus reactivation and impaired graft function or ureteric ulceration in renal transplant patients and hemorrhagic cystitis in bone marrow transplant patients. Oncogenicity is also postulated and this is the first report of a child with a carcinoma of the donor renal pelvis following BK virus allograft nephropathy. Removal of the primary tumor and cessation of immunosuppression led to regression of secondary tumors and a return to health. PMID:14986088

  4. Aplasia pura de serie roja post-trasplante alogeneico de células progenitoras hematopoyeticas ABO incompatible

    OpenAIRE

    E. Bulliorsky; C. Shanley; G. Stemmelin; J. Ceresetto; O. Rabinovich

    2002-01-01

    El trasplante alogeneico de células progenitoras hematopoyéticas (TCPH) con incompatibilidad ABO entre el donante y el receptor puede en ocasiones asociarse a trastornos en la progenie eritroide desarrollada a partir de la médula ósea trasplantada, caracterizado por un funcionamiento tardío, inadecuado e incompleto de la misma. En este contexto, la aplasia pura de serie roja es la complicación más severa. Se han intentado tratamientos para la aplasia pura de serie roja post-TCPH con eritropoy...

  5. Trasplante pulmonar

    Directory of Open Access Journals (Sweden)

    M. Espinosa

    2006-08-01

    Full Text Available El transplante pulmonar suele ser la última opción terapéutica para pacientes con insuficiencia respiratoria. A pesar de los muchos avances en inmunología y el manejo de las complicaciones, la mortalidad y morbilidad asociadas a este trasplante son muy superiores a los demás. El rechazo agudo es casi un problema universal en el primer año, mientras que la bronquiolitis obliterante limita la supervivencia a largo plazo. Las infecciones respiratorias también cumplen un papel importante en las complicaciones asociadas al trasplante pulmonar por la constante exposición del injerto al medio exterior. No obstante, los éxitos de esta opción terapéutica que depende fundamentalmente de una correcta selección de donante y receptor, son evidentes, sobre todo en cuanto a calidad de vida se refiere.

  6. Aplasia pura de serie roja post-trasplante alogeneico de células progenitoras hematopoyeticas ABO incompatible

    Directory of Open Access Journals (Sweden)

    E. Bulliorsky

    2002-12-01

    Full Text Available El trasplante alogeneico de células progenitoras hematopoyéticas (TCPH con incompatibilidad ABO entre el donante y el receptor puede en ocasiones asociarse a trastornos en la progenie eritroide desarrollada a partir de la médula ósea trasplantada, caracterizado por un funcionamiento tardío, inadecuado e incompleto de la misma. En este contexto, la aplasia pura de serie roja es la complicación más severa. Se han intentado tratamientos para la aplasia pura de serie roja post-TCPH con eritropoyetina o plasmaféresis, con relativo éxito. Algunos autores han informado también la utilización de globulina antilinfocitaria, asumiendo que dicha aplasia selectiva de la serie roja en la médula ósea trasplantada es mediada por un mecanismo inmune. En este trabajo se describe un paciente portador de una leucemia aguda en quien se realizó un TCPH alogeneico (ABO incompatible con su donante. Teniendo niveles bajos de aglutininas contra el grupo sanguíneo de la donante, desarrolló una aplasia pura de serie roja post - TCPH. La misma no mejoró con tratamiento con eritropoyetina o con un refuerzo de progenitores hematopoyéticos de sangre periférica de la misma donante (boost, resolviéndose totalmente luego de un tratamiento exitoso con globulina antilinfocitaria de origen equino.

  7. Trasplante cardiaco

    Directory of Open Access Journals (Sweden)

    Donato Salas-Segura

    2008-12-01

    Full Text Available La insuficiencia cardiaca es un cuadro clínico frecuente y de apreciable mortalidad. A menudo de nuestra área de atracción emergen cardiópatas con diferentes grados de discapacidad, dependientes de familiares para su atención y que requieren re-hospitalizaciones y tratamientos costosos y a pesar de ello con mal pronóstico. Las autoridades sanitarias y particularmente el estado invierten anualmente mucho dinero en el tratamiento de los enfermos que la padecen y también en la cobertura de incapacidades para estos individuos. El trasplante cardiaco se ha implementado en el mundo como una excelente opción de tratamiento de los pacientes con insuficiencia cardiaca, capaz de brindar al menos 10 años de vida a pesar de lo riguroso del seguimiento, tanto para el paciente y su familia, como para el personal medico. El Hospital R. A. Calderón Guardia inició hace un año un Programa de Trasplante Cardiaco, presentamos aquí los 2 primeros pacientes y su seguimiento.

  8. Aplasia pura de serie roja post-trasplante alogeneico de células progenitoras hematopoyeticas ABO incompatible Pure red cell aplasia after ABO incompatible bone marrow transplantation

    OpenAIRE

    E. Bulliorsky; C. Shanley; G. Stemmelin; J. Ceresetto; O. Rabinovich

    2002-01-01

    El trasplante alogeneico de células progenitoras hematopoyéticas (TCPH) con incompatibilidad ABO entre el donante y el receptor puede en ocasiones asociarse a trastornos en la progenie eritroide desarrollada a partir de la médula ósea trasplantada, caracterizado por un funcionamiento tardío, inadecuado e incompleto de la misma. En este contexto, la aplasia pura de serie roja es la complicación más severa. Se han intentado tratamientos para la aplasia pura de serie roja post-TCPH con eritropoy...

  9. al trasplante de órganos

    Directory of Open Access Journals (Sweden)

    María Ángeles Pérez San Gregorio

    2005-01-01

    Full Text Available El trasplante de órganos es una alternativa terapéutica para aquellos pacientes que tienen problemas graves en el funcionamiento de un órgano vital: corazón, hígado, pulmón, etc. Dada la relevancia de este tema, en el presente estudio teórico analizamos los principales problemas psicológicos asociados al trasplante de órganos. Concretamente, hemos tenido en cuenta los siguientes apartados: 1 Repercusiones psicológicas del trasplante de órganos en los pacientes: delirium, trastornos sexuales, trastornos del estado de ánimo, trastornos de ansiedad, fantasías sobre el donante, insatisfacción con la imagen corporal y otros trastornos; 2 variables psicosociales que influyen en las repercusiones psicológicas asociadas al trasplante de órganos: apoyo familiar, trastornos psicológicos en los familiares, hospitalización, expectativas pre y post-trasplante, estrategias de afrontamiento, duración de la enfermedad, etiología del trasplante, procedencia del órgano implantado y otras variables; 3 fases psicológicas en los trasplantados renales, hepáticos y cardíacos en función de diferentes periodos temporales de comparación; 4 calidad de vida en los trasplantados y variables que la predicen: adherencia terapéutica, hospitalización, apoyo familiar, expectativas hacia el trasplante y etiología del trasplante; y 5 repercusiones psicológicas del trasplante de órganos en los familiares, teniendo en cuenta la influencia que ejerce el apoyo social sobre la salud mental de estos familiares.

  10. Short-tem Post Renal Trasplant Follow-up at Madinah Al Munawarah

    Directory of Open Access Journals (Sweden)

    Bernieh Bassam

    1999-01-01

    Full Text Available We reviewed the records of the renal transplant patients followed at our hospital to determine short-term outcome and complications. Sixty-five renal transplant patients, follow-up for two years were included in this study. Of these patients 40 (61.5% were males, 33 (50.7% were Saudis with mean age of 37.2 ± 11.7 years. Donors were living related (LRD in 23 (35%, living non-related (LNRD in 27 (42% and cadaveric (CAD in 15 (23%. Thirty-two transplants were carried out at Medinah, 21 in India and the rest in other centers inside Saudi Arabia. Immunosuppression was based on a triple therapy (Cyclosporin, Azathioprine, and Prednisone. At two years, 52 (80% patients were alive, with functioning graft in 31 (58%. Causes of death among 13 patients (11 LNRD & 2 CAD were infections in 7 (54%, immediate post transplant in three (22.7%, acute myocardial infarction in two (15.7%, CVA in one (7.6%. Complications encountered were acute rejection (23 episodes in 18 923.6% patients, infections in 19 (25%, chronic rejection in 16 (21.5%, surgical in 13 917.1%, diabetes mellitus in 5 (6.5% primary non-function in three (3.8% and Kaposi Sarcoma in two (2.4%. Twenty-six (81.25% out of 32 transplants performed in Madinah were functioning, four (12.5% patients returned to dialysis and two (6.25% patients died. Among the 21 transplants done in India 11 (52% patients died, six (28.6% returned to dialysis, and four (19.4% had function deteriorated in all patients. We conclude that despite limitations, results of renal transplantation carried out at Madinah are encouraging on short-term basis. Live related transplant has a very good outcome, while commercial transplantation carries poor prognosis.

  11. Evolucion de niños post-trasplante hepático luego del primer año de sobrevida Evolution of children one year post liver transplant

    Directory of Open Access Journals (Sweden)

    Miriam Cuarterolo

    2005-10-01

    Full Text Available El trasplante hepático constituye la única alternativa terapéutica para numerosas enfermedades hepáticas avanzadas. En el seguimiento post-trasplante pueden observarse complicaciones de diversa gravedad. El objetivo de este estudio fue analizar la evolución a largo plazo de los pacientes trasplantados con un seguimiento mayor de un año post quirúrgico. En el período 11/92-11/01 se realizaron 264 trasplantes en 238 pacientes; incluyéndose en este trabajo 143 niños con más de un año post-trasplante. La mediana de edad ± DS fue de 5.41 ± 5.26 años (r: 0.58-21.7 años. Catorce (9.79% fueron retrasplantados. Todos los pacientes recibieron ciclosporina (inmunosupresión primaria. Las indicaciones de trasplante fueron: falla hepática fulminante (n: 50; atresia de vías biliares (n: 38; cirrosis (n: 37; colestasis crónica (n: 13 y otras (n: 5. Las indicaciones de retrasplante fueron: cirrosis biliar (n: 7; trombosis de la arteria hepática (n: 4 y rechazo crónico (n: 3. Fueron utilizados injertos reducidos en 73/157 trasplantes(14 donantes vivos relacionados y 11 biparticiones hepáticas. La sobrevida global fue de 93%, paciente y 86%, injerto. El retrasplante y el injerto reducido fueron las variables de mayor significación para el aumento del riesgo de muerte. El déficit de talla y masa ósea se recuperó antes de los 3años post-trasplante. La incidencia de síndrome linfoproliferativo fue del 7.69%. Se diagnosticó hepatitis B de novo en 7 pacientes (4.8%. El riesgo social no afectó la sobrevida. La prevención, detección y tratamiento precoz de las complicaciones en el seguimiento a largo plazo permitió mejorar la evolución de los pacientes.Orthotopic liver transplantation is the only definitive mode of therapy for children with end-stage liver disease. However, it remains challenging because of the necessity to prevent long-term complications. The aim of this study was to analyze the evolution of transplanted patients with

  12. Aplasia pura de serie roja post-trasplante alogeneico de células progenitoras hematopoyeticas ABO incompatible Pure red cell aplasia after ABO incompatible bone marrow transplantation

    Directory of Open Access Journals (Sweden)

    E. Bulliorsky

    2002-12-01

    Full Text Available El trasplante alogeneico de células progenitoras hematopoyéticas (TCPH con incompatibilidad ABO entre el donante y el receptor puede en ocasiones asociarse a trastornos en la progenie eritroide desarrollada a partir de la médula ósea trasplantada, caracterizado por un funcionamiento tardío, inadecuado e incompleto de la misma. En este contexto, la aplasia pura de serie roja es la complicación más severa. Se han intentado tratamientos para la aplasia pura de serie roja post-TCPH con eritropoyetina o plasmaféresis, con relativo éxito. Algunos autores han informado también la utilización de globulina antilinfocitaria, asumiendo que dicha aplasia selectiva de la serie roja en la médula ósea trasplantada es mediada por un mecanismo inmune. En este trabajo se describe un paciente portador de una leucemia aguda en quien se realizó un TCPH alogeneico (ABO incompatible con su donante. Teniendo niveles bajos de aglutininas contra el grupo sanguíneo de la donante, desarrolló una aplasia pura de serie roja post - TCPH. La misma no mejoró con tratamiento con eritropoyetina o con un refuerzo de progenitores hematopoyéticos de sangre periférica de la misma donante (boost, resolviéndose totalmente luego de un tratamiento exitoso con globulina antilinfocitaria de origen equino.ABO incompatibility in allogeneic bone marrow transplantation may be associated with incomplete or delayed erythroid engraftment, being pure red cell aplasia (PRCA the most severe complication in this setting. Attempts for the treatment of PRCA have been made with erythropoietin or with plasmapheresis with relative success, and some authors have reported the reversibility of PRCA with antilymphocyte globulin (ALG or ATG, based on the assumption that PRCA might be immunologically mediated. We report herewith a patient with acute leukemia who developed post - BMT pure red cell aplasia. His sibling donor (sister was HLA identical and ABO incompatible, having low agglutinin

  13. Trasplante renal Kidney transplant

    Directory of Open Access Journals (Sweden)

    P. Martín

    2006-08-01

    Full Text Available El trasplante renal es la terapia de elección para la mayoría de las causas de insuficiencia renal crónica terminal porque mejora la calidad de vida y la supervivencia frente a la diálisis. El trasplante renal de donante vivo es una excelente alternativa para el paciente joven en situación de prediálisis porque ofrece mejores resultados. El tratamiento inmunosupresor debe ser individualizado buscando la sinergia inmunosupresora y el mejor perfil de seguridad, y debe adaptarse a las diferentes etapas del trasplante renal. En el seguimiento del trasplante renal hay que tener muy en cuenta los factores de riesgo cardiovascular y los tumores puesto que la muerte del paciente con injerto funcionante es la segunda causa de pérdida del injerto tras el primer año del trasplante. La función alterada del injerto es un factor de mortalidad cardiovascular independiente que requerirá seguimiento y control de todas sus complicaciones para retrasar la entrada en diálisis.The kidney transplant is the therapy of choice for the majority of the causes of chronic terminal kidney insufficiency, because it improves the quality of life and survival in comparison with dialysis. A kidney transplant from a live donor is an excellent alternative for the young patient in a state of pre-dialysis because it offers the best results. Immunosuppressive treatment must be individualised, seeking immunosuppressive synergy and the best safety profile, and must be adapted to the different stages of the kidney transplant. In the follow-up to the kidney transplant, cardiovascular risk factors and tumours must be especially taken into account, given that the death of the patient with a working graft is the second cause of loss of the graft following the first year of the transplant. The altered function of the graft is a factor of independent cardiovascular mortality that will require follow-up and the control of all its complications to postpone the entrance in dialysis.

  14. Trasplante mecanizado de hortalizas

    Directory of Open Access Journals (Sweden)

    F. Muñoz Gómez

    2006-01-01

    Full Text Available En el trabajo se realiza el análisis de los parámetros de funcionamiento de una máquina trasplantadora de alimentación manual del tipo de pinzas, para que las plántulas queden verticales en el suelo y con la distancia especificada según el tipo de cultivo, obteniéndose los resultados de las pruebas de trasplante en campo de tomate de cáscara, el objetivo fue generar datos para calcular los valores teóricos del parámetro lp de 6 variedades de hortalizas. En las pruebas de trasplante en el campo los parámetros a medir fueron: velocidad de avance de la máquina, distancia entre plantas, inclinación de las plantas, profundidad de plantación. Las pruebas se realizaron en una parcela con 12 surcos de 140 metros de largo y 1,40 metros entre surcos. Los tres primeros se utilizaron para hacer las calibraciones y ajustes necesarios de los parámetros de trabajo de la máquina. Los resultados del trabajo arrojaron que los valores de lp calculados mediante las pruebas de laboratorio se pueden utilizar como parámetros para calcular la cadena cinemática de la máquina o como parámetros de referencia para ajustar la relación de transmisión de la máquina cuando se requiere investigar las distancias de plantación para que las plántulas queden trasplantadas de forma vertical en el suelo, así como que la calidad de trabajo durante el trasplante en campo depende de factores que son ajenos a la máquina

  15. Role of BK virus infection in end-stage renal disease patients waiting for kidney transplantation--viral replication dynamics from pre- to post-transplant.

    Science.gov (United States)

    Mitterhofer, Anna Paola; Tinti, Francesca; Pietropaolo, Valeria; Umbro, Ilaria; Anzivino, Elena; Bellizzi, Anna; Zavatto, Assunta; Poli, Luca; Berloco, Pasquale Bartolomeo; Taliani, Gloria

    2014-03-01

    We report the prevalence of BK virus (BKV) infection before renal transplantation and the dynamics of BKV viremia from pre- to post-transplantation. We assessed 60 kidney transplanted patients from a single cohort in Italy, treated with identical immunosuppressive therapy, for BK viremia at pre-transplantation, 12 h, and three and six months post-transplantation. Polymerase chain reaction showed that the prevalence of plasma BKV replication--considered a marker of infection--was 20% in pre-transplant patients. All pre-transplant-positive patients remained positive post-transplant, whereas the majority of pre-transplant-negative patients remained negative. Viremia dynamics classification revealed three clusters of patients: Cluster A++, pre-transplant-positive patients (20%) who tested positive at least once post-transplant; Cluster B-+, pre-transplant-negative patients (28%) who tested positive at least once post-transplant; and Cluster C- -, pre-transplant-negative patients (52%) who remained negative throughout. These clusters presented significant differences related to the prevalence of substantially positive patients with high plasma viral load (>10(3) copies/mL) in cluster A, but not in donors' or grafts' characteristics. We suggest that pre-transplant viral status should be considered as an additional risk factor for post-transplant BKV replication. Therefore, pre-transplant BKV infection screening in kidney transplant patients should be performed for improving planning of personalized immunosuppressant schemes and specific post-transplant surveillance.

  16. Trasplante pulmonar Lung transplant

    Directory of Open Access Journals (Sweden)

    M. Espinosa

    2006-08-01

    Full Text Available El transplante pulmonar suele ser la última opción terapéutica para pacientes con insuficiencia respiratoria. A pesar de los muchos avances en inmunología y el manejo de las complicaciones, la mortalidad y morbilidad asociadas a este trasplante son muy superiores a los demás. El rechazo agudo es casi un problema universal en el primer año, mientras que la bronquiolitis obliterante limita la supervivencia a largo plazo. Las infecciones respiratorias también cumplen un papel importante en las complicaciones asociadas al trasplante pulmonar por la constante exposición del injerto al medio exterior. No obstante, los éxitos de esta opción terapéutica que depende fundamentalmente de una correcta selección de donante y receptor, son evidentes, sobre todo en cuanto a calidad de vida se refiere.A lung transplant is usually the final therapeutic option for patients with respiratory insufficiency. In spite of the many advances in immunology and the management of complications, mortality and morbidity associated with this transplant are far higher than with others. Acute rejection is an almost universal problem in the first year, while obliterative bronchitis reduces long term survival. Respiratory infections also play a significant role in the complications associated with lung transplants due to the constant exposure of the graft to the outside. However, the success of this therapeutic option, which basically depends on a suitable selection of donor and recipient, are evident, above all with respect to quality of life.

  17. Late post transplant HIV infection with BK viremia and allograft tuberculosis in a renal transplant recipient with Kaposi sarcoma

    OpenAIRE

    Viswanathan, V.; Kandasamy, V.; Reddy, Y. N.; Kurien, A.; Mathew, M.; Abraham, G

    2012-01-01

    In this report, we discuss a case of a 51-year-old African renal transplant who presented with metastatic Kaposi sarcoma 1 year after transplant. The Kaposi sarcoma was treated with a switch of immunosuppressants and chemotherapy. Six years after transplant, he presented with chronic allograft nephropathy, allograft tuberculosis, BK viremia, and was diagnosed to have contracted HIV infection.

  18. Trasplante hepático Liver transplantation

    OpenAIRE

    Herrero, J. I.; Pardo, F.; J. Quiroga; F. Rotellar

    2006-01-01

    El trasplante hepático es una opción terapéutica eficaz para las enfermedades hepáticas terminales. Las principales indicaciones del trasplante hepático son la cirrosis hepática, los tumores hepáticos (fundamentalmente, el hepatocarcinoma) y la insuficiencia hepática aguda grave. Con el paso de los años, las contraindicaciones absolutas para el trasplante se han ido reduciendo. La técnica quirúrgica también ha sufrido modificaciones. Los resultados del trasplante hepático han mejorado, de for...

  19. Trasplante óseo

    OpenAIRE

    San-Julian, M.; Valenti, A

    2006-01-01

    We describe the methodology of the Bone and Soft Tissue Bank, from extraction and storage until use. Since the year 1986, with the creation of the Bone Bank in the University Clinic of Navarra, more than 3,000 grafts have been used for very different types of surgery. Bone grafts can be classified into cortical and spongy; the former are principally used in surgery to save tumour patients, in large post-traumatic reconstructions and in replacement surgery where there a...

  20. Trasplante hepático Liver transplantation

    Directory of Open Access Journals (Sweden)

    J. I. Herrero

    2006-08-01

    Full Text Available El trasplante hepático es una opción terapéutica eficaz para las enfermedades hepáticas terminales. Las principales indicaciones del trasplante hepático son la cirrosis hepática, los tumores hepáticos (fundamentalmente, el hepatocarcinoma y la insuficiencia hepática aguda grave. Con el paso de los años, las contraindicaciones absolutas para el trasplante se han ido reduciendo. La técnica quirúrgica también ha sufrido modificaciones. Los resultados del trasplante hepático han mejorado, de forma que la supervivencia al año del trasplante está próxima al 90% y a los cinco años, un 80% de los pacientes trasplantados siguen vivos.Liver transplantation is an efficient therapeutic option for terminal hepatic diseases. The principal indications of liver transplantation are hepatic cirrhosis, hepatic tumours (mainly, hepotocellular carcinoma and acute liver failure. Over the years, the absolute contraindications for a transplant have lessened. Surgical techniques have also undergone changes. The results of liver transplant have improved so that survival one year after the transplant is close to 90% and after five years some 80% of transplanted patients continue to live.

  1. Trasplante renal: efectos en el perfil cognoscitivo

    Directory of Open Access Journals (Sweden)

    Sofía Sánchez-Román

    2010-07-01

    Full Text Available Objetivo. Valorar el impacto del Trasplante Renal exitoso sobre el funcionamiento cognoscitivo de los pacientes con Insuficiencia Renal Crónica (IRC. Método. Se aplicó el Neuropsi Atención y Memoria, el Hospital Anxiety and Depression Scale, la Escala de Somnolencia de Epworth y la Escala Isquémica de Hachinski a 42 pacientes con IRC y 41 donadores vivos sanos (grupo control. De los 42 pacientes que fueron sometidos a trasplante renal, se evaluó con los mismos instrumentos a 28 de ellos en un tiempo de 6 meses posterior a su trasplante. Se valoró en los mismos tiempos a sus donadores renales (grupo control. Resultados. El funcionamiento cognoscitivo global del grupo IRC mejoró después del trasplante renal aún controlando los efectos de aprendizaje. Las áreas en las que el grupo postrasplantado mejoraron fueron el Stroop y la evocación verbal a largo plazo haciendo uso de claves. Conclusiones. El trasplante renal se aprecia como una solución ideal que elimina factores (medibles o no medibles que están impactando en el funcionamiento cognoscitivo.

  2. Trasplante renal: efectos en el perfil cognoscitivo

    OpenAIRE

    Sofía Sánchez-Román; Feggy Ostrosky-Solís; Luis Eduardo Morales- Buenrostro; María Guadalupe Nogués-Vizcaíno; Josefina Alberú-Gómez

    2010-01-01

    Objetivo. Valorar el impacto del Trasplante Renal exitoso sobre el funcionamiento cognoscitivo de los pacientes con Insuficiencia Renal Crónica (IRC). Método. Se aplicó el Neuropsi Atención y Memoria, el Hospital Anxiety and Depression Scale, la Escala de Somnolencia de Epworth y la Escala Isquémica de Hachinski a 42 pacientes con IRC y 41 donadores vivos sanos (grupo control). De los 42 pacientes que fueron sometidos a trasplante renal, se evaluó con los mismos instrumentos a 28 de ellos en ...

  3. Developmental expression of BK channels in chick cochlear hair cells

    Directory of Open Access Journals (Sweden)

    Tong Mingjie

    2009-12-01

    Full Text Available Abstract Background Cochlear hair cells are high-frequency sensory receptors. At the onset of hearing, hair cells acquire fast, calcium-activated potassium (BK currents, turning immature spiking cells into functional receptors. In non-mammalian vertebrates, the number and kinetics of BK channels are varied systematically along the frequency-axis of the cochlea giving rise to an intrinsic electrical tuning mechanism. The processes that control the appearance and heterogeneity of hair cell BK currents remain unclear. Results Quantitative PCR results showed a non-monotonic increase in BK α subunit expression throughout embryonic development of the chick auditory organ (i.e. basilar papilla. Expression peaked near embryonic day (E 19 with six times the transcript level of E11 sensory epithelia. The steady increase in gene expression from E11 to E19 could not explain the sudden acquisition of currents at E18-19, implicating post-transcriptional mechanisms. Protein expression also preceded function but progressed in a sequence from diffuse cytoplasmic staining at early ages to punctate membrane-bound clusters at E18. Electrophysiology data confirmed a continued refinement of BK trafficking from E18 to E20, indicating a translocation of BK clusters from supranuclear to subnuclear domains over this critical developmental age. Conclusions Gene products encoding BK α subunits are detected up to 8 days before the acquisition of anti-BK clusters and functional BK currents. Therefore, post-transcriptional mechanisms seem to play a key role in the delayed emergence of calcium-sensitive currents. We suggest that regulation of translation and trafficking of functional α subunits, near voltage-gated calcium channels, leads to functional BK currents at the onset of hearing.

  4. Eventraciones post-trasplante renal: análisis de factores de riesgo y técnica quirúrgica / Post kidney transplantatios incisional hernia: risk factors analysis and surgical repair techniques

    Directory of Open Access Journals (Sweden)

    Santa Maria Victoria

    2015-11-01

    Full Text Available Several factors increase the risk of insicional hernias post-kidney transplantation and different surgical techniques exist for solving this problem. A retrospective study analyzing the risk factors for developing an insicional hernia and eventroplasties made in the kidney transplants performed between 2006-2013 was performed. The incidence of hernias was 12.7%. All elements studied were statistically independent of the appearance of hernias, probably by influence when combined together and not each separately. Consistent with the literature in which patients did not mesh was used or an absorbable mesh used had a recurrence of 100%. It should be more study of the risk factors that influence the development of post-transplant hernias because of the contradictions that arise from the literature. Post-transplant renal ventral hernia repair is safe and effective provided it is carried out for non-resorbable mesh. The risk of post-surgical infections does not appear to be affected by the use of mesh when the necessary precautions are taken, and if it does not change the prognosis.

  5. Trasplante de córnea Cornea transplant

    Directory of Open Access Journals (Sweden)

    A. Garralda

    2006-08-01

    Full Text Available La queratoplastia o trasplante de córnea es una de las técnicas quirúrgicas más antiguas de la oftalmología cuyas indicaciones son: 1 tectónicas, para preservar la anatomía e integridad corneal, 2 clínicas, para eliminar el tejido corneal inflamado en casos refractarios al tratamiento médico, 3 ópticas, para mejorar la agudeza visual y 4 cosméticas para mejorar el aspecto del ojo. El perfeccionamiento en la técnica y en el instrumental, así como en el tratamiento postoperatorio y en los medios de conservación del tejido donante han mejorado la supervivencia de los injertos realizados. El Modelo Pamplona de coordinación de trasplantes del Hospital Virgen del Camino (HVC está considerado como original y único en España, y en la logística de este programa se incluye el protocolo de detección y extracción de córneas así como el de queratoplastias.The keratoplasty, or corena transplant, is one of the oldest surgical techniques in opthalmology, whose indication are: 1 tectonic, in order to preserve corneal anatomy and integrity; 2 clinical, in order to eliminate the inflamed corneal tissue in cases refractory to medical treatment; 3 optical, in order to improve visual acuity; and 4 cosmetic, in order to improve the appearance of the eye. Improvements in technique and instruments, as well as in post-operative treatment and the means of preserving donated tissue, have improved survival of the grafts. The Pamplona Model of transplant coordination of the Virgen del Camino Hospital is considered to be original and unique in Spain. The logistics of this program include the protocol for detection and extraction of corneas as well as for keratoplasties.

  6. Silicosis y trasplante pulmonar Lung transplantation in silicosis

    OpenAIRE

    MARÍA TERESA PARADA C; VÍCTOR ALISTE C; RODRIGO GIL D; PATRICIO RODRÍGUEZ D; MAURICIO FICA D; CRISTINA HERZOG O; LORENA CALABRÁN R; ALVARO UNDURRAGA P

    2007-01-01

    La silicosis es una enfermedad prevalente en Chile, que es un país minero y en desarrollo. Existe escasa bibliografía sobre trasplante pulmonar, como alternativa de tratamiento en silicosis avanzada. Objetivo: Describir el tiempo y forma de exposición a la sílice y las características clínicas de enfermos silicóticos tratados con trasplante pulmonar en la Clínica Las Condes de Santiago. Pacientes y Métodos: De un total de 38 pacientes en los que se practicó trasplante pulmonar entre 1999 y 20...

  7. Series BK contactless DC motors

    Energy Technology Data Exchange (ETDEWEB)

    Buss, V.A.; Vevyurko, I.A.; Ivanov, G.V.; Kuzmin, V.N.; Mikhaylov, E.M.; Stoma, A.S.

    1985-05-01

    Implementation of principles described in a previous work has allowed development and introduction to series production of a motor series including 36 standard types and sizes. The series is designed to operate at a nominal voltage of 27 V and includes two main versions: the BK-1 for fans and BK-2 for pumps. The BK-2 motor differs from the BK-1 in that it has a thin sealed sleeve of high impedance nonmagnetic metal separating the rotor and stator cavities, allowing the rotor of the BK-2 to operate in the fluids or other media being pumped. Characteristics of the motors are presented. The BK-1316 has an operating life of about 50,000 hours at nominal speed of 6000 rpm. The experience of series production of the BK motors has shown the need for further improvement of the design and technology in order to decrease the number of metal cutting, winding and assembly operations required. The use of plastic structures is suggested to this end.

  8. BK channel modulators: a comprehensive overview

    DEFF Research Database (Denmark)

    Nardi, Antonio; Olesen, Søren-Peter

    2008-01-01

    and blockers 4) Marketed and/or investigational drugs with BK-modulating side properties and structural analogues 5) Naturally-occurring BK channel openers and structural analogues 6) Synthetic BK channel openers. This review is intended to provide readers with current opinion on the BK channel as a drug......The large Ca(2+)-activated K(+) channel (BK channel) reflects per excellence the dilemma of the molecular target driven drug discovery process. Significant experimental evidence suggests that the BK channels play a pivotal and specific role in many pathophysiological conditions supporting...... the notion that the channel represents an innovative and promising drug target. However, after more than ten years of intense research effort both in academia and industry, scientists have yet to witness the approval of a single BK channel modulator for clinical use. On the contrary, three BK openers...

  9. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  10. Certeza diagnóstica en la mortalidad de una población de pacientes con trasplante cardíaco

    Directory of Open Access Journals (Sweden)

    Marcos Amuchástegui

    2008-01-01

    Full Text Available RESUMENIntroducciónA pesar de que la morbimortalidad en el trasplante cardíaco ha sido motivo de extensoanálisis, la mayoría de los estudios y registros de mortalidad en pacientes trasplantados sebasan sobre datos clínicos. En la bibliografía existen comunicaciones aisladas de autopsiasen pacientes con trasplante cardíaco.ObjetivoDeterminar la importancia de la realización de estudios anatomopatológicos para el diagnósticode causa de muerte en un programa de trasplante cardíaco.Material y métodosSe incluyeron todos los pacientes con trasplante cardíaco fallecidos entre enero 1990 y enero2005. El diagnóstico definitivo de la causa de muerte fue corroborado por autopsia obiopsia de órgano sólido. Las causas de muerte evaluadas fueron falla precoz del injerto,rechazo celular, infección, enfermedad vascular del injerto, neoplasia y otros.ResultadosDurante el período en estudio 73 pacientes fueron sometidos a trasplante cardíaco; de ellos,fallecieron 31. Se obtuvieron 12 autopsias y 7 biopsias de órgano sólido que certificaron lacausa de muerte (61%. La causa de muerte más frecuente fue el rechazo celular mayor degrado III. En el 12,9%, la anatomía patológica difirió de la sospecha clínica de la causa demuerte.ConclusiónLa información clinicopatológica derivada de estudios post mortem es un indicador de nuestrarealidad asistencial y se constituye en un pilar fundamental para el conocimiento y elmanejo futuro de los pacientes trasplantados, por lo que consideramos que la realización deautopsias en estos pacientes es de vital importancia.REV ARGENT CARDIOL 2008;76:292-294.

  11. Certeza diagnóstica en la mortalidad de una población de pacientes con trasplante cardíaco

    Directory of Open Access Journals (Sweden)

    Marcos Amuchástegui (h,

    2006-01-01

    Full Text Available Introducción A pesar de que la morbimortalidad en el trasplante cardíaco ha sido motivo de extenso análisis, la mayoría de los estudios y registros de mortalidad en pacientes trasplantados se basan sobre datos clínicos. En la bibliografía existen comunicaciones aisladas de autopsias en pacientes con trasplante cardíaco.Objetivo Determinar la importancia de la realización de estudios anatomopatológicos para el diagnóstico de causa de muerte en un programa de trasplante cardíaco.Material y métodosSe incluyeron todos los pacientes con trasplante cardíaco fallecidos entre enero 1990 y enero 2005. El diagnóstico definitivo de la causa de muerte fue corroborado por autopsia o biopsia de órgano sólido. Las causas de muerte evaluadas fueron falla precoz del injerto, rechazo celular, infección, enfermedad vascular del injerto, neoplasia y otros.ResultadosDurante el período en estudio 73 pacientes fueron sometidos a trasplante cardíaco; de ellos, fallecieron 31. Se obtuvieron 12 autopsias y 7 biopsias de órgano sólido que certificaron la causa de muerte (61%. La causa de muerte más frecuente fue el rechazo celular mayor de grado III. En el 12,9%, la anatomía patológica difirió de la sospecha clínica de la causa de muerte.ConclusiónLa información clinicopatológica derivada de estudios post mortem es un indicador de nuestra realidad asistencial y se constituye en un pilar fundamental para el conocimiento y el manejo futuro de los pacientes trasplantados, por lo que consideramos que la realización de autopsias en estos pacientes es de vital importancia.

  12. Experiencia con micofenolato mofetil en el trasplante renal

    OpenAIRE

    Esteban de la Rosa, Rafael Jos??

    2001-01-01

    Micofenolato mofetil (MMF) es un potente inmunosupresor, libre de efecto nefrot??xico, eficaz en la prevencion de rechazo agudo y en la nefropatia cronica del trasplante renal. Bloquea la fase de sintesis sobre la estirpe linfocitaria a trav??s de inhibici??n selectiva, reversible y no competitiva de la enzima inosin-monofosfato-deshidrogenasa(IMPDH), clave en la biosintesis de novo de las purinas. OBJETIVOS:Se evaluaron tres grupos de trasplantados renales (TR) seg??n la terapia inmunosupres...

  13. B_K from improved staggered quarks

    OpenAIRE

    Gamiz, E.; Collins, S.; Davies, C. T. H.; Shigemitsu, J.; Wingate, M

    2004-01-01

    We compare calculations of B_K with improved staggered quarks (HYP, Asqtad) and demonstrate the improved scaling behaviour that this gives rise to over previous calculations with unimproved staggered quarks. This enables us to perform the calculation of B_K on the MILC dynamical configurations (n_f=2+1), for which we give preliminary results.

  14. BK channel activators and their therapeutic perspectives

    DEFF Research Database (Denmark)

    Bentzen, Bo Hjorth; Olesen, Søren-Peter; Rønn, Lars C B;

    2014-01-01

    The large conductance calcium- and voltage-activated K(+) channel (KCa1.1, BK, MaxiK) is ubiquitously expressed in the body, and holds the ability to integrate changes in intracellular calcium and membrane potential. This makes the BK channel an important negative feedback system linking increase...... years. After a short introduction to the structure, function and regulation of BK channels, we review the small organic molecules activating BK channels and how these tool compounds have helped delineate the roles of BK channels in health and disease.......The large conductance calcium- and voltage-activated K(+) channel (KCa1.1, BK, MaxiK) is ubiquitously expressed in the body, and holds the ability to integrate changes in intracellular calcium and membrane potential. This makes the BK channel an important negative feedback system linking increases...... in intracellular calcium to outward hyperpolarizing potassium currents. Consequently, the channel has many important physiological roles including regulation of smooth muscle tone, neurotransmitter release and neuronal excitability. Additionally, cardioprotective roles have been revealed in recent...

  15. Trasplante renal en pacientes con anticuerpos dirigidos contra donante

    Directory of Open Access Journals (Sweden)

    Federico Cicora

    2014-10-01

    Full Text Available En trasplante renal, los anticuerpos donante-específicos por ensayos de fase sólida predicen el rechazo temprano mediado por anticuerpos, incluso con resultados negativos de citometría de flujo o citotoxicidad dependiente del complemento. Aquí se describen los protocolos de inmunosupresión y los resultados a diez meses de cuatro pacientes en los que se detectó anticuerpos donante-específicos anti-antígenos leucocitarios humanos (HLA por Luminex®, pero no detectados por el método de citotoxicidad dependiente de complemento (CDC ni por citometría de flujo. Los cuatro pacientes recibieron tratamiento de inducción con 5 dosis de timoglobulina de 1.25 mg/kg y 5 dosis de inmunoglobulina intravenosa (IVIG de 400 mg/kg. Además, uno recibió 20 mg de basiliximab el mismo día del trasplante y el día 4 postrasplante; otro recibió 3 sesiones de plasmaféresis en los días -5, -3, y -1 y eculizumab en dosis de 1200 mg antes del trasplante, 900 mg el día 1, and 600 mg por semana durante un mes. En todos los casos, la inmunosupresión de mantenimiento consistió en tacrolimus, micofenolato y deltisona. Todos presentaron buenos resultados en el corto plazo. Nuestra experiencia sugiere que los pacientes con anticuerpos donante-específicos anti-HLA detectados solo por Luminex® deben recibir un seguimiento estricto y que en esta población se pueden obtener buenos resultados a partir del uso de terapia de inducción con timoglobulina e IVIG.

  16. Problemas psicológicos asociados al trasplante de órganos

    OpenAIRE

    María Ángeles Pérez San Gregorio; Agustín Martín Rodríguez; Antonio Galán Rodríguez

    2005-01-01

    El trasplante de órganos es una alternativa terapéutica para aquellos pacientes que tienen problemas graves en el funcionamiento de un órgano vital: corazón, hígado, pulmón, etc. Dada la relevancia de este tema, en el presente estudio teórico analizamos los principales problemas psicológicos asociados al trasplante de órganos. Concretamente, hemos tenido en cuenta los siguientes apartados: 1) Repercusiones psicológicas del trasplante de órganos en los pacientes: delirium, trast...

  17. Trasplante óseo Bone transplant

    Directory of Open Access Journals (Sweden)

    M. San Julián

    2006-08-01

    .We describe the methodology of the Bone and Soft Tissue Bank, from extraction and storage until use. Since the year 1986, with the creation of the Bone Bank in the University Clinic of Navarra, more than 3,000 grafts have been used for very different types of surgery. Bone grafts can be classified into cortical and spongy; the former are principally used in surgery to save tumour patients, in large post-traumatic reconstructions and in replacement surgery where there are massive bone defects and a structural support is required. The spongy grafts are the most used due to their numerous indications; they are especially useful in filling cavities that require a significant quantity of graft when the autograft is insufficient, or as a complement. They are also of special help in treating fractures when there is bone loss and in the treatment of delays in consolidation and pseudoarthrosis in little vascularized and atrophic zones. They are also used in prosthetic surgery against the presence of cavity type defects. Allografts of soft tissues are specially recognised in multiple ligament injuries that require reconstructions. Nowadays, the most utilised are those employed in surgery of the anterior cruciate ligament although they can be used for filling any ligament or tendon defect. The principal difficulties of the cortical allografts are in the consolidation of the ends with the bone itself and in tumour surgery, given that these are patients immunodepressed by the treatment, the incidence of infection is increased with respect to spongy grafts and soft tissues, which is irrelevant. In short, the increasingly widespread use of allografts is an essential therapeutic weapon in orthopaedic surgery and traumatology. It must be used by expert hands.

  18. BK nephropathy in the native kidneys of patients with organ transplants: Clinical spectrum of BK infection.

    Science.gov (United States)

    Vigil, Darlene; Konstantinov, Nikifor K; Barry, Marc; Harford, Antonia M; Servilla, Karen S; Kim, Young Ho; Sun, Yijuan; Ganta, Kavitha; Tzamaloukas, Antonios H

    2016-09-24

    Nephropathy secondary to BK virus, a member of the Papoviridae family of viruses, has been recognized for some time as an important cause of allograft dysfunction in renal transplant recipients. In recent times, BK nephropathy (BKN) of the native kidneys has being increasingly recognized as a cause of chronic kidney disease in patients with solid organ transplants, bone marrow transplants and in patients with other clinical entities associated with immunosuppression. In such patients renal dysfunction is often attributed to other factors including nephrotoxicity of medications used to prevent rejection of the transplanted organs. Renal biopsy is required for the diagnosis of BKN. Quantitation of the BK viral load in blood and urine are surrogate diagnostic methods. The treatment of BKN is based on reduction of the immunosuppressive medications. Several compounds have shown antiviral activity, but have not consistently shown to have beneficial effects in BKN. In addition to BKN, BK viral infection can cause severe urinary bladder cystitis, ureteritis and urinary tract obstruction as well as manifestations in other organ systems including the central nervous system, the respiratory system, the gastrointestinal system and the hematopoietic system. BK viral infection has also been implicated in tumorigenesis. The spectrum of clinical manifestations from BK infection and infection from other members of the Papoviridae family is widening. Prevention and treatment of BK infection and infections from other Papovaviruses are subjects of intense research.

  19. BK nephropathy in the native kidneys of patients with organ transplants: Clinical spectrum of BK infection

    Science.gov (United States)

    Vigil, Darlene; Konstantinov, Nikifor K; Barry, Marc; Harford, Antonia M; Servilla, Karen S; Kim, Young Ho; Sun, Yijuan; Ganta, Kavitha; Tzamaloukas, Antonios H

    2016-01-01

    Nephropathy secondary to BK virus, a member of the Papoviridae family of viruses, has been recognized for some time as an important cause of allograft dysfunction in renal transplant recipients. In recent times, BK nephropathy (BKN) of the native kidneys has being increasingly recognized as a cause of chronic kidney disease in patients with solid organ transplants, bone marrow transplants and in patients with other clinical entities associated with immunosuppression. In such patients renal dysfunction is often attributed to other factors including nephrotoxicity of medications used to prevent rejection of the transplanted organs. Renal biopsy is required for the diagnosis of BKN. Quantitation of the BK viral load in blood and urine are surrogate diagnostic methods. The treatment of BKN is based on reduction of the immunosuppressive medications. Several compounds have shown antiviral activity, but have not consistently shown to have beneficial effects in BKN. In addition to BKN, BK viral infection can cause severe urinary bladder cystitis, ureteritis and urinary tract obstruction as well as manifestations in other organ systems including the central nervous system, the respiratory system, the gastrointestinal system and the hematopoietic system. BK viral infection has also been implicated in tumorigenesis. The spectrum of clinical manifestations from BK infection and infection from other members of the Papoviridae family is widening. Prevention and treatment of BK infection and infections from other Papovaviruses are subjects of intense research. PMID:27683628

  20. BK Channels in the Vascular System.

    Science.gov (United States)

    Krishnamoorthy-Natarajan, G; Koide, M

    2016-01-01

    Autoregulation of blood flow is essential for the preservation of organ function to ensure continuous supply of oxygen and essential nutrients and removal of metabolic waste. This is achieved by controlling the diameter of muscular arteries and arterioles that exhibit a myogenic response to changes in arterial blood pressure, nerve activity and tissue metabolism. Large-conductance voltage and Ca(2+)-dependent K(+) channels (BK channels), expressed exclusively in smooth muscle cells (SMCs) in the vascular wall of healthy arteries, play a critical role in regulating the myogenic response. Activation of BK channels by intracellular, local, and transient ryanodine receptor-mediated "Ca(2+) sparks," provides a hyperpolarizing influence on the SMC membrane potential thereby decreasing the activity of voltage-dependent Ca(2+) channels and limiting Ca(2+) influx to promote SMC relaxation and vasodilation. The BK channel α subunit, a large tetrameric protein with each monomer consisting of seven-transmembrane domains, a long intracellular C-terminal tail and an extracellular N-terminus, associates with the β1 and γ subunits in vascular SMCs. The BK channel is regulated by factors originating within the SMC or from the endothelium, perivascular nerves and circulating blood, that significantly alter channel gating properties, Ca(2+) sensitivity and expression of the α and/or β1 subunit. The BK channel thus serves as a central receiving dock that relays the effects of the changes in several such concomitant autocrine and paracrine factors and influences cardiovascular health. This chapter describes the primary mechanism of regulation of myogenic response by BK channels and the alterations to this mechanism wrought by different vasoactive mediators. PMID:27238270

  1. BK equation and traveling wave solutions

    Energy Technology Data Exchange (ETDEWEB)

    De Santana Amaral, J.T.; Betemps, M.A.; Gay Ducati, M.B. [Univ Fed Rio Grande do Sul, Inst Fis, BR-91501 Porto Alegre, RS, (Brazil); Soyez, G. [CEA Saclay, DSM, SPhT, Serv Phys Theor Saclay, F-91191 Gif Sur Yvette, (France)

    2007-07-01

    It has been shown that the transition to the saturation regime of high energy QCD is similar to the formation of the front of a traveling wave. In particular, it can be verified that Balitsky-Kovchegov (BK) evolution equation reduces, after some approximations, to the nonlinear Fisher and Kolmogorov-Petrovsky-Piscounov (FKPP) equation, well-known from statistical physics. In these proceedings, based on the current knowledge of the asymptotic solutions of the BK equation, we propose a parametrization for the forward scattering amplitude which interpolates between the traveling wave solution and the saturation region. (authors)

  2. BK equation and traveling wave solutions

    Energy Technology Data Exchange (ETDEWEB)

    Santana Amaral, J.T. de; Betemps, M.A.; Ducati, M.B. Gay [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Inst. de Fisica; Soyez, G. [CEA Saclay, Gif-sur-Yvette (France). Direction des Sciences de la Matiere. Service de Physique Theorique

    2007-06-15

    It has been shown that the transition to the saturation regime of high energy QCD is similar to the formation of the front of a traveling wave. In particular, it can be verified that Balitsky-Kovchegov (BK) evolution equation reduces, after some approximations, to the nonlinear Fisher and Kolmogorov-Petrovsky-Piscounov (FKPP) equation, well-known from statistical physics. In these proceedings, based on the current knowledge of the asymptotic solutions of the BK equation, we propose a parametrization for the forward scattering amplitude which interpolates between the traveling wave solution and the saturation region. (author)

  3. Polyoma BK Virus: An Oncogenic Virus?

    Directory of Open Access Journals (Sweden)

    Syed Hassan

    2013-01-01

    Full Text Available We report a case of a 65-year-old gentleman with a history of end stage renal disease who underwent a successful cadaveric donor kidney transplant four years ago. He subsequently developed BK virus nephropathy related to chronic immunosuppressant therapy. Three years later, misfortune struck again, and he developed adenocarcinoma of the bladder.

  4. Evaluating the BK 21 Program. Research Brief

    Science.gov (United States)

    Seong, Somi; Popper, Steven W.; Goldman, Charles A.; Evans, David K.; Grammich, Clifford A.

    2008-01-01

    The Brain Korea 21 program (BK21), an effort to improve Korean universities and research, has attracted a great deal of attention in Korea, producing the need to understand how well the program is meeting its goals. RAND developed a logic model for identifying program goals and dynamics, suggested quantitative and qualitative evaluation methods,…

  5. Transient versus Persistent BK Viremia and Long-Term Outcomes after Kidney and Kidney–Pancreas Transplantation

    Science.gov (United States)

    Elfadawy, Nissreen; Schold, Jesse D.; Srinivas, Titte R.; Poggio, Emilio; Fatica, Richard; Avery, Robin; Mossad, Sherif B.

    2014-01-01

    Background and objectives The objective was to study the long-term impact of transient versus persistent BK viremia on kidney transplant outcomes. Design, setting, participants, & measurements In total, 609 recipients who underwent kidney transplant from 2007 to 2011 were screened at months 1–12 for the occurrence of polyomavirus BK viremia; 130 patients (21.7%) developed BK viremia during the first year post-transplant. BK viremia patients were classified according to duration of infection (more or less than 3 months), and BK viral loads (more or less than 10,000 copies/ml) were classified as transient low viremia (n=42), transient high viremia (n=18), persistent low viremia (n=23), and persistent high viremia (n=47). All patients were followed a median of 36 (3–66) months. The rates of BK polyomavirus–associated nephropathy, acute rejection, and 1-year graft function were compared with the polyomavirus BK–negative control group. Results Patient and graft survival were not significantly different among the groups. Graft function (creatinine; milligrams per deciliter) at 1 year was significantly worse in the persistent high viremia (1.75±0.6) and transient high viremia (1.85±0.7) groups compared with aviremic controls (1.47±0.4; P=0.01 and P=0.01, respectively). The incidence of BK polyomavirus–associated nephropathy was limited to the persistent high viremia group (1.3%, P<0.001). The transient high viremia (50%) and persistent high viremia (34%) groups showed significantly (P=0.01) increased incidence of acute rejection versus aviremic controls (21.5%), transient low viremia (19%), or persistent low viremia (17.3%) groups. Conclusion Low viral load BK viremia, either transient or persistent, was not associated with long-term transplant outcomes. Persistent high viremia was associated with a greater risk for BK polyomavirus–associated nephropathy and subsequent graft dysfunction. Although transient high viremia was not associated with BK

  6. Nuevas fronteras en el trasplante de progenitores hematopoyéticos: el trasplante de células de cordón umbilical, una realidad en el tratamiento de Pacientes Adultos con Leucemia

    OpenAIRE

    Sanz, Miguel A.

    2006-01-01

    Los continuos avances en el trasplante alogénico de progenitores hematopoyéticos no sólo han mejorado los resultados clínicos en una variedad de enfermedades malignas y no malignas, sino que también han ampliado las indicaciones de tales trasplantes.

  7. Nuevas fronteras en el trasplante de progenitores hematopoyéticos: el trasplante de células de cordón umbilical, una realidad en el tratamiento de Pacientes Adultos con Leucemia

    Directory of Open Access Journals (Sweden)

    Miguel A. Sanz

    2006-04-01

    Full Text Available Los continuos avances en el trasplante alogénico de progenitores hematopoyéticos no sólo han mejorado los resultados clínicos en una variedad de enfermedades malignas y no malignas, sino que también han ampliado las indicaciones de tales trasplantes.

  8. Silicosis y trasplante pulmonar Lung transplantation in silicosis

    Directory of Open Access Journals (Sweden)

    MARÍA TERESA PARADA C

    2007-06-01

    Full Text Available La silicosis es una enfermedad prevalente en Chile, que es un país minero y en desarrollo. Existe escasa bibliografía sobre trasplante pulmonar, como alternativa de tratamiento en silicosis avanzada. Objetivo: Describir el tiempo y forma de exposición a la sílice y las características clínicas de enfermos silicóticos tratados con trasplante pulmonar en la Clínica Las Condes de Santiago. Pacientes y Métodos: De un total de 38 pacientes en los que se practicó trasplante pulmonar entre 1999 y 2006, cuatro de ellos fueron trasplantados por padecer de silicosis avanzada. En estos 38 enfermos la fibrosis pulmonar idiopática fue la enfermedad subyacente predominante (55%. Resultados: Los 4 pacientes silicóticos fueron trasplantados a una edad que fluctuó entre 34 y 65 años. Su período de exposición varió entre 5 y 30 años y sus síntomas comenzaron a manifestarse 4 a 30 años después de iniciada la exposición. Dos pacientes eran mineros, otro trabajó en la molienda de cuarzo y el 4º enfermo fue pulidor de prótesis dentales. La cirugía fue compleja debido a la distorsión de la anatomía pulmonar de estos enfermos. La estadía hospitalaria fue más prolongada en los trasplantados silicóticos que en los no silicóticos (41 versus 21 días, p Silicosis is a prevalent disease in Chile, a developing miner country. Scarce information about lung transplantation as an alternative for treating severe silicosis is available. Objective: To describe the time and way of exposure to silica and the clinical characteristics of silicotic patients subjected to lung transplantation at Clinica Las Condes, Santiago. Patients and Methods: From 38 patients subjected to lung transplantation between 1999 and 2006, four of them were transplanted because of severe silicosis. Ldiopathic pulmonary fibrosis was the predominant underlying disease (55% of these 38 patients. Results: The four silicotic patients were transplanted at an age ranging from 34 to 65

  9. Viviendo con los pacientes el sueño del trasplante: una experiencia enfermera

    Directory of Open Access Journals (Sweden)

    Ana Julia Carrillo Algarra

    2014-06-01

    Full Text Available El trasplante renal puede ser una solución para personas que sufren insuficiencia renal crónica. Durante este proceso es de vital importancia el cuidado de enfermería en las diferentes etapas a las que el paciente y su familia se ven enfrentados. Este es el relato biográfico de una enfermera con amplia experiencia en el cuidado de pacientes que han vivido el trasplante renal, que describe diferentes aspectos que se deben tener en cuenta en la relación del equipo interdisciplinario, con el paciente y la familia; a través del mismo narra las vivencias y los sentimientos que afloran en el diario vivir de su labor y comenta su opinión respecto al futuro de la Enfermería en trasplantes.

  10. Exposing the Molecular Machinery of BK Polyomavirus.

    Science.gov (United States)

    Buck, Christopher B

    2016-04-01

    BK polyomavirus (BKV) is an opportunistic pathogen that poses a serious threat to organ transplant recipients. In this issue of Structure, Hurdiss and colleagues' (Hurdiss et al., 2016) beautiful new high-resolution cryo-EM reconstruction of BKV provides a structural roadmap for the ongoing development of therapeutic antibodies and vaccines targeting this potentially deadly virus. The study also serves as a platform for exploring the basic biology of virion assembly and infectious entry. PMID:27050683

  11. The H2BK123Rgument

    OpenAIRE

    Latham, John A.; Dent, Sharon Y. R.

    2009-01-01

    The discovery of trans-regulation of histone H3K4 methylation by ubiquitination of histone H2BK123 generated much excitement in the field of chromatin biology. Recently, the veracity of this example of cross talk between histone modifications in yeast was challenged (Foster and Downs, 2009. J. Cell Biol. doi:10.1083/jcb.200812088) but ultimately reconfirmed in a study in this issue (Nakanishi et al., 2009. J. Cell Biol. doi:10.1083/jcb.200906005).

  12. BIOÉTICA, TRASPLANTE DE ÓRGANOS Y DERECHO PENAL EN COLOMBIA

    OpenAIRE

    Guerra, Yolanda Margaux

    2014-01-01

    Este artículo presenta los lineamientos del Derecho Penal que trascienden los conceptos de trasplantes de órganos y las implicaciones Bioéticasde los mismos. Del mismo modo, se establecen algunos de los principales criterios relacionados con el debate bioético en torno al problema de laDonación y Trasplante de Órganos, problemas relacionados con temas como la Muerte Encefálica, el consentimiento informado, Justicia y Distribución, los Xenotrasplantes y la Clonación Embrionaria, entre otros. L...

  13. El Lung Allocation Score como modelo predictivo de morbimortalidad en el trasplante pulmonar

    OpenAIRE

    Ojanguren Arranz, Amaia

    2012-01-01

    CONTEXTO: El trasplante pulmonar es a día de hoy una alternativa terapéutica válida para los pacientes en insuficiencia respiratoria crónica. Actualmente las indicaciones superan con creces el número de órganos disponibles lo que genera tiempos de espera prolongados. En el año 2005 Estados Unidos implementó un sistema innovador para priorizar los candidatos de la lista de espera mediante un estimador que calcula el beneficio neto que supondría realizar un trasplante pulmonar. Para ello se rea...

  14. La economía de los trasplantes de organos: Los incentivos importan

    OpenAIRE

    Julio J. Elías

    2014-01-01

    El problema del faltante de órganos para trasplantes es grave en la mayoría de los países con programas desarrollados de trasplantes. En este ensayo resumo la investigación sobre el problema del faltante de órganos que desarrollamos de forma conjunta con Gary Becker de la Universidad de Chicago. Primero muestro la causa principal del faltante de órganos y el costo que impone el sistema actual sobre aquellos que esperan por un órgano. Luego presento una propuesta que desarrollamos con Gary Bec...

  15. El cuidado en un programa de trasplante renal: un acompañamiento de vida

    Directory of Open Access Journals (Sweden)

    Ana Julia Carrillo-Algarra

    2015-01-01

    Full Text Available Objetivo: comprender las experiencias de cuidado de enfermeras integrantes de grupos de trasplante de la ciudad de Bogotá. Materiales y métodos: investigación cualitativa, utilizó la estrategia de grupos focales; la organización y el análisis de datos siguieron la propuesta de codificación de Janice M. Morse; participaron, previo consentimiento informado, 10 de 20 enfermeras de unidades de trasplante. Se realizó triangulación entre las integrantes del equipo investigador y la literatura relevante. Resultados: emergieron 6 ca- tegorías: 1 los múltiples significados del trasplante: cambio, pasión, satisfacción, esperanza, libertad, mayor cercanía, responsabilidad, compromiso, complejidad; 2 las redes de apoyo: familia, asociación de enfermeras, grupo de trabajo interdisciplinario, empresas pro- motoras de salud, industria farmacéutica; 3 implicaciones del día a día: relación cercana con el paciente y la familia, fortalecimiento de la autoestima profesional, estatus dentro del grupo de trasplante, manejo de las cargas; 4 trayectorias del cuidado profesiona l: acom- pañamiento de la enfermera a través del ciclo vital del paciente y posibilidad de identificar necesidades por la estrecha relac ión con él; 5 el perfil de la enfermera: carácter, conocimiento, compromiso, disponibilidad permanente y capacidad de gestión; 6 contradi cciones del trasplante: rechazo al injerto, sufrimiento, desesperanza, sistema de salud; para enfermería, las agotadoras jornadas de tr abajo.

  16. Diabetes y trasplante de páncreas Diabetes and pancreas transplantation

    Directory of Open Access Journals (Sweden)

    E. Esmatjes Mompó

    2008-05-01

    Full Text Available La nefropatía es una grave y frecuente complicación de la diabetes, cuyo tratamiento, en una fase terminal, implica la necesidad de efectuar diálisis, y de ser posible, un trasplante renal. El trasplante simultáneo de riñón y páncreas se considera en la actualidad como el tratamiento de elección en los pacientes con diabetes mellitus tipo 1 e insuficiencia renal terminal si no existe una contraindicación. El trasplante de páncreas es un procedimiento complejo, inicialmente asociado a una mayor morbilidad que el trasplante de riñón aislado, pero con el que hoy en día se obtiene una buena supervivencia del paciente y de los injertos. Esto implica una total normalización del control metabólico, permitiendo que el paciente desarrolle una vida normal sin necesidad de administrarse insulina, con los consiguientes beneficios que todo ello tiene para su calidad de vida y para la evolución de las complicaciones de la enfermedad. El trasplante de páncreas aislado, ofrece unos resultados algo peores a los del trasplante combinado de páncreas y riñón. No obstante, son lo suficientemente satisfactorios como para que se considere como una buena opción de tratamiento en pacientes portadores de un trasplante de riñón previo. Otra cuestión, es el trasplante de páncreas aislado en pacientes diabéticos sin insuficiencia renal y no trasplantados de riñón previamente. A pesar que sería el trasplante ideal, hoy en día, quedaría restringido a pacientes con una diabetes lábil, que precisan de repetidos ingresos hospitalarios por descompensación metabólica y/o episodios hipoglicémicos severos que se acompañan de pérdida de conciencia.Kidney disease is a severe and frequent complication in diabetes. In the terminal phase, treatment requires dialysis and, if possible, kidney transplantation. Provided that there are no contraindications, simultaneous kidney/pancreas transplantation is currently considered the treatment of choice in

  17. Molecular networks involved in the immune control of BK polyomavirus.

    Science.gov (United States)

    Girmanova, Eva; Brabcova, Irena; Klema, Jiri; Hribova, Petra; Wohlfartova, Mariana; Skibova, Jelena; Viklicky, Ondrej

    2012-01-01

    BK polyomavirus infection is the important cause of virus-related nephropathy following kidney transplantation. BK virus reactivates in 30%-80% of kidney transplant recipients resulting in BK virus-related nephropathy in 1%-10% of cases. Currently, the molecular processes associated with asymptomatic infections in transplant patients infected with BK virus remain unclear. In this study we evaluate intrarenal molecular processes during different stages of BKV infection. The gene expression profiles of 90 target genes known to be associated with immune response were evaluated in kidney graft biopsy material using TaqMan low density array. Three patient groups were examined: control patients with no evidence of BK virus reactivation (n = 11), infected asymptomatic patients (n = 9), and patients with BK virus nephropathy (n = 10). Analysis of biopsies from asymptomatic viruria patients resulted in the identification of 5 differentially expressed genes (CD3E, CD68, CCR2, ICAM-1, and SKI) (P < 0.05), and functional analysis showed a significantly heightened presence of costimulatory signals (e.g., CD40/CD40L; P < 0.05). Gene ontology analysis revealed several biological networks associated with BKV immune control in comparison to the control group. This study demonstrated that asymptomatic BK viruria is associated with a different intrarenal regulation of several genes implicating in antiviral immune response.

  18. Molecular Networks Involved in the Immune Control of BK Polyomavirus

    Directory of Open Access Journals (Sweden)

    Eva Girmanova

    2012-01-01

    Full Text Available BK polyomavirus infection is the important cause of virus-related nephropathy following kidney transplantation. BK virus reactivates in 30%–80% of kidney transplant recipients resulting in BK virus-related nephropathy in 1%–10% of cases. Currently, the molecular processes associated with asymptomatic infections in transplant patients infected with BK virus remain unclear. In this study we evaluate intrarenal molecular processes during different stages of BKV infection. The gene expression profiles of 90 target genes known to be associated with immune response were evaluated in kidney graft biopsy material using TaqMan low density array. Three patient groups were examined: control patients with no evidence of BK virus reactivation (n=11, infected asymptomatic patients (n=9, and patients with BK virus nephropathy (n=10. Analysis of biopsies from asymptomatic viruria patients resulted in the identification of 5 differentially expressed genes (CD3E, CD68, CCR2, ICAM-1, and SKI (P<0.05, and functional analysis showed a significantly heightened presence of costimulatory signals (e.g., CD40/CD40L; P<0.05. Gene ontology analysis revealed several biological networks associated with BKV immune control in comparison to the control group. This study demonstrated that asymptomatic BK viruria is associated with a different intrarenal regulation of several genes implicating in antiviral immune response.

  19. Immunobiology of renal transplant Inmunología del trasplante renal historia de los trasplantes y del complejo mayor de histocompatibilidad

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1990-02-01

    Full Text Available

    This article reviews the development of organ transplantation from the early beginning when fiction and superstition prevailed, to the current times when, with the participation of surgeons, oncologists, geneticists and immunologists, the concept of the Major Histocompatibility Complex was developed and later on the complexity of these markers was worked out and was used to match Donors and Recipients thus making transplants feasible. Hopefully molecular biology will help to open a new era in transplantation to make this form of therapy more reliable and safely applicable to other organs.

    En este artículo se revisa el desarrollo de los trasplantes de órganos desde los primeros tiempos cuando prevalecían la ficción y la superstición, hasta la actualidad cuando, con la participación secuencial y sistemática de cirujanos, oncólogos, geneticistas e inmunólogos se descubrió el Complejo Mayor de Histocompatibilidad y más tarde se redujo la complejidad de estos marcadores hasta poderlos utilizar para el apareamiento Donador/Receptor y aumentar el éxito del trasplante. Se espera que la biología molecular ayude a abrir una nueva era en esta área para mejorar la eficiencia de esta forma de terapia y ampliar su uso a otros órganos.

  20. Polyomavirus BK infection in blood and marrow transplant recipients

    OpenAIRE

    Dropulic, LK; Jones, RJ

    2007-01-01

    The association of BK virus infection with hemorrhagic cystitis in blood and marrow transplant (BMT) recipients was first demonstrated two decades ago. During this time, therapeutic interventions focused on supportive measures such as hyperhydration, continuous bladder irrigation and topical administration of agents that alter the mucosal surface of the bladder wall. In recent years, PCR amplification of viral DNA in the urine and plasma has solidified the association of BK virus infection wi...

  1. Polyomavirus specific cellular immunity: from BK-virus-specific cellular immunity to BK-virus-associated nephropathy ?

    Directory of Open Access Journals (Sweden)

    manon edekeyser

    2015-06-01

    Full Text Available In renal transplantation, BK-virus-associated nephropathy has emerged as a major complication, with a prevalence of 5–10% and graft loss in >50% of cases. BK-virus is a member of the Polyomavirus family and rarely induces apparent clinical disease in the general population. However, replication of polyomaviruses, associated with significant organ disease, is observed in patients with acquired immunosuppression, which suggests a critical role for virus-specific cellular immunity to control virus replication and prevent chronic disease. Monitoring of specific immunity combined with viral load could be used to individually assess the risk of viral reactivation and virus control. We review the current knowledge on BK-virus specific cellular immunity and, more specifically, in immunocompromised patients. In the future, immune-based therapies could allow us to treat and prevent BK-virus-associated nephropathy.

  2. BK polyomavirus association with colorectal cancer development.

    Science.gov (United States)

    Khabaz, M N; Nedjadi, T; Gari, M A; Al-Maghrabi, J A; Atta, H M; Basuni, A A; Elderwi, D A

    2016-01-01

    The development of human neoplasms can be provoked by exposure to one of several viruses. Burkitt lymphoma, cervical carcinoma, and hepatocellular carcinoma are associated with Epstein-Barr, human papilloma, and hepatitis B virus infections, respectively. Over the past three decades, many studies have attempted to establish an association between colorectal cancer and viruses, with debatable results. The aim of the present research was to assess the presence of BK polyomavirus (BKV) DNA and protein in colorectal cancer samples from patients in the Western Province of Saudi Arabia. DNA extracted from archival samples of colorectal cancer tissues was analyzed for BKV sequences using polymerase chain reaction (PCR)-based techniques. In addition, expression of a BKV protein was assessed using immunohistochemical staining. None of the tumor and control samples examined tested positive for BKV DNA in PCR assays. Furthermore, immunohistochemical staining failed to detect viral proteins in both cancer and control specimens. These results may indicate that BKV is not associated with the development of colorectal adenocarcinoma in patients in the Western Province of Saudi Arabia. PMID:27173319

  3. Impact of dietary intake and nutritional status on outcomes after liver transplantation Efecto de la ingesta y del estado nutricional en el trasplante hepático

    Directory of Open Access Journals (Sweden)

    D. A. de Luis

    2006-01-01

    nutritional status and dietary intake. Nutritional parameters showed no association with outcomes after liver transplantation. Liver transplantation improved serum protein levels and did not modify weight or dietary intake. Further studies are needed to clarify the role of liver transplantation on nutritional status and of nutritional status on liver transplantation outcomes, considering different populations of patients.Objetivo: el objetivo de nuestro estudio fue examinar de una manera prospectiva si la situación nutricional y la ingesta dietética pueden influir en los resultados del postrasplante hepático. Material y pacientes: se realizó una valoración nutricional basal y a los 6 meses en 31 pacientes consecutivos que fueron sometidos a trasplante hepático ortotópico (THO, en el Hospital U. Río Hortega. La evaluación nutricional incluyó el test de valoración subjetiva global (VSG, el test mininutritional assessment (MNA, antropometría convencional, analítica sérica y una encuesta nutricional de 3 días. Resultados: los pacientes tuvieron una edad media de 56,2 ± 8,11 años, peso (72,9 ± 15,3 kg e índice de masa corporal de (26,6 ± 4,1. La valoración antropométrica mostró los siguientes datos: pliegue tricipital 12,2 ± 6,1 mm, circunferencia muscular del brazo 24,5 ± 4,1 cm, masa libre de grasa 54,5 ± 10,9 kg, masa grasa 18,4 ± 6,5 mm y agua corporal 41,4 ± 9,1 kg. Tras seis meses del trasplante estos parámetros permanecieron inalterados. La ingesta calórica fue similar en el pre- y post-trasplante (28.1 ± 6 vs. 27,5 ± 5,8 kcal/kg: ns. Los niveles séricos de albúmina, prealbúmina y transferrina mejoraron a los 6 meses. La estancia media hospitalaria fue de 22,4 ± 14,9 días y la estancia en cuidados intensivos de 0,7 ± 1,7 días. EL estado nutricional determinado por los tests VSG y MNA no influyó en las estancias. Dos pacientes fallecieron tras el trasplante hepático (6,5% y 3 tuvieron rechazo agudo (9,6%. El estado nutricional

  4. BK channels reveal novel phosphate sensitivity in SNr neurons.

    Directory of Open Access Journals (Sweden)

    Juan Juan Ji

    Full Text Available Whether large conductance Ca(2+-activated potassium (BK channels are present in the substantia nigra pars reticulata (SNr is a matter of debate. Using the patch-clamp technique, we examined the functional expression of BK channels in neurons of the SNr and showed that the channels were activated or inhibited by internal high-energy phosphates (IHEPs at positive and negative membrane potentials, respectively. SNr neurons showed membrane potential hyperpolarization under glucose-deprivation conditions which was attenuated by paxilline, a specific BK channel blocker. In addition, Fluo-3 fluorescence recording detected an increase in the level of internal free calcium ([Ca(2+](i during ischemic hyperpolarization. These results confirm that BK channels are present in SNr neurons and indicate that their unique IHEP sensitivity is requisite in neuronal ischemic responses. Bearing in mind that the K(ATP channel blocker tolbutamide also attenuated the hyperpolarization, we suggest that BK channels may play a protective role in the basal ganglia by modulating the excitability of SNr neurons along with K(ATP channels under ischemic stresses.

  5. Coronary arterial BK channel dysfunction exacerbates ischemia/reperfusion-induced myocardial injury in diabetic mice.

    Science.gov (United States)

    Lu, Tong; Jiang, Bin; Wang, Xiao-Li; Lee, Hon-Chi

    2016-09-01

    The large conductance Ca(2+)-activated K(+) (BK) channels, abundantly expressed in coronary artery smooth muscle cells (SMCs), play a pivotal role in regulating coronary circulation. A large body of evidence indicates that coronary arterial BK channel function is diminished in both type 1 and type 2 diabetes. However, the consequence of coronary BK channel dysfunction in diabetes is not clear. We hypothesized that impaired coronary BK channel function exacerbates myocardial ischemia/reperfusion (I/R) injury in streptozotocin-induced diabetic mice. Combining patch-clamp techniques and cellular biological approaches, we found that diabetes facilitated the colocalization of angiotensin II (Ang II) type 1 receptors and BK channel α-subunits (BK-α), but not BK channel β1-subunits (BK-β1), in the caveolae of coronary SMCs. This caveolar compartmentation in vascular SMCs not only enhanced Ang II-mediated inhibition of BK-α but also produced a physical disassociation between BK-α and BK-β1, leading to increased infarct size in diabetic hearts. Most importantly, genetic ablation of caveolae integrity or pharmacological activation of coronary BK channels protected the cardiac function of diabetic mice from experimental I/R injury in both in vivo and ex vivo preparations. Our results demonstrate a vascular ionic mechanism underlying the poor outcome of myocardial injury in diabetes. Hence, activation of coronary BK channels may serve as a therapeutic target for cardiovascular complications of diabetes. PMID:27574914

  6. Mecanismos sociales de coordinación en el Sistema Español de Trasplantes

    Directory of Open Access Journals (Sweden)

    Carmen De Pablos Heredero

    2013-01-01

    Full Text Available El proceso de donación de órganos es complejo y demanda de un conjunto de recursos muy especializados e interconectados que operan con altas restricciones de tiempos. El presente trabajo analiza desde las perspectivas organizativas y sociales el Sistema Nacional de Trasplantes. Por medio de una metodología cualitativa basada en el desarrollo de un análisis Delphi, se presenta y describe el complejo sistema de donación de órganos, a continuación se analizan los factores de éxito del sistema de gestión. Se muestra como los mecanismos de coordinación intrahospitalarios, que promueven los hospitales, así como los extra hospitalarios que facilita la Organización Nacional de Trasplantes, posibilitan la colaboración y el consenso que se requieren para conseguir los resultados exitosos que hacen del modelo español un referente mundial. Los resultados apuntan que se dan un conjunto de elementos de gestión que constituyen factores críticos de éxito en el sistema, como las competencias de coordinación que desarrollan por un lado la Organización de Trasplantes y por otro los coordinadores hospitalarios en materia de donación de órganos, factores como la formación a los especialistas, la sensibilización hacia la importancia de la donación, la gestión y el control de la información y la dualidad en el perfil de los coordinadores constituyen los pilares básicos de este sistema excelente.

  7. Data of evolutionary structure change: 1BK9A-2QOGD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BK9A-2QOGD 1BK9 2QOG A D SLIQFETLIMKVAKKSGMFWYSNYGCYCGWGGQGRPQDA...TDRCCFVHDCCYGKVTGCDPKMDVYSFSEENGDIVCGGDDPCKKEICECDRAAAICFRDNLTLYNDKKYWAFGAKNCPQEESEPC SLLQFNKMI.../pdbChain> 2QOGD LSTYK-NEYMF

  8. Urinary BK virus excretion in children newly diagnosed with acute lymphoblastic leukemia

    Directory of Open Access Journals (Sweden)

    Nahid Raeesi

    2012-01-01

    Conclusion: To demonstrate the role of BK virus in inducing ALL or increasing the number of relapses, prospective studies on larger scale of population and evaluating both serum and urine for BK virus are recommended.

  9. Genetic activation of BK currents in vivo generates bidirectional effects on neuronal excitability.

    Science.gov (United States)

    Montgomery, Jenna R; Meredith, Andrea L

    2012-11-13

    Large-conductance calcium-activated potassium channels (BK) are potent negative regulators of excitability in neurons and muscle, and increasing BK current is a novel therapeutic strategy for neuro- and cardioprotection, disorders of smooth muscle hyperactivity, and several psychiatric diseases. However, in some neurons, enhanced BK current is linked with seizures and paradoxical increases in excitability, potentially complicating the clinical use of agonists. The mechanisms that switch BK influence from inhibitory to excitatory are not well defined. Here we investigate this dichotomy using a gain-of-function subunit (BK(R207Q)) to enhance BK currents. Heterologous expression of BK(R207Q) generated currents that activated at physiologically relevant voltages in lower intracellular Ca(2+), activated faster, and deactivated slower than wild-type currents. We then used BK(R207Q) expression to broadly augment endogenous BK currents in vivo, generating a transgenic mouse from a circadian clock-controlled Period1 gene fragment (Tg-BK(R207Q)). The specific impact on excitability was assessed in neurons of the suprachiasmatic nucleus (SCN) in the hypothalamus, a cell type where BK currents regulate spontaneous firing under distinct day and night conditions that are defined by different complements of ionic currents. In the SCN, Tg-BK(R207Q) expression converted the endogenous BK current to fast-activating, while maintaining similar current-voltage properties between day and night. Alteration of BK currents in Tg-BK(R207Q) SCN neurons increased firing at night but decreased firing during the day, demonstrating that BK currents generate bidirectional effects on neuronal firing under distinct conditions.

  10. Genética de las complicaciones del trasplante de Células Madre Hematopoyéticas

    OpenAIRE

    José Domingo Torres Hernández

    2006-01-01

    El trasplante de células madre hematipoyéticas (TCMH) se efectúa cada vez con mayor frecuencia puesto que en muchas ocasiones es la única alternativa de tratamiento con posibilidad de curación en algunos desórdenes hematológicos.

  11. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis.

    Science.gov (United States)

    Wen, Donghai; Cornelius, Ryan J; Sansom, Steven C

    2014-04-01

    Large conductance, Ca-activated K channels (BK) are abundantly located in cells of vasculature, glomerulus, and distal nephron, where they are involved in maintaining blood volume, blood pressure, and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertension, and compromised K handling. The BK-α/β4 resides in acid/base transporting intercalated cells (IC) of the distal nephron, where they mediate K secretion in mammals on a high K, alkaline diet. BK-α expression in IC is increased by a high K diet via aldosterone. The BK-β4 subunit and alkaline urine are necessary for the luminal expression and function of BK-α in mouse IC. In distal nephron cells, membrane BK-α expression is inhibited by WNK4 in in vitro expression systems, indicating a role in the hyperkalemic phenotype in patients with familial hyperkalemic hypertension type 2 (FHHt2). β1KO and BK-β4 knockout mice (β4KO) are hypertensive because of exaggerated epithelial Na channels (ENaC) mediated Na retention in an effort to secrete K via only renal outer medullary K channels (ROMK). BK hypertension is resistant to thiazides and furosemide, and would be more amenable to ENaC and aldosterone inhibiting drugs. Activators of BK-α/β1 or BK-α/β4 might be effective blood pressure lowering agents for a subset of hypertensive patients. Inhibitors of renal BK would effectively spare K in patients with Bartter Syndrome, a renal K wasting disease. PMID:24721651

  12. [BK virus infection in a pediatric renal transplant recipient].

    Science.gov (United States)

    Bonaventura, R; Vázquez, A; Exeni, A; Rivero, K; Freire, M C

    2005-01-01

    BK Human Polyomavirus causes an asymptomatic primary infection in children, then establishing latency mainly in the urinary tratt. Viral reactivation can lead to renal pathology in individuals with impaired cellular immune response. This is particularly important in pediatric transplant recipients, who can suffer a primary infection when immunosupressed. We followed up the case of a 5 years old patient who received a renal transplant in October 2003, and presented damaged graft 45 days after the intervention. The patient suffered 3 episodes of renal function failure between October 2003 and June 2004. Blood, urine, renal biopsy and lymphocele liquid samples were analyzed. A differential diagnosis between acute rejection and infectious causes was established by testing for BK, CMV and ADV viruses, and the cytological study of renal tissue. Laboratory findings together with clinical signs suggest the patient was infected by BK virus. As a final consideration, the great importance of differentiating between acute rejection and BK infection is emphasized, since immunosuppressant management is opposite in each case.

  13. Diffuse gastrointestinal bleeding and BK polyomavirus replication in a pediatric allogeneic haematopoietic stem cell transplant patient.

    Science.gov (United States)

    Koskenvuo, M; Lautenschlager, I; Kardas, P; Auvinen, E; Mannonen, L; Huttunen, P; Taskinen, M; Vettenranta, K; Hirsch, H H

    2015-01-01

    Patients undergoing haematopoietic stem cell transplantation (HSCT) are at high risk of severe gastrointestinal bleeding caused by infections, graft versus host disease, and disturbances in haemostasis. BK polyomavirus (BKPyV) is known to cause hemorrhagic cystitis, but there is also evidence of BKV shedding in stool and its association with gastrointestinal disease. We report putative association of BKPyV replication with high plasma viral loads in a pediatric HSCT patient developing hemorrhagic cystitis and severe gastrointestinal bleeding necessitating intensive care. The observation was based on chart review and analysis of BKPyV DNA loads in plasma and urine as well as retrospective BKPyV-specific IgM and IgG measurements in weekly samples until three months post-transplant. The gastrointestinal bleeding was observed after a >100-fold increase in the plasma BKPyV loads and the start of hemorrhagic cystitis. The BKPyV-specific antibody response indicated past infection prior to transplantation, but increasing IgG titers were seen following BKPyV replication. The gastrointestinal biopsies were taken at a late stage of the episode and were no longer informative of BK polyomavirus involvement. In conclusion, gastrointestinal complications with bleeding are a significant problem after allogeneic HSCT to which viral infections including BKPyV may contribute. PMID:25542476

  14. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis

    Science.gov (United States)

    Wen, Donghai; Cornelius, Ryan J.; Sansom, Steven C.

    2014-01-01

    Large conductance, Ca-activated K channels are abundantly located in cells of vasculature, glomerulus and distal nephron, where they are involved in maintaining blood volume, blood pressure and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertension, and compromised K handling. The BK-α/β4resides in acid/base transporting intercalated cells (IC) of the distal nephron, where they mediate K secretion in mammals on a high K, alkaline diet. BK-α expression in IC is increased by a high K diet via aldosterone. The BK-β4 subunit and alkaline urine are necessary for the luminal expression and function of BK-α in mouse IC. In distal nephron cells, membrane BK-α expression is inhibited by WNK4 in in vitro expression systems, indicating a role in the hyperkalemic phenotype in patients with familial hyperkalemic hypertension type 2 (FHHt2). β1KO and BK-β4 knockout mice (β4KO) are hypertensive because of exaggerated ENaC-mediated Na retention in an effort to secrete K via only ROMK. BK hypertension is resistant to thiazides and furosemide, and would be more amenable to ENaC and aldosterone inhibiting drugs. Activators of BK-α/β1 or BK-α/β4 might be effective blood pressure lowering agents for a subset of hypertensive patients. Inhibitors of renal BK would effectively spare K in patients with Bartter Syndrome, a renal K wasting disease. PMID:24721651

  15. Diarrea aguda en trasplantes renales y reno-pancreáticos

    Directory of Open Access Journals (Sweden)

    Alberto A Carena

    2015-02-01

    Full Text Available La diarrea es una complicación frecuente y potencialmente grave del trasplante renal. Se describen aquí, en un estudio de corte transversal, las características epidemiológicas y microbiológicas de la diarrea aguda y persistente en pacientes internados con trasplante renal o reno-páncreas. Se incluyeron 52 pacientes internados en un hospital de la Ciudad de Buenos Aires, 42 (80.8% habían recibido un trasplante renal y 10 (19.2% reno-páncreas. La diarrea fue el motivo de ingreso en 34 casos (65.4%. La etiología de la diarrea pudo estudiarse en 50 pacientes: en 25 (50% no se arribó a un diagnóstico etiológico y en 18 (36% se constató diarrea con causa microbiológica específica: 3 (6% enfermedad por citomegalovirus, 6 (12% diarrea atribuida a citomegalovirus, 5 (10% a rotavirus y 4 (8% a Clostridium difficile. En 7 (14% la diarrea fue atribuida a fármacos (mofetil micofenolato y sirolimus. Aquellos con diarrea con causa microbiológica habían recibido recientemente inmunosupresores a altas dosis con mayor frecuencia que el resto (p = 0.048. Los pacientes con diarrea atribuida a fármacos recibían más frecuentemente mofetil micofenolato (p = 0.039. En 16 (30.8% se realizaron modificaciones de los inmunosupresores como medida terapéutica, y a 47 (90.4% se les indicó antibioticoterapia empírica. La mediana de duración de internación fue de 6 días y 7 pacientes (14.6% persistieron con diarrea al quinto día. Todos tuvieron resolución de la diarrea al alta y un tercio persistió con insuficiencia renal. La información de este estudio puede servir para mejorar las medidas preventivas, diagnósticas y terapéuticas en estos pacientes.

  16. Trasplante de progenitores hemopoyéticos Transplant of hemopoietic progenitors

    Directory of Open Access Journals (Sweden)

    J. J. Rifón

    2006-08-01

    Full Text Available En la segunda mitad del siglo XX el trasplante de progenitores hemopoyéticos ha pasado de ser un tratamiento desesperado con una alta incidencia de complicaciones que implicaba una elevada mortalidad, a ser un tratamiento curativo para miles de pacientes con neoplasias hematológicas y otras enfermedades. Desde entonces se han ampliado los conocimientos sobre las células madre hemopoyéticas, la sangre periférica ha sustituido a la médula ósea como fuente de progenitores, la sangre de cordón se ha establecido como fuente viable de progenitores, la realización de trasplantes no emparentados es una realidad para muchos pacientes. La mejora en los regímenes de acondicionamiento y la introducción de los regímenes no mieloablativos han disminuido las recaídas. Las nuevas técnicas diagnósticas y los nuevos tratamientos antimicrobianos han disminuido las complicaciones infecciosas y su mortalidad. Se han desarrollado los conocimientos en determinación de enfermedad mínima residual y el efecto antitumoral de los linfocitos del donante lo que ha permitido ampliar las indicaciones. Además, los nuevos conocimientos en la inmunobiología del trasplante han mejorado por un lado las opciones de controlar una de las principales complicaciones como es la enfermedad injerto contra huésped, y por otro un mejor aprovechamiento del efecto inmunoterápico del trasplante.In the second half of the XX century, the transplant of hemopoietic progenitors ceased to be a desperate treatment with a high incidence of complications implying a high mortality, and became a curative treatment for thousands of patients with hematological neoplasias and other diseases. Since then understanding of the hemopoietic stem cells has increased, peripheral blood has replaced bone marrow as a source of progenitors, cord blood has been established as a viable source of progenitors and the realisation of unrelated transplants is a reality for many patients. The improvement of

  17. Pilot conversion trial from mycophenolic acid to everolimus in ABO-incompatible kidney-transplant recipients with BK viruria and/or viremia.

    Science.gov (United States)

    Belliere, Julie; Kamar, Nassim; Mengelle, Catherine; Allal, Asma; Sallusto, Federico; Doumerc, Nicolas; Game, Xavier; Congy-Jolivet, Nicolas; Esposito, Laure; Debiol, Benedicte; Rostaing, Lionel

    2016-03-01

    Immunosuppression using everolimus (EVR) plus low-dose tacrolimus (Tac) is commonly used in organ transplantation. EVR has potential antiviral effects. Herein, the long-term outcomes and impacts of Tac-EVR on the BK virus are reported in ABO-incompatible kidney-transplant recipients. The initial immunosuppressive regimen combined steroids, Tac, and mycophenolic acid (MPA). At a median of 141 (34-529) days post-transplantation, seven stable ABO-incompatible kidney-transplant recipients were converted from MPA to EVR because of active BK replication, and compared with a reference group of fourteen ABO-incompatible patients receiving classical Tac plus MPA. At 1 month before conversion, at 1, 3 months after, and at last follow-up, clinical and biological parameters were monitored. The median time from conversion to the last follow-up was 784 (398-866) days. Conversion to EVR caused no change to rejection episodes or immunological status (isoagglutinin titers, anti-HLA antibodies). At last follow-up, median eGFR was similar in the Tac-MPA versus Tac-EVR group (40 [range: 14-56] vs. 54.5 ml/min/1.73 m(2) [range: 0-128], P = 0.07). The major adverse event was dyslipidemia. Interestingly, conversion from MPA to EVR decreased BK viral load in five patients. ABO-incompatible kidney-transplant recipients with an active BK virus infection may benefit from conversion to EVR. PMID:26575959

  18. BK-parameter from Nf=2 twisted mass lattice QCD

    International Nuclear Information System (INIS)

    We present an unquenched Nf = 2 lattice computation of the BK parameter which controls K0- anti K0 oscillations. A partially quenched setup is employed with two maximally twisted dynamical (sea) light Wilson quarks, and valence quarks of both the maximally twisted and the Osterwalder-Seiler variety. Suitable combinations of these two kinds of valence quarks lead to a lattice definition of the BK parameter which is both multiplicatively renormalizable and O(a) improved. Employing the non-perturbative RI-MOM scheme, in the continuum limit and at the physical value of the pion mass we get BRGIK=0.729±0.030, a number well in line with the existing quenched and unquenched determinations. (orig.)

  19. Urological management (medical and surgical) of BK-virus associated haemorrhagic cystitis in children following haematopoietic stem cell transplantation

    OpenAIRE

    Nikhil Vasdev; Angela Davidson; Christian Harkensee; Mary Slatter; Andrew Gennery; Ian Willetts; Andrew Thorpe

    2013-01-01

    Aim: Haemorrhagic cystitis (HC) is uncommon and in its severe form potentially life threatening complication of Haematopoietic stem cell transplantation (HSCT) in children. We present our single centre experience in the urological management of this clinically challenging condition. Patients and Methods: Fourteen patients were diagnosed with BK-Virus HC in our centre. The mean age at diagnosis was 8.8 years (range, 3.2-18.4 years). The mean number of days post-BMT until onset of HC was 20.8 (...

  20. Tumores malignos de novo en el trasplante hepático experiencia de un centro en la Argentina

    Directory of Open Access Journals (Sweden)

    Florencia Antinucci

    2015-02-01

    Full Text Available El objetivo del presente trabajo ha sido evaluar la incidencia y las características clínicas de los tumores aparecidos de novo en los pacientes sometidos a trasplante hepático, como así también su supervivencia. Para ello, analizamos en forma retrospectiva los 168 trasplantes hepáticos realizados en 159 pacientes adultos en el período mayo 2006 hasta mayo 2014, encontrando una incidencia de neoplasia de novo de 7.5% (n = 12. La edad media en el momento del diagnóstico fue de 63 ± 7 años. Las neoplasias más frecuentes fueron las de piel no melanoma y adenocarcinomas. El 50% de las neoplasias se desarrollaron en el segundo y tercer año postrasplante. El tipo de inmunosupresión no influyó en el tipo de tumor; sin embargo, debemos destacar que la mayor parte de los pacientes recibieron tacrolimus, micofenolato y/o corticoides. El tiempo medio de seguimiento tras el diagnóstico del tumor fue 25 ± 29 meses (0-76, y la tasa de mortalidad fue de un 41% (5/12 pacientes IC95%,15-72.La supervivencia global luego del trasplante a 1 y 5 años, calculada por análisis de Kaplan-Meier, fue de 83 y 55%, respectivamente. Los tumores de novo son frecuentes luego del trasplante hepático y presentan un patrón evolutivo diferente al de la población general. Teniendo en cuenta esta evolución más agresiva, es fundamental el seguimiento periódico en estos pacientes para realizar un diagnóstico lo más precoz posible.

  1. BK channel activation by NS11021 decreases excitability and contractility of urinary bladder smooth muscle

    DEFF Research Database (Denmark)

    Layne, Jeffrey J; Nausch, Bernhard; Olesen, Søren-Peter;

    2009-01-01

    activation of BK channels has the converse effect of reducing UBSM excitability and contractility. Here, we have sought to investigate this possibility by using the novel BK channel opener NS11021. NS11021 (3 microM) caused an approximately threefold increase in both single BK channel open probability (P......Large-conductance Ca(2+)-activated potassium (BK) channels play an important role in regulating the function and activity of urinary bladder smooth muscle (UBSM), and the loss of BK channel function has been shown to increase UBSM excitability and contractility. However, it is not known whether......(o)) and whole cell BK channel currents. The frequency of spontaneous action potentials in UBSM strips was reduced by NS11021 from a control value of 20.9 + or - 5.9 to 10.9 + or - 3.7 per minute. NS11021 also reduced the force of UBSM spontaneous phasic contractions by approximately 50%, and this force...

  2. Trasplante cardíaco y de médula ósea en un paciente

    Directory of Open Access Journals (Sweden)

    CÉSAR BELZITI

    2009-01-01

    Full Text Available RESUMENLa amiloidosis es una enfermedad infiltrativa sistémica que compromete al corazón y representauna causa importante de miocardiopatía restrictiva.Se describe el caso de un paciente masculino de 35 años con insuficiencia cardíaca avanzadasecundaria a miocardiopatía infiltrativa por depósito amiloide. Durante su evaluación serealizó diagnóstico de neoplasia de células plasmáticas. Debido a la rápida progresión de lossíntomas, el deterioro de la función ventricular y la incapacidad para tolerar el tratamientoadecuado para su enfermedad hematológica, se realizó trasplante cardíaco seguido de trasplanteautólogo de médula ósea sin complicaciones. La presentación de este caso constituyela primera comunicación en nuestro país de trasplante cardíaco seguido de trasplante demédula ósea como tratamiento de la amiloidosis cardíaca.REV ARGENT CARDIOL 2009;77;309-311.

  3. Reactivation of BK polyomavirus in patients with multiple sclerosis receiving natalizumab therapy.

    LENUS (Irish Health Repository)

    Lonergan, Roisin M

    2012-02-01

    Natalizumab therapy in multiple sclerosis has been associated with JC polyomavirus-induced progressive multifocal leucoencephalopathy. We hypothesized that natalizumab may also lead to reactivation of BK, a related human polyomavirus capable of causing morbidity in immunosuppressed groups. Patients with relapsing remitting multiple sclerosis treated with natalizumab were prospectively monitored for reactivation of BK virus in blood and urine samples, and for evidence of associated renal dysfunction. In this cohort, JC and BK DNA in blood and urine; cytomegalovirus (CMV) DNA in blood and urine; CD4 and CD8 T-lymphocyte counts and ratios in peripheral blood; and renal function were monitored at regular intervals. BK subtyping and noncoding control region sequencing was performed on samples demonstrating reactivation. Prior to commencement of natalizumab therapy, 3 of 36 patients with multiple sclerosis (8.3%) had BK viruria and BK reactivation occurred in 12 of 54 patients (22.2%). BK viruria was transient in 7, continuous in 2 patients, and persistent viruria was associated with transient viremia. Concomitant JC and CMV viral loads were undetectable. CD4:CD8 ratios fluctuated, but absolute CD4 counts did not fall below normal limits. In four of seven patients with BK virus reactivation, transient reductions in CD4 counts were observed at onset of BK viruria: these resolved in three of four patients on resuppression of BK replication. No renal dysfunction was observed in the cohort. BK virus reactivation can occur during natalizumab therapy; however, the significance in the absence of renal dysfunction is unclear. We propose regular monitoring for BK reactivation or at least for evidence of renal dysfunction in patients receiving natalizumab.

  4. Unique Inner Pore Properties of BK Channels Revealed by Quaternary Ammonium Block

    OpenAIRE

    Li, Weiyan; Aldrich, Richard W.

    2004-01-01

    Potassium channels have a very wide distribution of single-channel conductance, with BK type Ca2+-activated K+ channels having by far the largest. Even though crystallographic views of K+ channel pores have become available, the structural basis underlying BK channels' large conductance has not been completely understood. In this study we use intracellularly applied quaternary ammonium compounds to probe the pore of BK channels. We show that molecules as large as decyltriethylammonium (C10) a...

  5. Pengaruh Sumber Karbon dan Nitrogen Terhadap Pertumbuhan dan Pembentukan Spora Bacillus sp. Bk17

    OpenAIRE

    Rachmi

    2014-01-01

    Study of the effect of carbon and nitrogen sources on the growth and sporulation of Bacillus sp. BK17 has been conducted. Bacillus sp. BK17 was cultured in broth medium containing different carbon and nitrogen sources, and incubated for 6 days. The highest growth of Bacillus sp. BK17 was obtained on molasses-tryptone medium incubated during 3 days and the lowest growth obtained on whey-sodium nitrate. The highest spore formation was also obtained from molasses-tryptone mediu...

  6. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis

    OpenAIRE

    Wen, Donghai; Cornelius, Ryan J.; Sansom, Steven C.

    2013-01-01

    Large conductance, Ca-activated K channels are abundantly located in cells of vasculature, glomerulus and distal nephron, where they are involved in maintaining blood volume, blood pressure and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertensi...

  7. A role for BK channels in heart rate regulation in rodents.

    Directory of Open Access Journals (Sweden)

    Wendy L Imlach

    Full Text Available The heart generates and propagates action potentials through synchronized activation of ion channels allowing inward Na(+ and Ca(2+ and outward K(+ currents. There are a number of K(+ channel types expressed in the heart that play key roles in regulating the cardiac cycle. Large conductance calcium-activated potassium (BK ion channels are not thought to be directly involved in heart function. Here we present evidence that heart rate can be significantly reduced by inhibiting the activity of BK channels. Agents that specifically inhibit BK channel activity, including paxilline and lolitrem B, slowed heart rate in conscious wild-type mice by 30% and 42%, respectively. Heart rate of BK channel knock-out mice (Kcnma1(-/- was not affected by these BK channel inhibitors, suggesting that the changes to heart rate were specifically mediated through BK channels. The possibility that these effects were mediated through BK channels peripheral to the heart was ruled out with experiments using isolated, perfused rat hearts, which showed a significant reduction in heart rate when treated with the BK channel inhibitors paxilline (1 microM, lolitrem B (1 microM, and iberiotoxin (0.23 microM, of 34%, 60%, and 42%, respectively. Furthermore, paxilline was shown to decrease heart rate in a dose-dependent manner. These results implicate BK channels located in the heart to be directly involved in the regulation of heart rate.

  8. Soporte social percibido y calidad de vida de personas con enfermedad renal crónica sometidas a trasplante renal

    Directory of Open Access Journals (Sweden)

    Judith Medellín Olaya

    2014-07-01

    Full Text Available Objetivo: Establecer la relación entre el soporte social y la calidad de vida percibida de personas con enfermedad renal crónica sometidas a trasplante renal. Método: Estudio descriptivo correlacional, de corte transversal y abordaje cuantitativo. Participaron 210 personas con trasplante renal que asistieron a su control mensual en una institución privada prestadora de servicios de salud. Se aplicaron los instrumentos Calidad de vida versión paciente de Betty Ferrell, Soporte social percibido de Hilbert y el Formato de caracterización sociodemográfica para persona con enfermedad crónica del Grupo de Cuidado al Paciente Crónico de la Universidad Nacional de Colombia. El análisis de asociación se realizó mediante la determinación de los coeficientes de correlación de Pearson y de Spearman, utilizando el programa SPSSS Versión 17.0 Resultados: Las características sociodemográficas de las personas con enfermedad renal crónica sometidas a trasplante renal fueron: mayoría hombres, edades entre 18 y 60 años, estado civil casados, estrato socioeconómico 2, nivel educativo bachillerato, ocupación trabajadores independientes. La percepción de calidad de vida en general fue alta, especialmente en la dimensión física. El soporte social percibido en la mayoría de los casos fue alto, reportándose los mayores puntajes en las dimensiones guía y en la interacción social, mientras que los menores, en la interacción personal. No se identificó correlación estadísticamente significativa entre calidad de vida y soporte social percibido en personas con enfermedad renal crónica sometidas a un trasplante renal. Conclusión: Para este estudio, la calidad de vida en personas sometidas a trasplante renal no se relacionó con el soporte social percibido, aspecto que puede estar relacionado con factores que requieren ser explorados mediante abordajes cualitativos que reconozcan elementos propios de la experiencia de cronicidad y que hacen

  9. El trasplante en Navarra y España Transplantation in Navarra and Spain

    Directory of Open Access Journals (Sweden)

    J. J. Unzué

    2006-08-01

    Full Text Available La donación de órganos y tejidos es un proceso admitido en nuestra sociedad como algo habitual, así ante la inminencia de la muerte, y el planteamiento de la gravedad del paciente, en una UCI, la familia ofrece los órganos y/o tejidos antes de solicitarlos. Como cifra clave, al finalizar el año 2005, se produjeron tres datos históricos: por un lado, en España ha pasado de 35 donaciones por millón -¡récord mundial!-, y por otro lado, se ha conseguido la cifra más baja de negativas familiares de la historia, situándonos por debajo del 16 por millón, y además se ha podido rebasar la cifra de 1.500 donantes en un año. El hecho de llevar más de 30 años de experiencia en donación y trasplante ha permitido optimizar métodos y protocolos y distribuir con eficacia funciones sobre la base de la especialización; el Hospital de Navarra se encarga preferentemente de la extracción de órganos; el Hospital Virgen del Camino se ocupa de la captación de tejidos, y la Clínica Universitaria de Navarra del proceso quirúrgico del trasplante. En este trabajo se ofrecen datos de los distintos trasplantes haciendo referencia continuamente a los datos producidos entre los años 1995 y 2005; cuando la ocasión lo requiere, se citan también datos anteriores y se establecen algunas comparaciones con el resto de España y otros países.The donation of organs and tissues is accepted in our society as a normal process; thus it frequently happens that when, in the face of imminent death, we inform the family of the severity of the patient in an intensive care unit, they offer us the organs and/or tissues before they are even asked. That is to say that in our milieu the degree of awareness and generosity is very high. As a sort of magic figure, three historic events occurred at the end of 2005: on the one hand, Spain exceeded the figure of 35 donations per million - a world record; on the other hand, we obtained the lowest figure of family refusals in

  10. Marcador Triangular, Método alternativo para la realización del trasplante manual en hileras en pequeñas parcelas.

    Directory of Open Access Journals (Sweden)

    Pedro Antonio Meneses Dartayet

    2007-01-01

    Full Text Available El trabajo se realizó en los campos experimentales de la Estación del Arroz “Sur del Jíbaro” y en áreas de producción del Arroz Popular de los municipios La Sierpe, Fomento y Taguasco, provincia de Sancti Spiritus. Se estudiaron cinco variantes para la realización del trasplante manual en hileras, las cuales fueron comparadas con el trasplante tradicional al Azar y entre ellas mismas; se evaluó la productividad (ha/hombre/jornada y el rendimiento agrícola (t/ha. Los resultados mostraron que la variante de mayor productividad fue el Trasplante Tradicional al Azar con 0.086 ha/hombre/jornada, en el resto de los tratamientos ésta se redujo hasta valores de 0.036, cuando se utilizó el marcador de dos sogas; por otra parte el rendimiento agrícola de todos los tratamientos donde se realizó el trasplante en hileras supero significativamente al trasplante tradicional al Azar, el mejor resultado fue alcanzado por el Marcador Triangular 20x20cm y 1.5 m de ancho.

  11. BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.

    Science.gov (United States)

    Lai, Michael H; Wu, Yuejin; Gao, Zhan; Anderson, Mark E; Dalziel, Julie E; Meredith, Andrea L

    2014-11-01

    Large-conductance Ca(2+)- and voltage-activated K(+) (BK) channels play prominent roles in shaping muscle and neuronal excitability. In the cardiovascular system, BK channels promote vascular relaxation and protect against ischemic injury. Recently, inhibition of BK channels has been shown to lower heart rate in intact rodents and isolated hearts, suggesting a novel role in heart function. However, the underlying mechanism is unclear. In the present study, we recorded ECGs from mice injected with paxilline (PAX), a membrane-permeable BK channel antagonist, and examined changes in cardiac conduction. ECGs revealed a 19 ± 4% PAX-induced reduction in heart rate in wild-type but not BK channel knockout (Kcnma1(-/-)) mice. The heart rate decrease was associated with slowed cardiac pacing due to elongation of the sinus interval. Action potential firing recorded from isolated sinoatrial node cells (SANCs) was reduced by 55 ± 15% and 28 ± 9% by application of PAX (3 μM) and iberiotoxin (230 nM), respectively. Furthermore, baseline firing rates from Kcnma1(-/-) SANCs were 33% lower than wild-type SANCs. The slowed firing upon BK current inhibition or genetic deletion was due to lengthening of the diastolic depolarization phase of the SANC action potential. Finally, BK channel immunoreactivity and PAX-sensitive currents were identified in SANCs with HCN4 expression and pacemaker current, respectively, and BK channels cloned from SANCs recapitulated similar activation as the PAX-sensitive current. Together, these data localize BK channels to SANCs and demonstrate that loss of BK current decreases SANC automaticity, consistent with slowed sinus pacing after PAX injection in vivo. Furthermore, these findings suggest BK channels are potential therapeutic targets for disorders of heart rate.

  12. Sarcoidosis cardíaca: trasplante cardíaco y recidiva de la enfermedad

    Directory of Open Access Journals (Sweden)

    César A. Belziti

    2010-01-01

    Full Text Available RESUMENLa sarcoidosis cardíaca es una enfermedad granulomatosa multisistémica de causa desconocida.El compromiso aislado del corazón es poco frecuente y el pronóstico se correlacionacon el grado de afectación de este órgano. El tratamiento inmunosupresor y el trasplantecardíaco han demostrado que prolongan la sobrevida; no obstante, existen comunicacionesde recidiva de la enfermedad en el órgano implantado. En esta presentación se describe uncaso de recidiva de sarcoidosis cardíaca en un paciente con miocardiopatía dilatada coninsuficiencia cardíaca avanzada, sometido a un trasplante cardíaco y en quien el diagnósticode sarcoidosis cardíaca se estableció por el estudio anatomopatológico del corazón explantado.La evolución clínica fue favorable a pesar de la recidiva de la sarcoidosis en el órgano implantado.REV ARGENT CARDIOL 2010;78:358-360.

  13. Cochlear function in mice lacking the BK channel alpha, beta1, or beta4 subunits

    NARCIS (Netherlands)

    Pyott, Sonja J; Meredith, Andrea L; Fodor, Anthony A; Vázquez, Ana E; Yamoah, Ebenezer N; Aldrich, Richard W

    2007-01-01

    Large conductance voltage- and calcium-activated potassium (BK) channels are important for regulating many essential cellular functions, from neuronal action potential shape and firing rate to smooth muscle contractility. In amphibians, reptiles, and birds, BK channels mediate the intrinsic frequenc

  14. KCNMA1 encoded cardiac BK channels afford protection against ischemia-reperfusion injury

    DEFF Research Database (Denmark)

    Soltysinska, Ewa; Bentzen, Bo Hjorth; Barthmes, Maria;

    2014-01-01

    that mitoBK fine-tune the oxidative state at hypoxia and re-oxygenation. Because ROS and the capacity of the myocardium for oxidative metabolism are important determinants of cellular survival, we tested BK-/- hearts for their response in an ex-vivo model of ischemia/reperfusion (I/R) injury. Infarct areas...

  15. CALIDAD DE VIDA RELACIONADA CON LA SALUD INFANTIL Y EL TRASPLANTE DE ÓRGANOS: UNA REVISIÓN DE LITERATURA

    Directory of Open Access Journals (Sweden)

    Elisa Kern de Castro

    2005-06-01

    Full Text Available En el presente artículo los autores revisan algunas cuestiones teóricas y estudios empíricos sobre la calidad de vida relacionada con la salud infantil, en especial en niños con enfermedades crónicas que necesitan trasplantes de órganos. Pocas investigaciones han sido realizadas sobre el tema hasta el momento. Sus resultados han mostrado que el trasplante mejora el bienestar físico pero no hay conclusiones definitivas sobre su relación con el bienestar psicológico. Se discute la necesidad de evaluar los efectos del trasplante de órganos pediátrico en cada fase evolutiva, en distintos órganos y en diversas culturas.

  16. Utilidad del MELD y el sodio pretrasplante en el pronóstico del trasplante hepático a corto plazo

    OpenAIRE

    Londoño Hurtado, Maria Carlota

    2011-01-01

    [spa] El MELD y el sodio sérico son factores pronósticos en la cirrosis, pero no queda claro su papel en la evaluación del pronóstico en lista de espera para trasplante hepático y en tras el mismo. El objetivo de la presente tesis doctoral es evaluar la utlidad del MELD y el sodio sérico en la valoración pronóstica del paicente cirrótico antes y después del trasplante hepático. En el primer estudio se incluyeron 308 pacientes en lista de espera para trasplante hepático durante un periodo de 5...

  17. BK virus-associated hemorrhagic cystitis after pediatric stem cell transplantation.

    Science.gov (United States)

    Han, Seung Beom; Cho, Bin; Kang, Jin Han

    2014-12-01

    Hemorrhagic cystitis is a common stem cell transplantation-related complication. The incidence of early-onset hemorrhagic cystitis, which is related to the pretransplant conditioning regimen, has decreased with the concomitant use of mesna and hyperhydration. However, late-onset hemorrhagic cystitis, which is usually caused by the BK virus, continues to develop. Although the BK virus is the most common pathogenic microorganism of poststem cell transplantation late-onset hemorrhagic cystitis, pediatricians outside the hemato-oncology and nephrology specialties tend to be unfamiliar with hemorrhagic cystitis and the BK virus. Moreover, no standard guidelines for the early diagnosis and treatment of BK virus-associated hemorrhagic cystitis after stem cell transplantation have been established. Here, we briefly introduce poststem cell transplantation BK virus-associated hemorrhagic cystitis. PMID:25653684

  18. Collinearly-improved BK evolution meets the HERA data

    Directory of Open Access Journals (Sweden)

    E. Iancu

    2015-11-01

    Full Text Available In a previous publication, we have established a collinearly-improved version of the Balitsky–Kovchegov (BK equation, which resums to all orders the radiative corrections enhanced by large double transverse logarithms. Here, we study the relevance of this equation as a tool for phenomenology, by confronting it to the HERA data. To that aim, we first improve the perturbative accuracy of our resummation, by including two classes of single-logarithmic corrections: those generated by the first non-singular terms in the DGLAP splitting functions and those expressing the one-loop running of the QCD coupling. The equation thus obtained includes all the next-to-leading order corrections to the BK equation which are enhanced by (single or double collinear logarithms. We then use numerical solutions to this equation to fit the HERA data for the electron–proton reduced cross-section at small Bjorken x. We obtain good quality fits for physically acceptable initial conditions. Our best fit, which shows a good stability up to virtualities as large as Q2=400 GeV2 for the exchanged photon, uses as an initial condition the running-coupling version of the McLerran–Venugopalan model, with the QCD coupling running according to the smallest dipole prescription.

  19. Collinearly-improved BK evolution meets the HERA data

    CERN Document Server

    Iancu, E; Mueller, A H; Soyez, G; Triantafyllopoulos, D N

    2015-01-01

    In a previous publication, we have established a collinearly-improved version of the Balitsky-Kovchegov (BK) equation, which resums to all orders the radiative corrections enhanced by large double transverse logarithms. Here, we study the relevance of this equation as a tool for phenomenology, by confronting it to the HERA data. To that aim, we first improve the perturbative accuracy of our resummation, by including two classes of single-logarithmic corrections: those generated by the first non-singular terms in the DGLAP splitting functions and those expressing the one-loop running of the QCD coupling. The equation thus obtained includes all the next-to-leading order corrections to the BK equation which are enhanced by (single or double) collinear logarithms. We then use numerical solutions to this equation to fit the HERA data for the electron-proton reduced cross-section at small Bjorken x. We obtain good quality fits for physically acceptable initial conditions. Our best fit, which shows a good stability ...

  20. La perspectiva de los nefrólogos acerca de la donación y el trasplante renal en la Argentina

    Directory of Open Access Journals (Sweden)

    Javier Roberti

    2014-10-01

    Full Text Available El objetivo de este trabajo cualitativo fue explorar y describir la perspectiva de los nefrólogos acerca de la situación de la donación y el trasplante en la Argentina. Participaron 22 jefes de equipo de trasplante y/o profesionales a cargo de la toma de decisiones sobre la aceptación de injertos, donantes y candidatos a trasplante, de una muestra intencional. Se realizaron entrevistas en profundidad, semi-estructuradas, que se grabaron, transcribieron, analizaron y codificaron temáticamente. Más de la mitad de los participantes coincidió en la necesidad de promover la donación de órganos; casi la mitad dijo que los centros de diálisis no enviaban todos los pacientes que deberían a realizar estudios para trasplante. La mitad de los participantes confirmó que la información brindada por el equipo de procuración no era confiable. Se identificó la falta de adherencia de los pacientes al tratamiento como un problema serio, principalmente a causa de la situación socio-económica. 5/22 participantes expresaron que la cantidad de trasplantes no aumentaba por bajas tasas de donación, entrenamiento deficiente o falta de información de los nefrólogos. Los participantes percibieron una necesidad de información, entrenamiento y compromiso de los profesionales de la salud en la identificación y derivación de posibles donantes y receptores y señalaron que los problemas socioeconómicos afectan al proceso en diferentes etapas. Estos temas deberían ser tenidos en cuenta para mejorar los resultados del trasplante en un contexto de transparencia y equidad.

  1. Trasplantation of larynx and trachea: both a present and future option Trasplantes de la laringe y tráquea, una opción para el presente y el futuro

    Directory of Open Access Journals (Sweden)

    Francisco Martínez

    2004-01-01

    Full Text Available

    Lost functions of the larynx and the trachea may be restored by different means, but none of them is physiologic and patients are left with functional difficulties and self-esteem disorders that alter the quality of their lives.  Transplantation of these organs is an useful alternative but certain basic requirements concerning revascularization, reinnervation and immunosupression should be fulfilled.  The former has been achieved through the knowledge of vascular territories and the advances in surgical techniques.  Difficulties for reinnervation have no yet been thoroughly overcome but tone can be achieved in the vocal folds and functionality may be obtained by manipulation of their position.  Immunosupression is produced with cyclosporine which requirements were determined in experimental models.  The main reason for carrying out these and other transplantations is to improve the quality of life of persons who have suffered the loss of an organ.  A review is presented on important aspects that have to be taken into account when performing these transplantations.

    Las funciones perdidas de la laringe o la tráquea se pueden reemplazar de diferentes maneras; sin embargo, ninguna alternativa es fisiológica y los trasplantes quedan con dificultades funcionales y de autoestima que alteran la calidad de sus vidas,  El Trasplante de estos órganos es una alternativa útil, pero deben cumplirse ciertos requisitos básicos en cuanto a la revascularización, la reinervación y la imunosupresión.  El primero se logró con el conocimiento de los territorios vasculares y los avances en las técnicas quirúrgicas.  Las dificultades para la reinervación todavía no se han superado totalmente, pero se puede lograr tono en los pliegues vocales y obtener funcionalidad manipulando su posición.  la inmunosupresión se logra con ciclosporina cuyos requerimientos se definieron en modelos experimentales.  La principal razón para hacer estos y

  2. Phase 1b randomized trial and follow-up study in Uganda of the blood-stage malaria vaccine candidate BK-SE36.

    Directory of Open Access Journals (Sweden)

    Nirianne Marie Q Palacpac

    Full Text Available BACKGROUND: Up to now a malaria vaccine remains elusive. The Plasmodium falciparum serine repeat antigen-5 formulated with aluminum hydroxyl gel (BK-SE36 is a blood-stage malaria vaccine candidate that has undergone phase 1a trial in malaria-naive Japanese adults. We have now assessed the safety and immunogenicity of BK-SE36 in a malaria endemic area in Northern Uganda. METHODS: We performed a two-stage, randomized, single-blinded, placebo-controlled phase 1b trial (Current Controlled trials ISRCTN71619711. A computer-generated sequence randomized healthy subjects for 2 subcutaneous injections at 21-day intervals in Stage1 (21-40 year-olds to 1-mL BK-SE36 (BKSE1.0 (n = 36 or saline (n = 20 and in Stage2 (6-20 year-olds to BKSE1.0 (n = 33, 0.5-mL BK-SE36 (BKSE0.5 (n = 33, or saline (n = 18. Subjects and laboratory personnel were blinded. Safety and antibody responses 21-days post-second vaccination (Day42 were assessed. Post-trial, to compare the risk of malaria episodes 130-365 days post-second vaccination, Stage2 subjects were age-matched to 50 control individuals. RESULTS: Nearly all subjects who received BK-SE36 had induration (Stage1, n = 33, 92%; Stage2, n = 63, 96% as a local adverse event. No serious adverse event related to BK-SE36 was reported. Pre-existing anti-SE36 antibody titers negatively correlated with vaccination-induced antibody response. At Day42, change in antibody titers was significant for seronegative adults (1.95-fold higher than baseline [95% CI, 1.56-2.43], p = 0.004 and 6-10 year-olds (5.71-fold [95% CI, 2.38-13.72], p = 0.002 vaccinated with BKSE1.0. Immunogenicity response to BKSE0.5 was low and not significant (1.55-fold [95% CI, 1.24-1.94], p = 0.75. In the ancillary analysis, cumulative incidence of first malaria episodes with ≥5000 parasites/µL was 7 cases/33 subjects in BKSE1.0 and 10 cases/33 subjects in BKSE0.5 vs. 29 cases/66 subjects in the control group. Risk ratio

  3. CALIDAD DE VIDA RELACIONADA CON LA SALUD INFANTIL Y EL TRASPLANTE DE ÓRGANOS: UNA REVISIÓN DE LITERATURA

    OpenAIRE

    Elisa Kern de Castro; Bernardo Moreno-Jiménez

    2005-01-01

    En el presente artículo los autores revisan algunas cuestiones teóricas y estudios empíricos sobre la calidad de vida relacionada con la salud infantil, en especial en niños con enfermedades crónicas que necesitan trasplantes de órganos. Pocas investigaciones han sido realizadas sobre el tema hasta el momento. Sus resultados han mostrado que el trasplante mejora el bienestar físico pero no hay conclusiones definitivas sobre su relación con el bienestar psicológico. Se discute la necesidad de ...

  4. Rentabilidad diagnóstica de la tomografía computarizada de alta resolución en la valoración previa al trasplante pulmonar.

    OpenAIRE

    Pérez Enguix, Daniel Bernardo

    2007-01-01

    RESUMEN OBJETIVOS: Establecer la rentabilidad diagnóstica de los estudios de tomografía computarizada de alta resolución (TCAR) en la valoración previa al trasplante pulmonar. MATERIAL Y METODOS: Se ha realizado un estudio prospectivo en el transcurso de dos años, sobre una población de 81 pacientes remitidos al hospital La Fe de Valencia como posibles candidatos a trasplante pulmonar y cardio-pulmonar. De esta población se ha seleccionado una muestra de 71 pacientes cuya indicaci...

  5. Influencia de cuatro distancias de trasplante sobre el rendimiento agrícola del cultivar de arroz Amistad-82.

    Directory of Open Access Journals (Sweden)

    Alexander Calero Hurtado

    2012-04-01

    Full Text Available El trabajo consistió en comparar cuatro distancias de trasplante sobre el rendimiento agrícola del cultivar de arroz Amistad-82, durante la siembra de primavera de 2012, el trasplante se realizó de forma manual, sobre un suelo pardo sialítico carbonatado en la finca “La Rosita” perteneciente a la CCS “Heriberto Orellane”, en la provincia de Sancti Spíritus, se utilizó un diseño de bloques al azar, se tomaron posturas jóvenes de 18 días de germinadas, cuatro distancias de plantación 10x15, 15x15, 20x15 y 20x20 cm y una postura por sitio. Se evaluaron los indicadores productivos como el número de tallos, panículas por metro cuadrado, longitud de la panícula, granos por panículas, granos llenos y vanos por panículas, peso de 1000 granos, el rendimiento, así como las ganancias y los costos de producción. Los mejores resultados sobre el rendimiento agrícola del cultivar de arroz Amistad-82 lo alcanzaron las distancias de trasplante 10x15 y 20x15 cm, porque lograron rendimientos superiores a las distancias 15x15 y 20x20 cm, mayor cantidad de granos por panículas y mayores porcentajes de granos llenos por panículas y superaron también el peso en 1000 granos y las ganancias.

  6. EXPERIMENTACIÓN FETAL, TRASPLANTES, COSMÉTICA Y SU RELACIÓN CON EL ABORTO PROVOCADO

    OpenAIRE

    José Luis Redondo Calderón

    2012-01-01

    La generalización del aborto provocado da lugar a gran cantidad de células, tejidos y órganos que se emplean en diversos campos de la Medicina bien en investigación o en tratamientos. Entre ellos destacan la Cardiología, Hematología, Metabolismo, Embriología, Neurología, Inmunología, Oftalmología, Dermatología y Trasplantes. También implica a potenciadores del sabor y cosméticos. El utilitarismo ha propiciado que se multipliquen los bancos de células y tejidos procedentes de abortos provocado...

  7. Trasplante de homoinjertos valvulares cardiacos y vasculares Cardiac and vascular homograft valves transplant

    Directory of Open Access Journals (Sweden)

    J. M. Herreros

    2006-08-01

    Full Text Available Los progresos en la manipulación de los tejidos humanos, el desarrollo de la criobiología, la cirugía cardiaca pediátrica, la imposibilidad de conseguir una prótesis valvular cardiaca ideal y el tratamiento quirúrgico de las infecciones cardiovasculares, han reintroducido el interés para utilizar los homoinjertos. Los donantes de estos homoinjertos pueden ser: a Donantes vivos: válvula aórtica y pulmonar del receptor de trasplante cardiaco; b Donantes multiorgánicos con el diagnóstico de muerte según criterios neurológicos, cuyo corazón es rechazado para trasplante cq ardiaco; c Donantes cadáveres con asistolia inferior a 8 horas. Los homoinjertos valvulares cardiacos son el sustituto de elección en las endocarditis valvulares aórticas, pacientes con contraindicación para la anticoagulación, reconstrucción del tracto de salida de ventrículo derecho, sustitución valvular aórtica en niños o adultos jóvenes mediante la operación de Ross y es una indicación opcional la sustitución valvular aórtica y/o la aorta ascendente en los pacientes con edad superior a 60 años. Aunque no hay series suficientemente amplias de homoinjertos como sustitutos arteriales, en cuanto a número de pacientes y tiempo de evolución, los resultados sugieren que se pueden beneficiar los pacientes con infección vascular, inmunodeprimidos o los pacientes complejos cuya técnica durante la intervención puede requerir la necesidad de un homoinjerto.The advances in the manipulation of human tissues, the development of cryobiology, paediatric cardiac surgery, the impossibility of obtaining an ideal prosthetic cardiac valve and the surgical treatment of cardiovascular infections have revived interest in the use of homografts. The donors of these homografts can be: a Live donors: aortic and pulmonary valve of the recipient of a heart transplant; b Multiorgan donors with a diagnosis of death according to neurological criteria, whose heart is rejected

  8. The Impact of BK Channels on Cellular Excitability Depends on their Subcellular Location

    Science.gov (United States)

    Bock, Tobias; Stuart, Greg J.

    2016-01-01

    Large conductance calcium-activated potassium channels (or BK channels) fulfil a multitude of roles in the central nervous system. At the soma of many neuronal cell types they control the speed of action potential (AP) repolarization and therefore they can have an impact on neuronal excitability. Due to their presence in nerve terminals they also regulate transmitter release. BK channels have also been shown to be present in the dendrites of some neurons where they can regulate the magnitude and duration of dendritic spikes. Here, we investigate the impact of modulating the activation of BK channels at different locations on the cellular excitability of cortical layer 5 pyramidal neurons. We find that while somatic BK channels help to repolarize APs at the soma and mediate the fast after-hyperpolarization, dendritic BK channels are responsible for repolarization of dendritic calcium spikes and thereby regulate somatic AP burst firing. We found no evidence for a role of dendritic BK channels in the regulation of backpropagating AP amplitude or duration. These experiments highlight the diverse roles of BK channels in regulating neuronal excitability and indicate that their functional impact depends on their subcellular location.

  9. Oxidative Stress and Maxi Calcium-Activated Potassium (BK Channels

    Directory of Open Access Journals (Sweden)

    Anton Hermann

    2015-08-01

    Full Text Available All cells contain ion channels in their outer (plasma and inner (organelle membranes. Ion channels, similar to other proteins, are targets of oxidative impact, which modulates ion fluxes across membranes. Subsequently, these ion currents affect electrical excitability, such as action potential discharge (in neurons, muscle, and receptor cells, alteration of the membrane resting potential, synaptic transmission, hormone secretion, muscle contraction or coordination of the cell cycle. In this chapter we summarize effects of oxidative stress and redox mechanisms on some ion channels, in particular on maxi calcium-activated potassium (BK channels which play an outstanding role in a plethora of physiological and pathophysiological functions in almost all cells and tissues. We first elaborate on some general features of ion channel structure and function and then summarize effects of oxidative alterations of ion channels and their functional consequences.

  10. Covariance fitting of highly correlated $B_K$ data

    CERN Document Server

    Yoon, Boram; Jung, Chulwoo; Lee, Weonjong

    2011-01-01

    We present the reason why we use the diagonal approximation (uncorrelated fitting) when we perform the data analysis of highly correlated $B_K$ data on the basis of the SU(2) staggered chiral perturbation theory. Basically, the essence of the problem is that we do not have enough statistics to determine the small eigenvalues of the covariance matrix with a high precision. As a result, we have the smallest eigenvalue, which is smaller than the statistical error of the covariance matrix, corresponding to an unphysical eigenmode. We have applied a number of prescriptions available in the market such as the cutoff method and modified covariance matrix method. It turns out that the cutoff method is not a good prescription and the modified covariance matrix method is an even worse one. The diagonal approximation turns out to be a good prescription if the data points are somehow correlated and the statistics are relatively poor.

  11. Enfermedad Renal Crónica y trasplante renal: experiencias y superación de una estudiante de medicina

    Directory of Open Access Journals (Sweden)

    Ana Julia Carrillo Algarra

    2015-12-01

    Full Text Available Las personas con enfermedad renal crónica (ERC en estado terminal ven el trasplante como esperanza de vida e independencia, les evita ir tres veces por semana a hemodiálisis o tener presente el horario para sus recambios. Describen este cambio como positivo, por tanto interesa comprender cómo vive esa transformación Kate, estudiante de último año de medicina a quien sorpresivamente le diagnostican ERC, el efecto que tiene este suceso en su confianza en la medicina occidental, que la lleva a buscar refugio en medicinas alternativas. El relato rememora la experiencia y evolución del tratamiento de Kate, cómo describe ella el cambio de vida, las implicaciones de ser paciente en las diferentes terapias de sustitución renal, sus experiencias antes, durante y después del trasplante y lo que este significa teniendo en cuenta que ella conoce los procedimientos y las posibles complicaciones.

  12. Calidad de vida relacionada con la salud en pacientes con trasplante de progenitores hematopoyéticos

    Directory of Open Access Journals (Sweden)

    Margarita Ruiz Seixas

    2014-12-01

    Full Text Available El Trasplante de Progenitores Hematopoyéticos (TPH es la primera opción de tratamiento en múltiples patologías. El análisis de la calidad de vida de estos pacientes es necesario para evaluar resultados y ofrecer información al paciente. Objetivo: Se analiza la evolución de la calidad de vida mediante estudio descriptivo longitudinal, en la Unidad Clínica de Hematología del Hospital Universitario Virgen del Rocío. Resultados: El análisis con SF36 rinde en las mediciones basal, 2 y 9 meses tras TPH, en escala física 43.5, 39.2 y 43.2 y en mental 48.7, 44.7 y 51.2. No se observaron diferencias por modalidad de trasplante (autólogo o alogénico o tipo de acondicionamiento. Conclusión: La calidad de vida inicial de los pacientes con TPH es inferior a la población estándar, empeorando a los dos meses y produciéndose mejoría en funcionamiento mental a los 9. No hay evidencias de que influya la modalidad de TPH o el acondicionamiento previo.

  13. Experiencia de trasplante hepático en Latinoamérica: en un centro médico en Colombia

    Directory of Open Access Journals (Sweden)

    Oscar Santos

    2015-03-01

    Full Text Available Objetivos:El trasplante hepático es el tratamiento de elección para la falla hepática aguda y crónica, casos seleccionados de tumores y enfermedades por errores en el metabolismo. En este documento se reporta la experiencia de un centro en Latinoamérica.Métodos:Entre el 2004 y el 2010 se realizaron 305 trasplantes ortotópicos de hígado en 284 pacientes. De ellos, 241 corresponde a primer trasplante en adultos.Resultados:La edad promedio fue 52 años y el 62% eran hombres. La principal indicación fue cirrosis por alcohol. La supervivencia de los pacientes a 1 y 5 años fue de 82 y 72% respectivamente y del injerto hepático a 1 y 5 años fue de 78 y 68% respectivamente. La principal causa de muerte fue sepsis. Se documentaron complicaciones en la arteria hepática en el 5% y complicaciones en la vía biliar en el 14.5%. Se encontraron infecciones en el 41% de los pacientes. Rechazo agudo se presento en el 30% y rechazo crónico en el 3%.Conclusión:El trasplante hepático en nuestro centro en Colombia ofrece buenos resultados a mediano plazo, con una tasa de complicaciones similar a lo reportado en otros centros del mundo.

  14. Fusion and quasifission dynamics in the reactions $^{48}$Ca+$^{249}$Bk and $^{50}$Ti+$^{249}$Bk using TDHF

    CERN Document Server

    Umar, A S; Simenel, C

    2016-01-01

    Background: Synthesis of superheavy elements (SHE) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHE have been recently produced with doubly-magic $^{48}$Ca beams. However, SHE synthesis experiments with single-magic $^{50}$Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for $Z=117,119$ superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in $^{48}$Ca,$^{50}$Ti+$^{249}$Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleu...

  15. Neuronal fast activating and meningeal silent modulatory BK channel splice variants cloned from rat

    DEFF Research Database (Denmark)

    Poulsen, Asser Nyander; Jansen-Olesen, Inger; Olesen, Jes;

    2011-01-01

    The big conductance calcium-activated K(+) channel (BK) is involved in regulating neuron and smooth muscle cell excitability. Functional diversity of BK is generated by alpha-subunit splice variation and co-expression with beta subunits. Here, we present six different splice combinations cloned...... from rat brain or cerebral vascular/meningeal tissues, of which at least three variants were previously uncharacterized (X1, X2(92), and X2(188)). An additional variant was identified by polymerase chain reaction but not cloned. Expression in Xenopus oocytes showed that the brain-specific X1 variant...... for a subpopulation of BK channels in the brain, while the "silent" truncated variants X2(92) and X2(188) may play a role as modulators of other BK channel variants in a way similar to well known beta subunits....

  16. Adrenaline-induced colonic K+ secretion is mediated by KCa1.1 (BK) channels

    DEFF Research Database (Denmark)

    Sørensen, Mads Vaarby; Sausbier, Matthias; Ruth, Peter;

    2010-01-01

    secretory K(+) channel in the apical membrane of the murine distal colon. The BK channel is responsible for both resting and Ca(2+)-activated colonic K(+) secretion and is up-regulated by aldosterone. Agonists (e.g. adrenaline) that elevate cAMP are potent activators of distal colonic K(+) secretion....... However, the secretory K(+) channel responsible for cAMP-induced K(+) secretion remains to be defined. In this study we used the Ussing chamber to identify adrenaline-induced electrogenic K(+) secretion. We found that the adrenaline-induced electrogenic ion secretion is a compound effect dominated...... by anion secretion and a smaller electrically opposing K(+) secretion. Using tissue from (i) BK wildtype (BK(+/+)) and knockout (BK(/)) and (ii) cystic fibrosis transmembrane regulator (CFTR) wildtype (CFTR(+/+)) and knockout (CFTR(/)) mice we were able to isolate the adrenaline-induced K(+) secretion. We...

  17. Molecular studies of BKCa channels in intracranial arteries

    DEFF Research Database (Denmark)

    Wulf, Helle; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2008-01-01

    expression of the BK(Ca) channel in rat basilar, middle cerebral, and middle meningeal arteries by reverse transcription polymerase chain reaction (RT-PCR), quantitative real-time PCR, and Western blotting. Distribution patterns were investigated using in situ hybridization and immunofluorescence studies. RT-PCR...... and quantitative real-time PCR detected the expression of the BK(Ca) channel mRNA transcript in rat basilar, middle cerebral, and middle meningeal arteries, with the transcript being expressed more abundantly in rat basilar arteries than in middle cerebral and middle meningeal arteries. Western blotting detected...... the BK(Ca) channel protein in rat basilar and middle cerebral arteries. In situ hybridization and immunofluorescence studies confirmed that the BK(Ca) channel mRNA and protein expression was localized to smooth muscle cells in all three intracranial arteries. The data thus suggest the presence...

  18. BK virus-associated hemorrhagic cystitis after pediatric stem cell transplantation

    OpenAIRE

    Han, Seung Beom; Cho, Bin; Kang, Jin Han

    2014-01-01

    Hemorrhagic cystitis is a common stem cell transplantation-related complication. The incidence of early-onset hemorrhagic cystitis, which is related to the pretransplant conditioning regimen, has decreased with the concomitant use of mesna and hyperhydration. However, late-onset hemorrhagic cystitis, which is usually caused by the BK virus, continues to develop. Although the BK virus is the most common pathogenic microorganism of poststem cell transplantation late-onset hemorrhagic cystitis, ...

  19. Closed state-coupled C-type inactivation in BK channels.

    Science.gov (United States)

    Yan, Jiusheng; Li, Qin; Aldrich, Richard W

    2016-06-21

    Ion channels regulate ion flow by opening and closing their pore gates. K(+) channels commonly possess two pore gates, one at the intracellular end for fast channel activation/deactivation and the other at the selectivity filter for slow C-type inactivation/recovery. The large-conductance calcium-activated potassium (BK) channel lacks a classic intracellular bundle-crossing activation gate and normally show no C-type inactivation. We hypothesized that the BK channel's activation gate may spatially overlap or coexist with the C-type inactivation gate at or near the selectivity filter. We induced C-type inactivation in BK channels and studied the relationship between activation/deactivation and C-type inactivation/recovery. We observed prominent slow C-type inactivation/recovery in BK channels by an extreme low concentration of extracellular K(+) together with a Y294E/K/Q/S or Y279F mutation whose equivalent in Shaker channels (T449E/K/D/Q/S or W434F) caused a greatly accelerated rate of C-type inactivation or constitutive C-inactivation. C-type inactivation in most K(+) channels occurs upon sustained membrane depolarization or channel opening and then recovers during hyperpolarized membrane potentials or channel closure. However, we found that the BK channel C-type inactivation occurred during hyperpolarized membrane potentials or with decreased intracellular calcium ([Ca(2+)]i) and recovered with depolarized membrane potentials or elevated [Ca(2+)]i Constitutively open mutation prevented BK channels from C-type inactivation. We concluded that BK channel C-type inactivation is closed state-dependent and that its extents and rates inversely correlate with channel-open probability. Because C-type inactivation can involve multiple conformational changes at the selectivity filter, we propose that the BK channel's normal closing may represent an early conformational stage of C-type inactivation.

  20. BK channel β1 and β4 auxiliary subunits exert opposite influences on escalated ethanol drinking in dependent mice.

    Science.gov (United States)

    Kreifeldt, Max; Le, David; Treistman, Steven N; Koob, George F; Contet, Candice

    2013-01-01

    Large conductance calcium-activated potassium (BK) channels play a key role in the control of neuronal activity. Ethanol is a potent activator of BK channel gating, but how this action may impact ethanol drinking still remains poorly understood. Auxiliary β subunits are known to modulate ethanol-induced potentiation of BK currents. In the present study, we investigated whether BK β1 and β4 subunits influence voluntary ethanol consumption using knockout (KO) mice. In a first experiment, mice were first subjected to continuous two-bottle choice (2BC) and were then switched to intermittent 2BC, which progressively increased ethanol intake as previously described in wildtype mice. BK β1 or β4 subunit deficiency did not affect ethanol self-administration under either schedule of access. In a second experiment, mice were first trained to drink ethanol in a limited-access 2BC paradigm. BK β1 or β4 deletion did not affect baseline consumption. Weeks of 2BC were then alternated with weeks of chronic intermittent ethanol (CIE) or air inhalation. As expected, a gradual escalation of ethanol drinking was observed in dependent wildtype mice, while intake remained stable in non-dependent wildtype mice. However, CIE exposure only produced a mild augmentation of ethanol consumption in BK β4 KO mice. Conversely, ethanol drinking increased after fewer CIE cycles in BK β1 KO mice than in wildtype mice. In conclusion, BK β1 or β4 did not influence voluntary ethanol drinking in non-dependent mice, regardless of the pattern of access to ethanol. However, deletion of BK β4 attenuated, while deletion of BK β1 accelerated, the escalation of ethanol drinking during withdrawal from CIE. Our data suggest that BK β1 and β4 subunits have an opposite influence on the negative reinforcing properties of ethanol withdrawal. Modulating the expression, distribution or interactions of BK channel auxiliary subunits may therefore represent a novel avenue for the treatment of alcoholism

  1. BK channel β1 and β4 auxiliary subunits exert opposite influences on escalated ethanol drinking in dependent mice

    Directory of Open Access Journals (Sweden)

    Max eKreifeldt

    2013-12-01

    Full Text Available Large conductance calcium-activated potassium (BK channels play a key role in the control of neuronal activity. Ethanol is a potent activator of BK channel gating, but how this action may impact ethanol drinking still remains poorly understood. Auxiliary β subunits are known to modulate ethanol-induced potentiation of BK currents. In the present study, we investigated whether BK β1 and β4 subunits influence voluntary ethanol consumption using knockout mice. In a first experiment, mice were first subjected to continuous two-bottle choice (2BC and were then switched to intermittent 2BC, which progressively increased ethanol intake as previously described in wildtype mice. BK β1 or β4 subunit deficiency did not affect ethanol self-administration under either schedule of access. In a second experiment, mice were first trained to drink ethanol in a limited-access 2BC paradigm. BK β1 or β4 deletion did not affect baseline consumption. Weeks of 2BC were then alternated with weeks of chronic intermittent ethanol (CIE or air inhalation. As expected, a gradual escalation of ethanol drinking was observed in dependent wildtype mice, while intake remained stable in non-dependent wildtype mice. However, CIE exposure only produced a mild augmentation of ethanol consumption in BK β4 knockout mice. Conversely, ethanol drinking increased after fewer CIE cycles in BK β1 knockout mice than in wildtype mice. In conclusion, BK β1 or β4 did not influence voluntary ethanol drinking in non-dependent mice, regardless of the pattern of access to ethanol. However, deletion of BK β4 attenuated, while deletion of BK β1 accelerated, the escalation of ethanol drinking during withdrawal from CIE. Our data suggest that BK β1 and β4 subunits have an opposite influence on the negative reinforcing properties of ethanol withdrawal. Modulating the expression, distribution or interactions of BK channel auxiliary subunits may therefore represent a novel avenue for the

  2. Froth characteristic of MIBC and BK-201 frothers%起泡剂MIBC和BK-201的浮选泡沫特性

    Institute of Scientific and Technical Information of China (English)

    曾培; 欧乐明; 冯其明; 李洪强; 张福亚

    2015-01-01

    选用非极性基结构不同的起泡剂MIBC和BK-201,利用自制的泡沫性能测试系统,在两相泡沫体系下,测定两相泡沫不同高度处的气泡直径、静压强、表观溢流速度,研究起泡剂对泡沫特征及夹带的影响.结果表明:增加起泡剂浓度,气泡的兼并行为受到抑制,气泡直径逐渐减小;当MIBC浓度超过75 mg/L、BK-201浓度超过150 mg/L时,兼并行为受到显著抑制,气泡直径基本保持不变.在相同的浓度下,相比MIBC,BK-201产生的泡沫气泡直径大、含液率低、水回收速率低.因而,微细粒脉石在BK-201所形成泡沫中夹带更弱,浮选选择性更好.%By using self-designed foam property testing system, two nonpolar base structure frothers, MIBC and BK-201 were chosen to study the influences of frothers on the foam characteristic and entrainment by measuring the bubble diameter, static pressure and apparent flooding velocity in the two-phase foam. The results show that bubble merger degree reduces and air bubble diameter decreases with increasing frothers concentration. When the concentrations of MIBC and BK-201 are more than 75 and 150 mg/L, respectively, the air bubble diameter basically remains unchanged because the merger behavior is dramatically depressed. Under the same concentration, BK-201 generates larger diameter bubble, lower liquid holdup and lower water recovery compared with MIBC. As a result, the foam entrainment of fine gangue is weaker and the selectivity of flotation is better when BK-201 is used.

  3. A BK inequality for randomly drawn subsets of fixed size

    CERN Document Server

    Berg, J van den

    2011-01-01

    The BK inequality, proved by van den Berg and Kesten \\cite{BeKe85}, says that, for product measures on $\\Om := \\{0,1\\}^n$, the probability that two increasing events $A$ and $B$ 'occur disjointly' is smaller than or equal to the product of the two individual probabilities. Their conjecture that this holds for {\\em all} events was proved by Reimer \\cite{Re00}. In spite of Reimer's work, several fundamental problems in this area remained open. For instance, although it is easy to see that non-product measures can not satisfy the above inequality for all events, there are several such measures on $\\Om$ which, intuitively, should satisfy the inequality for all increasing events. One of the most 'natural' candidates is what we call here the $k$-out-of-$n$ measure, the measure assigning equal probabilities to all elements of $\\Om$ with exactly $k$ 1's (and probability 0 to all other elements). The main contribution of this paper is a proof for these measures. Remarkably, although the $k$-out-of-$n$ measures are not...

  4. BK virus infection in human immunodeficiency virus-infected patients.

    Science.gov (United States)

    Ledesma, J; Muñoz, P; Garcia de Viedma, D; Cabrero, I; Loeches, B; Montilla, P; Gijon, P; Rodriguez-Sanchez, B; Bouza, E

    2012-07-01

    The aim of this study is to evaluate the prevalence of BK virus (BKV) infection in HIV-positive patients receiving highly active antiretroviral therapy (HAART) in our hospital. The presence of BKV was analysed in urine and plasma samples from 78 non-selected HIV-infected patients. Clinical data were recorded using a pre-established protocol. We used a nested PCR to amplify a specific region of the BKV T-large antigen. Positive samples were quantified using real-time PCR. Mean CD4 count in HIV-infected patients was 472 cells/mm3 and median HIV viral load was 500 cells/mm3 (74.3% vs 25.7%; p=0.007). Viruria was present in 21.7% of healthy controls (5 out of 23 samples, p=0.02). All viral loads were low (<100 copies/mL), and we could not find any association between BKV infection and renal or neurological manifestations. We provide an update on the prevalence of BKV in HIV-infected patients treated with HAART. BKV viruria was more common in HIV-infected patients; however, no role for BKV has been demonstrated in this population.

  5. Enfoques del trasplante pancreático y de Islotes de Lanngerhans en el tratamiento de la Diabetes

    Directory of Open Access Journals (Sweden)

    Rafael De Acha Torrez

    2011-06-01

    Full Text Available La diabetes es una enfermedad con gran repercusión a nivel mundial, los objetivos de una terapia prolongada, en pacientes con cierta limitación en la terapia exógena convencional son mejorar la calidad de vida con niveles normoglicemicossustentables. Los trasplantes de órgano o de islotes son alternativas promisorias para este fin. Por lo que el enfoque de las técnicas, historia y perspectivas a futuro es de gran interés dentro de múltiples campos como la cirugía, la endocrinología, la medicina interna, finalmente y más importante la vida del paciente.

  6. Cuatro años de experiencia en el uso de tomografía computada multidetector en el trasplante de páncreas: aprendiendo junto a los cirujanos Four years of experience in the use of multidetector computer tomography in pancreas transplantation: a lesson learned together with surgeons

    Directory of Open Access Journals (Sweden)

    Hugo José Paladini

    2013-03-01

    Full Text Available Objetivo. Conocer la anatomía normal posquirúrgica del paciente con trasplante de páncreas en tomografía computada multidetector (TCMD y describir las complicaciones más frecuentes. Revisión de tema. El trasplante pancreático ha aumentado en los últimos años como estrategia terapéutica en pacientes diabéticos, siendo en la actualidad el único tratamiento eventualmente curativo. Según cifras del Instituto Nacional Central Único Coordinador de Ablación e Implante (INCUCAI, en el 2001 se realizaron 9 trasplantes renopancreáticos/pancreáticos, mientras que en el 2011 se practicaron 74. Esto nos obliga como radiólogos a conocer la anatomía normal posquirúrgica y a aprender a identificar las complicaciones más frecuentes. Los métodos imagenológicos utilizados son la ecografía/Doppler, la tomografía computada multidetector (TCMD, la angiografía convencional y la resonancia magnética (RM. En pacientes con buena función renal y ecografía no concluyente, para categorizar las complicaciones, la evaluación por tomografía computada multidetector es el paso siguiente. En nuestro hospital se realizaron 25 trasplantes pancreáticos en el período 2008-2012. Durante el posoperatorio, en 19 de ellos se sospecharon, por clínica o ecografía, complicaciones (a 15 de los cuales se les realizó tomografía computada. Conociendo la técnica quirúrgica, describimos la anatomía normal y desarrollamos las complicaciones posquirúrgicas más frecuentes: vasculares (trombosis, fístula arteriovenosa, pseudoaneurisma y no vasculares (pancreatitis, fístulas pancreáticas, colecciones, neumoperitoneo, íleo. Conclusión. La tomografía computada multidetector es un método de gran utilidad al momento de evaluar pacientes con trasplante pancreático. Un conocimiento cabal de la particular anatomía posquirúrgica y sus posibles complicaciones es crucial para el radiólogo, con el fin de orientar el seguimiento y tratamiento de estos pacientes

  7. Indicaciones, técnicas y resultados del trasplante de intestino delgado Indications, techniques and outcomes of small bowel transplant

    Directory of Open Access Journals (Sweden)

    M. López Santamaría

    2007-05-01

    Full Text Available Los resultados más recientes del trasplante intestinal (TI, con una supervivencia inmediata al procedimiento superior al 80% de los casos, y una gran proporción de supervivientes que consiguen autonomía digestiva completa y desempeñan actividades acordes con su edad, permiten considerar el TI como el tratamiento de elección en enfermos con fallo intestinal irreversible en los que es previsible una mala evolución con nutrición parenteral. El daño hepático asociado a la administración de nutrición parenteral es la indicación más frecuente de TI, especialmente en los niños, más susceptibles que los adultos a desarrollar esta complicación. Otras indicaciones aceptadas de TI son el fallo intestinal irreversible asociado a pérdida significativa de accesos venosos profundos, infecciones graves con riesgo vital asociadas al uso de catéteres centrales, y casos de fracaso intestinal que conducen habitualmente a muerte precoz, como cuadros de intestino ultracorto, diarreas intratables, y fallo intestinal asociado a elevada morbilidad y mala calidad de vida. El TI se practica en clínica humana bajo tres modalidades técnicas: trasplante de intestino aislado, trasplante combinado de hígado intestino y trasplante multivisceral. Refinamientos de las técnicas originales, que incluyen reducciones de los injertos hepáticos y/o intestinales, la opción con injerto de donante vivo, etc. permiten actualmente cubrir las diferentes necesidades, a la vez que incrementar la probabilidad de acceso al trasplante, objetivo especialmente necesario en niños muy pequeños o de muy bajo peso candidatos a trasplante hepatointestinal. Uno de los aspectos más interesantes de los programas de TI es haber permitido la evolución hacia Unidades de Rehabilitación Intestinal, que integran en un equipo multidisciplinar las tres modalidades de tratamiento: soporte nutricional, farmacoterapia y cirugía. Estas Unidades optimizan los resultados, minimizan los

  8. Implementación y resultados de un nuevo programa de ECMO para trasplante de pulmón y distrés respiratorio agudo

    Directory of Open Access Journals (Sweden)

    Eduardo San Roman

    2015-06-01

    Full Text Available RESUMEN Objetivo: El desarrollo de la membrana de oxigenación extracorpórea en América Latina representa un desafío para la especialidad. El objetivo de este artículo fue describir los resultados de un nuevo programa de membrana de oxigenación extracorpórea en una unidad de cuidados intensivos. Métodos: Estudio de cohorte retrospectivo. Incluye 22 pacientes que requirieron membrana de oxigenación extracorpórea desde Enero de 2011 hasta Junio de 2014. Se evaluaron características basales, indicaciones, duración de la corrida, días de ventilación mecánica, días de unidad de cuidados intensivos, complicaciones y mortalidad hospitalaria. Resultados: Quince pacientes requirieron membrana de oxigenación extracorpórea post-trasplante pulmonar y 7 pacientes por distrés respiratorio agudo. Todos los pacientes trasplantados fueron destetados de membrana de oxigenación extracorpórea, con una duración mediana de 3 días (Rango intercuantil - IQR: 2 - 5, de ventilación mecánica 15,5 días (IQR: 3 - 35, de estadía unidad de cuidados intensivos 31,5 días (IQR: 19 - 53 y de estadía hospitalaria 60 días (IQR: 36 - 89, con una mortalidad de 20%. Los pacientes con distrés respiratorio agudo tuvieron una mediana de duración de membrana de oxigenación extracorpórea de 9 días (IQR: 3 - 14, mediana de ventilación mecánica 25 días (IQR: 13 - 37, de estadía en terapia 31 días (IQR: 11 - 38, y hospitalaria 32 días (IQR: 11 - 41, y 57% de mortalidad. Las principales complicaciones fueron infecciones (80%, insuficiencia renal aguda (43%, sangrados en sitio quirúrgico y de inserción de cánulas (22%, plaquetopenia (60% y coagulopatía (30%. Conclusión: A pesar de encontrarnos transitando una curva de aprendizaje, consideramos la experiencia satisfactoria, con resultados y complicaciones comparables a las reportadas en la literatura.

  9. Tuning the mechanosensitivity of a BK channel by changing the linker length

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Some large-conductance Ca2+ and voltage-activated K+ (BK) channels are activated by membrane stretch. However, the mechanism of mechano-gating of the BK channels is still not well understood. Previous studies have led to the proposal that the tinker-gating ring complex functions as a passive spring, transducing the force generated by intraceilular Ca2+ to the gate to open the channel. This raises the question as to whether membrane stretch is also transmitted to the gate of mechanosensitive (MS) BK channels via the tinker-gating complex. To study this, we changed the linker length in the stretch-activated BK channel (SAKCaC), and examined the effect of membrane stretch on the gating of the resultant mutant channels. Shortening the tinker increased, whereas extending the tinker reduced, the channel mechanosensitivity both in the presence and in the absence of intracellular Ca2+. However, the voltage and Ca2+ sensitivities were not significantly altered by membrane stretch. Furthermore, the SAKCaC became less sensitive to membrane stretch at relatively high intracellular Ca2+ concentrations or membrane depolarization. These observations suggest that once the channel is in the open-state conformation, tension on the spring is partially released and membrane stretch is less effective. Our results are consistent with the idea that membrane stretch is transferred to the gate via the tinker-gating ring complex of the MS BK channels.

  10. Impact of two different commercial DNA extraction methods on BK virus viral load

    Directory of Open Access Journals (Sweden)

    Massimiliano Bergallo

    2016-03-01

    Full Text Available Background and aim: BK virus, a member of human polyomavirus family, is a worldwide distributed virus characterized by a seroprevalence rate of 70-90% in adult population. Monitoring of viral replication is made by evaluation of BK DNA by quantitative polymerase chain reaction. Many different methods can be applied for extraction of nucleic acid from several specimens. The aim of this study was to assess the impact of two different DNA extraction procedure on BK viral load. Materials and methods: DNA extraction procedure including the Nuclisens easyMAG platform (bioMerieux, Marcy l’Etoile, France and manual QIAGEN extraction (QIAGEN Hilden, Germany. BK DNA quantification was performed by Real Time TaqMan PCR using a commercial kit. Result and discussion: The samples capacity, cost and time spent were compared for both systems. In conclusion our results demonstrate that automated nucleic acid extraction method using Nuclisense easyMAG was superior to manual protocol (QIAGEN Blood Mini kit, for the extraction of BK virus from serum and urine specimens.

  11. CALIDAD DE VIDA Y ESTRATEGIAS DE AFRONTAMIENTO EN PACIENTES CON INSUFICIENCIA RENAL CRÓNICA SOMETIDOS A HEMODIÁLISIS, DIÁLISIS PERITONEAL Y TRASPLANTE RENAL

    Directory of Open Access Journals (Sweden)

    Cesar Armando Rey Anacona

    2008-07-01

    Full Text Available Se comparó la calidad de vida y las estrategias de afrontamiento en 120 pacientes con Insuficiencia Renal Crónica sometidos a hemodiálisis, diálisis peritoneal o trasplante renal, teniendo en cuenta la edad, sexo, escolaridad, estado civil y ocupación. Los instrumentos utilizados fueron una ficha sociodemográfica, la prueba de calidad de vida WHOQOL-100 (Organización Mundial de la Salud, 1998 y el Cuestionario de Estrategias de Afrontamiento (Lazarus & Folkman, 1985. Se encontró que los pacientes en tratamiento de trasplante reportaban mayor calidad de vida y mejores estrategias de afrontamiento en comparación con los otros tratamientos, siendo mayores las puntuaciones en personas con edad de transición entre adultez media y tardía, mujeres, con estudios universitarios, casados y empleados. Se discuten las implicaciones de estos hallazgos.

  12. Evaluación nutricional de pacientes candidatos a lista de espera de trasplante renopancreático Nutritional assessment of patients candidates for waiting list simultaneous kidney pancreas transplantation

    Directory of Open Access Journals (Sweden)

    M.ª L. Iglesias

    2010-06-01

    Full Text Available Introducción: El trasplante renopancreático es en la actualidad el tratamiento elegido para los pacientes diabéticos tipo 1 con ERD avanzada. Estudios científicos sobre los beneficios de esta terapéutica avalan la aceptación de la misma como lo más adecuado para los pacientes. La independencia de diálisis y de tratamiento insulínico luego del trasplante representa un importante incremento en la calidad de vida de esos pacientes. En los últimos años, la importancia de la evaluación nutricional en pacientes con enfermedades crónicas ha aumentado. Existe cada vez más evidencia científica que la malnutrición esta asociada a un riesgo mayor de morbilidad y mortalidad post intervención quirúrgica. Teniendo en cuenta la terapéutica elegida para estos pacientes y la importancia del estado nutricional como factor predictor independiente de riesgo de complicaciones post trasplante es objetivo de nuestro trabajo describir el estado nutricional de los pacientes candidatos a trasplante renopancreatico a través de parámetros objetivos y subjetivos de valoración nutricional. Materiales y métodos: Se incluyeron 45 pacientes Diabéticos tipo 1 con ERD internados en el Hospital Italiano de Buenos Aires para evaluación pre trasplante renopancreático durante el período Junio 2007-Junio 2008. Se recolectaron los datos mediante una ficha de elaboración propia. Como parámetro antropométrico se calculó el Índice de Masa corporal (IMC mediante la fórmula de Quetelet (Peso post diálisis (kg/talla 2 (mts y se clasificó según los rangos propuestos por el comité de Expertos de la OMS. Como parámetro subjetivo se realizo la Valoración Global Subjetiva (VGS que clasificó a los pacientes en Bien nutrido (A, desnutrido leve (B, desnutrido moderado (C y desnutrido severo (D. Como parámetros bioquímicos se registró el dato de albúmina sérica (g/dl al ingreso hospitalario y este dato se obtuvo de la historia clínica del paciente

  13. Airway Hydration, Apical K(+) Secretion, and the Large-Conductance, Ca(2+)-activated and Voltage-dependent Potassium (BK) Channel.

    Science.gov (United States)

    Kis, Adrian; Krick, Stefanie; Baumlin, Nathalie; Salathe, Matthias

    2016-04-01

    Large-conductance, calcium-activated, and voltage-gated K(+) (BK) channels are expressed in many tissues of the human body, where they play important roles in signaling not only in excitable but also in nonexcitable cells. Because BK channel properties are rendered in part by their association with four β and four γ subunits, their channel function can differ drastically, depending on in which cellular system they are expressed. Recent studies verify the importance of apically expressed BK channels for airway surface liquid homeostasis and therefore of their significant role in mucociliary clearance. Here, we review evidence that inflammatory cytokines, which contribute to airway diseases, can lead to reduced BK activity via a functional down-regulation of the γ regulatory subunit LRRC26. Therefore, manipulation of LRRC26 and pharmacological opening of BK channels represent two novel concepts of targeting epithelial dysfunction in inflammatory airway diseases. PMID:27115952

  14. Renovascular BK(Ca) channels are not activated in vivo under resting conditions and during agonist stimulation

    DEFF Research Database (Denmark)

    Magnusson, Linda; Sørensen, Charlotte Mehlin; Braunstein, Thomas Hartig;

    2006-01-01

    of renal vascular BK(Ca) channels by cAMP was investigated by infusing forskolin. Renal blood flow (RBF) was measured in vivo using electromagnetic flowmetry or ultrasonic Doppler. Renal preinfusion of tetraethylammonium (TEA; 3.0 mumol/min) caused a small reduction of baseline RBF, but iberiotoxin (IBT; 0......, but it attenuated the response to ANG II. Coadministration of NS-1619 with TEA or IBT abolished this effect. Forskolin caused renal vasodilation that was not inhibited by IBT. The presence of BK(Ca) channels in the preglomerular vessels was confirmed by immunohistochemistry. Despite their presence......, there is no indication for a major role for BK(Ca) channels in the control of basal renal tone in vivo. Furthermore, BK(Ca) channels do not have a buffering effect on the rat renal vascular responses to ANG II and NE. The fact that NS-1619 attenuates the ANG II response indicates that the renal vascular BK(Ca) channels...

  15. Polyoma (BK) virus associated urothelial carcinoma originating within a renal allograft five years following resolution of polyoma virus nephropathy.

    Science.gov (United States)

    Salvatore, Steven P; Myers-Gurevitch, Patricia M; Chu, Stacy; Robinson, Brian D; Dadhania, Darshana; Seshan, Surya V

    2016-03-01

    A direct role for BK polyomavirus infection in malignant tumors of renal allografts and urinary tract is emerging. Case reports suggest a link between BK virus (BKV) reactivation and development of malignancy in renal allograft recipients. Herein we describe the first case of BKV positive invasive urothelial carcinoma within the renal allograft, presenting with chronic diarrhea and weight loss 5 years following resolution of BK viremia/nephropathy (BKVN). Unique to our case was the remote history of BK viremia/BKVN, rising titer of anti-HLA antibody and presence of renal limited urothelial carcinoma with microinvasion of malignant cells staining positive for SV40 large T antigen (T-Ag). These findings suggest that persistence of subclinical BKV infection within the renal allograft may play a role in the malignant transformation of epithelial cells. Patients with history of BKVN may be at risk for kidney and urinary tract malignancy despite resolution of BK viremia/BKVN.

  16. Functional characterization of three ethylene response factor genes from Bupleurum kaoi indicates that BkERFs mediate resistance to Botrytis cinerea.

    Science.gov (United States)

    Liu, Wen-Yu; Chiou, Shu-Jiau; Ko, Chia-Yun; Lin, Tsai-Yun

    2011-03-01

    Three novel ethylene response factor (ERF) genes, BkERF1, BkERF2.1 and BkERF2.2, were isolated from a medicinal plant, Bupleurum kaoi. The deduced BkERFs contain a canonical nuclear localization signal and an ERF/AP2 DNA binding domain. RNA gel blot analysis revealed that BkERF1 and BkERF2.1 were ubiquitously expressed at low levels in all parts of mature plants, and that BkERF2.2 was expressed at moderate levels in vegetative tissues. Exogenous application of methyl jasmonate induced BkERF1/2.1/2.2 transcripts. BkERF2.2 transcript levels were slightly increased by addition of ethephon and salicylic acid. BkERFs were localized in the plant nucleus and functioned as transcriptional activators. In B. kaoi cells overexpressing BKERFs, inoculation with Botrytis cinerea increased expression of some defense genes which are associated with enhanced disease resistance. Similarly, overexpression of BkERFs in transgenic Arabidopsis thaliana resulted in elevated mRNA levels of the defense gene PDF1.2, and in enhanced resistance to B. cinerea. Collectively, these results provide evidence that BkERFs mediate the expression of defense-related genes in plants.

  17. Fusion and quasifission dynamics in the reactions 48Ca+249Bk and 50Ti+249Bk using a time-dependent Hartree-Fock approach

    Science.gov (United States)

    Umar, A. S.; Oberacker, V. E.; Simenel, C.

    2016-08-01

    Background: Synthesis of superheavy elements (SHEs) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHEs have been recently produced with doubly-magic 48Ca beams. However, SHE synthesis experiments with single-magic 50Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for Z =117 ,119 superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in 48Ca,50Ti+249Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleus-nucleus potentials, nuclear contact times, masses and charges of the fragments, as well as their kinetic and excitation energies strongly depend on the orientation of the prolate 249Bk nucleus. Long contact times associated with fusion are observed in collisions of both projectiles with the side of the 249Bk nucleus, but not on collisions with its tip. The energy and impact parameter dependencies of the fragment properties, as well as their mass-angle and mass-total kinetic energy correlations are investigated. Conclusions: Entrance channel reaction dynamics are similar with both 48Ca and 50Ti projectiles. Both are expected to lead to the formation of a compound nucleus by fusion if they have enough energy to get in contact with the side of the 249Bk target.

  18. Evaluation of polyomavirus BK reactivation in lupus patients who underwent kidney transplantation

    Directory of Open Access Journals (Sweden)

    Cristina Costa

    2012-06-01

    Full Text Available Background. A pathogenic role for polyomavirus BK in systemic lupus erythematosus (SLE has been proposed, however no study evaluated the occurrence of BK replication in renal transplant recipients according to the underlying disease leading to transplantation and its potential impact. Methods. The occurrence of BK reactivation was serially evaluated in 468 renal transplant recipients, including 11 patients with SLE as underlying disease (overall, 2370 serum and 2370 urine specimens; 65 from SLE patients. Results. Considering the overall occurrence of viral reactivation (viremia and/or viruria, 26/65 (40% specimens were positive in four SLE patients (36.3% versus 331/2143 (15.4% in 130/227 (57.3% non-SLE patients. A patient transplanted for class III lupus nephritis evidenced sustained BK viremia and viruria (with viremia values potentially indicative of polyomavirus-associated nephropathy in the absence of clinical features of renal dysfunction or recurrence of lupus nephritis. Conclusions. Further studies on larger populations and for a longer follow-up should be required to evaluate the impact of BKV reactivation in renal transplant patients with SLE as underlying disease, as well as the potential therapeutic implications.

  19. The Disappearance of the Red Supergiant Progenitor of Supernova 2008bk

    OpenAIRE

    Mattila, Seppo; Smartt, Stephen; Maund, Justyn; Benetti, Stefano; Ergon, Mattias

    2010-01-01

    Massive stars end their lives in spectacular supernova explosions. Identifying the progenitor star is a test of stellar evolution and explosion models. Here we show that the progenitor star of the supernova SN 2008bk has now disappeared, which provides conclusive evidence that this was the death of a red supergiant star.

  20. Test du Module BECKHOFF (BK7420) Entrées/Sorties deportees sur FIPIO de SCHNEIDER

    CERN Document Server

    Palluel, J; CERN. Geneva. AB Department

    2004-01-01

    Cette note présente le test du nouveau coupleur I/O déporté sur FIPIO de Beckhoff référencé BK7420 (voir photo ci-dessous), et notamment son évaluation sur différentes longueurs par rapport à un module semblable de Schneider (Momentum 170 FNT 110 01).

  1. New properties of BK-spaces defined by using regular matrix of Fibonacci numbers

    Science.gov (United States)

    Ercan, Sinan; Bektaş, ćiǧdem A.

    2016-06-01

    In the present paper, we studied the new properties of BK-spaces which were defined using regular matrix of Fibonacci numbers in [1]. We computed alpha-, beta-, gamma- duals of these spaces and obtained Schauder basis. We also derived some topological properties of these spaces.

  2. Ca(2+)-BK channel clusters in olfactory receptor neurons and their role in odour coding.

    Science.gov (United States)

    Bao, Guobin; de Jong, Daniëlle; Alevra, Mihai; Schild, Detlev

    2015-12-01

    Olfactory receptor neurons (ORNs) have high-voltage-gated Ca(2+) channels whose physiological impact has remained enigmatic since the voltage-gated conductances in this cell type were first described in the 1980s. Here we show that in ORN somata of Xenopus laevis tadpoles these channels are clustered and co-expressed with large-conductance potassium (BK) channels. We found approximately five clusters per ORN and twelve Ca(2+) channels per cluster. The action potential-triggered activation of BK channels accelerates the repolarization of action potentials and shortens interspike intervals during odour responses. This increases the sensitivity of individual ORNs to odorants. At the level of mitral cells of the olfactory bulb, odour qualities have been shown to be coded by first-spike-latency patterns. The system of Ca(2+) and BK channels in ORNs appears to be important for correct odour coding because the blockage of BK channels not only affects ORN spiking patterns but also changes the latency pattern representation of odours in the olfactory bulb.

  3. First Spanish series of intestinal transplantation in adult recipients Primera serie nacional de trasplante de intestino en receptores adultos

    Directory of Open Access Journals (Sweden)

    J. C. Meneu Díaz

    2006-10-01

    Full Text Available Background: short-bowel transplantation has experienced a substantial growth worldwide following improved results from the late 1990s on, and its coverage by Medicare. According to the International Registry (1985-2005, a total of 1,292 intestinal trasplants for 1,210 patients in 65 hospitals across 20 countries have been carried out thus far. Objective: to know short-term (6 months results regarding patient and graft survival from the first Spanish series of intestinal transplants in adult recipients. Material and methods: we present our experience in the assessment of 20 potential candidates to short-bowel transplantation between June 2004 and October 2005. Of these, 10 patients were rejected and 4 were transplanted, which makes up the sample of our study. Results: to this date 5 transplants have been carried out in 4 patients (2 retransplants, 2 desmoid tumors, 1 short bowel syndrome after excision as a result of mesenteric ischemia. Upon study completion and after a mean follow-up of 180 days (range 90-190 days all recipients are alive, and all grafts but one (75% are fully operational, with complete digestive autonomy. All patients received induction with alemtuzumab except one, who received thymoglobulin; in all induction was initiated with no steroids. Conclusions: intestinal transplantation represents a therapeutic option that is applicable in our setting and valid for recipients with an indication who have no other feasible alternative to keep their intestinal failure under control.

  4. Similar enhancement of BK(Ca) channel function despite different aerobic exercise frequency in aging cerebrovascular myocytes.

    Science.gov (United States)

    Li, N; Liu, B; Xiang, S; Shi, L

    2016-07-18

    Aerobic exercise showed beneficial influence on cardiovascular systems in aging, and mechanisms underlying vascular adaption remain unclear. Large-conductance Ca(2+)-activated K(+) (BK(Ca)) channels play critical roles in regulating cellular excitability and vascular tone. This study determined the effects of aerobic exercise on aging-associated functional changes in BK(Ca) channels in cerebrovascular myocytes, Male Wistar rats aged 20-22 months were randomly assigned to sedentary (O-SED), low training frequency (O-EXL), and high training frequency group (O-EXH). Young rats were used as control. Compared to young rats, whole-cell BK(Ca) current was decreased, and amplitude of spontaneous transient outward currents were reduced. The open probability and Ca(2+)/voltage sensitivity of single BK(Ca) channel were declined in O-SED, accompanied with a reduction of tamoxifen-induced BK(Ca) activation; the mean open time of BK(Ca) channels was shortened whereas close time was prolonged. Aerobic exercise training markedly alleviated the aging-associated decline independent of training frequency. Exercise three times rather than five times weekly may be a time and cost-saving training volume required to offer beneficial effects to offset the functional declines of BK(Ca) during aging. PMID:27070745

  5. Putative calcium-binding domains of the Caenorhabditis elegans BK channel are dispensable for intoxication and ethanol activation.

    Science.gov (United States)

    Davis, S J; Scott, L L; Ordemann, G; Philpo, A; Cohn, J; Pierce-Shimomura, J T

    2015-07-01

    Alcohol modulates the highly conserved, voltage- and calcium-activated potassium (BK) channel, which contributes to alcohol-mediated behaviors in species from worms to humans. Previous studies have shown that the calcium-sensitive domains, RCK1 and the Ca(2+) bowl, are required for ethanol activation of the mammalian BK channel in vitro. In the nematode Caenorhabditis elegans, ethanol activates the BK channel in vivo, and deletion of the worm BK channel, SLO-1, confers strong resistance to intoxication. To determine if the conserved RCK1 and calcium bowl domains were also critical for intoxication and basal BK channel-dependent behaviors in C. elegans, we generated transgenic worms that express mutated SLO-1 channels predicted to have the RCK1, Ca(2+) bowl or both domains rendered insensitive to calcium. As expected, mutating these domains inhibited basal function of SLO-1 in vivo as neck and body curvature of these mutants mimicked that of the BK null mutant. Unexpectedly, however, mutating these domains singly or together in SLO-1 had no effect on intoxication in C. elegans. Consistent with these behavioral results, we found that ethanol activated the SLO-1 channel in vitro with or without these domains. By contrast, in agreement with previous in vitro findings, C. elegans harboring a human BK channel with mutated calcium-sensing domains displayed resistance to intoxication. Thus, for the worm SLO-1 channel, the putative calcium-sensitive domains are critical for basal in vivo function but unnecessary for in vivo ethanol action.

  6. Surveillance of polyomavirus BK in relation to immunosuppressive therapy in kidney transplantation

    Directory of Open Access Journals (Sweden)

    Cristina Costa

    2012-03-01

    Full Text Available Introduction. Reactivation of polyomavirus BK in kidney transplant recipients has been associated to the development of nephropathy (polyomavirus-associated nephropathy, PVAN, possibly leading to the loss of the transplanted organ. Immunosuppression is the condicio sine qua non for the onset of PVAN; however, a lower incidence of BK viremia has been reported with low-level tacrolimus based immunosuppressive protocols in comparison to cyclosporine A.Aim of this study was to compare the two immunosuppressive protocols. Methods. Virological monitoring of BK was performed in 468 consecutive renal transplant patients over a period of 3 years (2370 urine e 2370 serum specimens: in particular, 1780 specimens from 362 patients treated with tacrolimus and 590 from 106 treated with cyclosporine A. Results. BK viremia was evidenced in 124 (7.0% and 12 (2.0% specimens from 40 (11.0% and 11 (10.4% patients treated with tacrolimus and cyclosporine A, respectively; similarly, BK viruria in 289 (16.2% and 58 (9.8% specimens from 67 (18.5% and 27 (25.5% patients, being the difference of incidence highly significant (p <0.0001 for both viremia and viruria at comparison between specimens and not significant for patients. No case of PVAN was diagnosed at histophatology evaluation. Conclusions. The incidence of viremia and viruria was similar to that previously reported. Our results evidenced that with low-level tacrolimus-based protocols the overall incidence of reactivation in renal transplant patients is not significantly different and there is no increased risk of PVAN, nevertheless the higher incidence of episodes of reactivation.

  7. Intermediate-dose cidofovir without probenecid in the treatment of BK virus allograft nephropathy.

    Science.gov (United States)

    Araya, Carlos E; Lew, Judy F; Fennell, Robert S; Neiberger, Richard E; Dharnidharka, Vikas R

    2006-02-01

    BK virus allograft nephropathy (BKVAN) is a rising complication in kidney transplant recipients. Reducing immunosuppression has been the initial form of therapy in most cases, but is not always associated with improvement in graft function. Anti-viral therapy with low-dose cidofovir (0.25-0.42 mg/kg/dose) has been used successfully in some patients, but dose-related nephrotoxicity has limited its use. We present our experience with 3 kidney transplant recipients diagnosed with BKVAN who received intermediate-dose cidofovir (0.75-1.0 mg/kg/dose) without probenecid, and without concomitant nephrotoxicity. Three female patients, ages 8, 19 and 20 yr, presented with elevated serum creatinine (SCr) values, BK virus stain positive on renal biopsy and high plasma BK viral loads. As a result of viral loads being >2 million copies/ml in two patients and a lack of response to reduction in immunosuppression in the third, we initiated therapy with low-dose cidofovir. Because of persistent positive BK stain and positive plasma viral load, we then administered intermediate-dose cidofovir, without probenecid, for several subsequent doses (seven to 15 infusions till date). All patients tolerated the intermediate-dose cidofovir with no significant rise in SCr during the course of the infusions. The most recent SCr values in all three patients were improved from those at the initial diagnosis of BKVAN. All three patients showed a marked drop in BK viral loads when on intermediate-dose cidofovir, with complete clearing of viremia in two patients. In our experience, intermediate-dose cidofovir without probenecid, used judiciously, is not associated with additional nephrotoxicity and may provide an additional alternative for treatment. PMID:16499584

  8. Ethanol modulation of mammalian BK channels in excitable tissues: molecular targets and their possible contribution to alcohol-induced altered behavior

    Directory of Open Access Journals (Sweden)

    Alex M. Dopico

    2014-12-01

    Full Text Available In most tissues, the function of calcium- and voltage-gated potassium (BK channels is modified in response to ethanol concentrations reached in human blood during alcohol intoxication. In general, modification of BK current from ethanol-naïve preparations in response to brief ethanol exposure results from changes in channel open probability without modification of unitary conductance or change in BK protein levels in the membrane. Protracted and/or repeated ethanol exposure, however, may evoke changes in BK expression. The final ethanol effect on BK open probability leading to either BK current potentiation or BK current reduction is determined by an orchestration of molecular factors, including levels of activating ligand (cytosolic calcium, BK subunit composition and posttranslational modifications, and the channel’s lipid microenvironment. These factors seem to allosterically regulate a direct interaction between ethanol and a recognition pocket of discrete dimensions recently mapped to the channel-forming (slo1 subunit. Type of ethanol exposure also plays a role in the final BK response to the drug: in several central nervous system regions (e.g., striatum, primary sensory neurons, and supraoptic nucleus, acute exposure to ethanol reduces neuronal excitability by enhancing BK activity. In contrast, protracted or repetitive ethanol administration may alter BK subunit composition and membrane expression, rendering the BK complex insensitive to further ethanol exposure. In neurohypophysial axon terminals, ethanol potentiation of BK channel activity leads to a reduction in neuropeptide release. In vascular smooth muscle, however, ethanol inhibition of BK current leads to cell contraction and vascular constriction.

  9. Algunos aspectos éticos de la donación y el trasplante Some ethical aspects of donation and transplantation

    Directory of Open Access Journals (Sweden)

    K. Martínez

    2006-08-01

    Full Text Available El consenso ético y legal en nuestro país basa la práctica de las donaciones y los trasplantes en diversos principios éticos, recogidos en la legislación, muy acordes con los cuatro principios de la bioética principialista: autonomía, beneficencia, no-maleficencia y justicia. El nivel de donaciones conseguido en nuestro medio podría, de hecho, estar relacionado con el estricto respeto de los mismos por parte de los profesionales sanitarios así como con la excelente organización del mundo del trasplante. Muchos han sido los retos científicos, técnicos y éticos a los que se ha tenido que dar respuesta para llegar a la situación actual del trasplante. Y muchos siguen siendo los retos actuales. En el artículo se analizan sólamente algunos, por su repercusión técnica, ética y social: los trasplantes de órganos de donante vivo, la solicitud pública de órganos, el mercado de órganos, los trasplantes de órganos no vitales (fundamentalmente el trasplante de cara, la utilización de células troncales y los bancos de células de cordón umbilical. El objetivo del escrito es el de enunciar los problemas éticos que estas nuevas prácticas despiertan para intentar sentar las bases de una deliberación moral que necesariamente ha de involucrar a toda la sociedad.Ethical and legal consensus in our country bases the practice of donations and transplants on different ethical principles, which are contained in the legislation, closely conforming to the four principles of principialist bioethics: autonomy, beneficence, non-maleficence, and justice. The level of donations achieved in our milieu might, in fact, be related to a strict respect for these principles by the health professionals, as well as to the excellent organisation of the transplant world. Many scientific, technical and ethical challenges have had to be met to reach the present state of the transplant. And there are many current challenges. The article only analyses some of

  10. Análisis del perfil de los estudiantes de enfermería en Polonia relacionado con la donación y trasplante de órganos

    OpenAIRE

    Mikla, Marzena

    2016-01-01

    Introducción y objetivos: El trasplante de órganos es, en muchos casos, el único método alternativo terapéuticamente eficaz. El proceso de donación y trasplante conlleva la participación de numerosos profesionales de salud, tanto a nivel hospitalario como extrahospitalario. Actitudes positivas o negativas hacia el mismo, trasmitidas por enfermeras, médicos y otros profesionales de la salud, influyen de forma convincente y definitiva en las familias que pasan por la terrible experiencia de...

  11. Análisis del perfil de los estudiantes de enfermería en Polonia relacionado con la donación y trasplante de órganos

    OpenAIRE

    Mikla, Marzena

    2016-01-01

    Introducción y objetivos: El trasplante de órganos es, en muchos casos, el único método alternativo terapéuticamente eficaz. El proceso de donación y trasplante conlleva la participación de numerosos profesionales de salud, tanto a nivel hospitalario como extrahospitalario. Actitudes positivas o negativas hacia el mismo, trasmitidas por enfermeras, médicos y otros profesionales de la salud, influyen de forma convincente y definitiva en las familias que pasan por la terrible experiencia de una...

  12. Enfermedad pulmonar obstructiva crónica y trasplante pulmonar. Resultados y análisis de factores pronósticos

    OpenAIRE

    Cerón Navarro, Jose A.

    2012-01-01

    Estudio observacional, analítico y retrospectivo de los pacientes diagnosticados de enfermedad pulmonar obstructiva crónica (EPOC) sometidos a trasplante pulmonar (TP) en el Hospital Universitario La Fe desde 1991 hasta 2008. Tras la recogida de variables relacionadas con el receptor, el donante, el procedimiento quirúrgico y el seguimiento, precoz y a largo plazo, se obtuvo una muestra de 107 pacientes, con un predominio de varones en torno a los 52 años de edad. La capacidad funcional r...

  13. Urological management (medical and surgical of BK-virus associated haemorrhagic cystitis in children following haematopoietic stem cell transplantation

    Directory of Open Access Journals (Sweden)

    Nikhil Vasdev

    2013-10-01

    Full Text Available Aim: Haemorrhagic cystitis (HC is uncommon and in its severe form potentially life threatening complication of Haematopoietic stem cell transplantation (HSCT in children. We present our single centre experience in the urological management of this clinically challenging condition. Patients and Methods: Fourteen patients were diagnosed with BK-Virus HC in our centre. The mean age at diagnosis was 8.8 years (range, 3.2-18.4 years. The mean number of days post-BMT until onset of HC was 20.8 (range, 1 – 51. While all patients tested urine positive for BKV at the clinical onset of HC, only four patients had viral quantification, with viral loads ranging from 97,000 to >1 billion/ml. 8 patients had clinical HC. Ten patients experienced acute GVHD (grade I: 6 patients, grade II: 3 patients, grade 4: 1 patient.Results: Four patients received medical management for their HC. Treatments included hyperhydration, MESNA, blood and platelet transfusion, premarin and oxybutynin (Table 6.  Two patients received both medical and surgical management which included cystoscopy with clot evacuation, bladder irrigation and supra-pubic catheter insertion. One patient received exclusive surgical management. Seven patients were treated conservatively. Conclusion: There is limited available evidence for other potential therapeutic strategies highlighting the need for more research into the pathophysiology of HSCT-associated HC. Commonly used interventions with possible clinical benefit (e.g. cidofovir, ciprofloxacin still require to be evaluated in multi-centre, high-quality studies. Potential future preventative and therapeutic options, such as modulation of conditioning, immunosuppression and engraftment, new antiviral and anti-inflammatory and less nephrotoxic agents need to be assessed.---------------------------Cite this article as:Vasdev N, Davidson A, Harkensee C, Slatter M, Gennery A, Willetts I, Thorpe A.Urological management (medical and surgical of BK

  14. Pabellón de trasplantes en el hospital general de Edimburgo, Gran Bretaña

    Directory of Open Access Journals (Sweden)

    Womersley, P.

    1970-11-01

    Full Text Available The set of buildings includes a medical wing, an administrative wing, and a slightly elevated passage, which connects the Nuffield Foundation with the Hospital, through which patients and donants are taken from the Hospital to the Pavillion. The body of the building, which is tower shaped, has stairs, a lift, water tanks; and in the semi-basement there are mechanical, sanitary, and air conditioning installations. This pavillion has been specially designed to carry out human transplants, mainly kidneys, and meets present complex technical needs in this branch of surgery. From the aesthetic aspect, the total designs gives the visitor the impression of safety and airiness, and induces a sensation of confidence.El conjunto construido consta de: un ala médica; un ala administrativa; y un paso ligeramente elevado, que une Nuffield con el Hospital, utilizado para el traslado de pacientes y donantes desde el Hospital al Pabellón. El cuerpo de edificio, con aspecto de «torre», contiene: la escalera, el ascensor, el depósito de agua, etc.; el semisótano alberga: los equipos mecánicos y los servicios de las instalaciones sanitarias, aire acondicionado, etc. Ha sido especialmente diseñado para realizar operaciones de trasplante de órganos humanos, en particular de riñon, y satisface adecuadamente las complejas exigencias técnicas que reclamaban los recientes avances en esta rama de la cirugía. Desde el punto de vista estético, el conjunto construido produce en el espectador una sensación segura y etérea, que lo hace sumamente atractivo.

  15. NS19504: a novel BK channel activator with relaxing effect on bladder smooth muscle spontaneous phasic contractions.

    Science.gov (United States)

    Nausch, Bernhard; Rode, Frederik; Jørgensen, Susanne; Nardi, Antonio; Korsgaard, Mads P G; Hougaard, Charlotte; Bonev, Adrian D; Brown, William D; Dyhring, Tino; Strøbæk, Dorte; Olesen, Søren-Peter; Christophersen, Palle; Grunnet, Morten; Nelson, Mark T; Rønn, Lars C B

    2014-09-01

    Large-conductance Ca(2+)-activated K(+) channels (BK, KCa1.1, MaxiK) are important regulators of urinary bladder function and may be an attractive therapeutic target in bladder disorders. In this study, we established a high-throughput fluorometric imaging plate reader-based screening assay for BK channel activators and identified a small-molecule positive modulator, NS19504 (5-[(4-bromophenyl)methyl]-1,3-thiazol-2-amine), which activated the BK channel with an EC50 value of 11.0 ± 1.4 µM. Hit validation was performed using high-throughput electrophysiology (QPatch), and further characterization was achieved in manual whole-cell and inside-out patch-clamp studies in human embryonic kidney 293 cells expressing hBK channels: NS19504 caused distinct activation from a concentration of 0.3 and 10 µM NS19504 left-shifted the voltage activation curve by 60 mV. Furthermore, whole-cell recording showed that NS19504 activated BK channels in native smooth muscle cells from guinea pig urinary bladder. In guinea pig urinary bladder strips, NS19504 (1 µM) reduced spontaneous phasic contractions, an effect that was significantly inhibited by the specific BK channel blocker iberiotoxin. In contrast, NS19504 (1 µM) only modestly inhibited nerve-evoked contractions and had no effect on contractions induced by a high K(+) concentration consistent with a K(+) channel-mediated action. Collectively, these results show that NS19504 is a positive modulator of BK channels and provide support for the role of BK channels in urinary bladder function. The pharmacologic profile of NS19504 indicates that this compound may have the potential to reduce nonvoiding contractions associated with spontaneous bladder overactivity while having a minimal effect on normal voiding.

  16. Expression of BK Ca channels and the modulatory beta-subunits in the rat and porcine trigeminal ganglion

    DEFF Research Database (Denmark)

    Johansson, Helle Wulf; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways and the c......Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways...... and the cerebral arteries. We hypothesize that BK(Ca) channel alpha- and beta-subunits are present in the rat and porcine trigeminal ganglion (TG) thus enabling a role in migraine. BK(Ca) channel mRNA was detected using reverse transcription polymerase chain reaction (RT-PCR) and in situ hybridization. BK(Ca...... revealed beta2- and beta 4-subunit proteins in rat and porcine TG. The present study showed BK(Ca) channel expression in rat and porcine TG. The main modulatory beta-subunits detected in TG of both species were beta2- and beta 4-subunits....

  17. The impact of surveillance and rapid reduction in immunosuppression to control BK virus-related graft injury in kidney transplantation.

    Science.gov (United States)

    Elfadawy, Nissreen; Flechner, Stuart M; Liu, Xiaobo; Schold, Jesse; Tian, Devin; Srinivas, Titte R; Poggio, Emilio; Fatica, Richard; Avery, Robin; Mossad, Sherif B

    2013-08-01

    We prospectively screened 609 consecutive kidney (538) and kidney-pancreas (71) transplant recipients for BK viremia over a 4-year interval using polymerase chain reaction viral load detection and protocol kidney biopsies. We found that BK viremia is common at our center: total cases 26.7%, cases during first year 21.3% (mean 4 months), and recipients with ≥ 10 000 copies/ml 12.3%. We found few predictive clinical or demographic risk factors for any BK viremia or viral loads ≥ 10,000 copies/ml, other than prior treatment of biopsy confirmed acute rejection and/or higher immunosuppressive blood levels of tacrolimus (P = 0.001) or mycophenolate mofetil (P = 0.007). Viral loads at diagnosis (185 000 copies/ml at diagnosis were predictive of BK virus-associated nephropathy (BKVAN; OR: 113.25, 95% CI: 17.22-744.6, P < 0.001). Surveillance for BK viremia and rapid reduction of immunosuppression limited the incidence of BKVAN to 1.3%. The addition of leflunomide or ciprofloxacin to immunosuppressive dose reduction did not result in greater rates of viral clearance. These data support the role of early surveillance for BK viremia to limit the impact on transplant outcome, although the most effective schedule for screening awaits further investigation. PMID:23763289

  18. An Association between BK Virus Replication in Bone Marrow and Cytopenia in Kidney-Transplant Recipients

    OpenAIRE

    Emilie Pambrun; Catherine Mengelle; Geneviève Fillola; Patrick Laharrague; Laure Esposito; Isabelle Cardeau-Desangles; Arnaud Del Bello; Jacques Izopet; Lionel Rostaing; Nassim Kamar

    2014-01-01

    The human polyomavirus BK (BKV) is associated with severe complications, such as ureteric stenosis and polyomavirus-associated nephropathy (PVAN), which often occur in kidney-transplant patients. However, it is unknown if BKV can replicate within bone marrow. The aim of this study was to search for BKV replication within the bone marrow of kidney-transplant patients presenting with a hematological disorder. Seventy-two kidney-transplant patients underwent bone-marrow aspiration for cytopenia....

  19. BK/TD models for analyzing in vitro impedance data on cytotoxicity

    OpenAIRE

    Teng, Sophie; Barcellini-Couget, Sylvie; Beaudoin, Rémy; Desousa, Georges; Rahmani, Roger; Pery, Alexandre

    2015-01-01

    The ban of animal testing has enhanced the development of new in vitro technologies for cosmetics safety assessment. Impedance metrics is one such technology which enables monitoring of cell viability in real time. However, analyzing real time data requires moving from static to dynamic toxicity assessment. In the present study, we built mechanistic biokinetic/toxicodynamic (BK/TD) models to analyze the time course of cell viability in cytotoxicity assay using impedance. These models accou...

  20. Restriction of Human Polyomavirus BK Virus DNA Replication in Murine Cells and Extracts

    OpenAIRE

    Mahon, C.; Liang, B.; Tikhanovich, I.; et al

    2009-01-01

    BK virus (BKV) causes persistent and asymptomatic infections in most humans and is the etiologic agent of polyomavirus-associated nephropathy (PVAN) and other pathologies. Unfortunately, there are no animal models with which to study activation of BKV replication in the human kidney and the accompanying PVAN. Here we report studies of the restriction of BKV replication in murine cells and extracts and the cause(s) of this restriction. Upon infection of murine cells, BKV expressed large T anti...

  1. SLO BK Potassium Channels Couple Gap Junctions to Inhibition of Calcium Signaling in Olfactory Neuron Diversification.

    Science.gov (United States)

    Alqadah, Amel; Hsieh, Yi-Wen; Schumacher, Jennifer A; Wang, Xiaohong; Merrill, Sean A; Millington, Grethel; Bayne, Brittany; Jorgensen, Erik M; Chuang, Chiou-Fen

    2016-01-01

    The C. elegans AWC olfactory neuron pair communicates to specify asymmetric subtypes AWCOFF and AWCON in a stochastic manner. Intercellular communication between AWC and other neurons in a transient NSY-5 gap junction network antagonizes voltage-activated calcium channels, UNC-2 (CaV2) and EGL-19 (CaV1), in the AWCON cell, but how calcium signaling is downregulated by NSY-5 is only partly understood. Here, we show that voltage- and calcium-activated SLO BK potassium channels mediate gap junction signaling to inhibit calcium pathways for asymmetric AWC differentiation. Activation of vertebrate SLO-1 channels causes transient membrane hyperpolarization, which makes it an important negative feedback system for calcium entry through voltage-activated calcium channels. Consistent with the physiological roles of SLO-1, our genetic results suggest that slo-1 BK channels act downstream of NSY-5 gap junctions to inhibit calcium channel-mediated signaling in the specification of AWCON. We also show for the first time that slo-2 BK channels are important for AWC asymmetry and act redundantly with slo-1 to inhibit calcium signaling. In addition, nsy-5-dependent asymmetric expression of slo-1 and slo-2 in the AWCON neuron is necessary and sufficient for AWC asymmetry. SLO-1 and SLO-2 localize close to UNC-2 and EGL-19 in AWC, suggesting a role of possible functional coupling between SLO BK channels and voltage-activated calcium channels in AWC asymmetry. Furthermore, slo-1 and slo-2 regulate the localization of synaptic markers, UNC-2 and RAB-3, in AWC neurons to control AWC asymmetry. We also identify the requirement of bkip-1, which encodes a previously identified auxiliary subunit of SLO-1, for slo-1 and slo-2 function in AWC asymmetry. Together, these results provide an unprecedented molecular link between gap junctions and calcium pathways for terminal differentiation of olfactory neurons.

  2. BK channels regulate spontaneous action potential rhythmicity in the suprachiasmatic nucleus.

    Directory of Open Access Journals (Sweden)

    Jack Kent

    Full Text Available BACKGROUND: Circadian ( approximately 24 hr rhythms are generated by the central pacemaker localized to the suprachiasmatic nucleus (SCN of the hypothalamus. Although the basis for intrinsic rhythmicity is generally understood to rely on transcription factors encoded by "clock genes", less is known about the daily regulation of SCN neuronal activity patterns that communicate a circadian time signal to downstream behaviors and physiological systems. Action potentials in the SCN are necessary for the circadian timing of behavior, and individual SCN neurons modulate their spontaneous firing rate (SFR over the daily cycle, suggesting that the circadian patterning of neuronal activity is necessary for normal behavioral rhythm expression. The BK K(+ channel plays an important role in suppressing spontaneous firing at night in SCN neurons. Deletion of the Kcnma1 gene, encoding the BK channel, causes degradation of circadian behavioral and physiological rhythms. METHODOLOGY/PRINCIPAL FINDINGS: To test the hypothesis that loss of robust behavioral rhythmicity in Kcnma1(-/- mice is due to the disruption of SFR rhythms in the SCN, we used multi-electrode arrays to record extracellular action potentials from acute wild-type (WT and Kcnma1(-/- slices. Patterns of activity in the SCN were tracked simultaneously for up to 3 days, and the phase, period, and synchronization of SFR rhythms were examined. Loss of BK channels increased arrhythmicity but also altered the amplitude and period of rhythmic activity. Unexpectedly, Kcnma1(-/- SCNs showed increased variability in the timing of the daily SFR peak. CONCLUSIONS/SIGNIFICANCE: These results suggest that BK channels regulate multiple aspects of the circadian patterning of neuronal activity in the SCN. In addition, these data illustrate the characteristics of a disrupted SCN rhythm downstream of clock gene-mediated timekeeping and its relationship to behavioral rhythms.

  3. BK virus encephalopathy and sclerosing vasculopathy in a patient with hypohidrotic ectodermal dysplasia and immunodeficiency

    OpenAIRE

    Darbinyan, Armine; Major, Eugene O.; Morgello, Susan; Holland, Steven; Ryschkewitsch, Caroline; Monaco, Maria Chiara; Naidich, Thomas P.; Bederson, Joshua; Malaczynska, Joanna; Ye, Fei; Gordon, Ronald; Cunningham-Rundles, Charlotte; Fowkes, Mary; Tsankova, Nadejda M.

    2016-01-01

    Human BK polyomavirus (BKV) is reactivated under conditions of immunosuppression leading most commonly to nephropathy or cystitis; its tropism for the brain is rare and poorly understood. We present a unique case of BKV-associated encephalopathy in a man with hypohidrotic ectodermal dysplasia and immunodeficiency (HED-ID) due to IKK-gamma (NEMO) mutation, who developed progressive neurological symptoms. Brain biopsy demonstrated polyomavirus infection of gray and white matter, with predominan...

  4. A non-cardiomyocyte autonomous mechanism of cardioprotection involving the SLO1 BK channel

    Directory of Open Access Journals (Sweden)

    Andrew P. Wojtovich

    2013-03-01

    Full Text Available Opening of BK-type Ca2+ activated K+ channels protects the heart against ischemia-reperfusion (IR injury. However, the location of BK channels responsible for cardioprotection is debated. Herein we confirmed that openers of the SLO1 BK channel, NS1619 and NS11021, were protective in a mouse perfused heart model of IR injury. As anticipated, deletion of the Slo1 gene blocked this protection. However, in an isolated cardiomyocyte model of IR injury, protection by NS1619 and NS11021 was insensitive to Slo1 deletion. These data suggest that protection in intact hearts occurs by a non-cardiomyocyte autonomous, SLO1-dependent, mechanism. In this regard, an in-situ assay of intrinsic cardiac neuronal function (tachycardic response to nicotine revealed that NS1619 preserved cardiac neurons following IR injury. Furthermore, blockade of synaptic transmission by hexamethonium suppressed cardioprotection by NS1619 in intact hearts. These results suggest that opening SLO1 protects the heart during IR injury, via a mechanism that involves intrinsic cardiac neurons. Cardiac neuronal ion channels may be useful therapeutic targets for eliciting cardioprotection.

  5. Bimane fluorescence scanning suggests secondary structure near the S3-S4 linker of BK channels.

    Science.gov (United States)

    Semenova, Nina P; Abarca-Heidemann, Karin; Loranc, Eva; Rothberg, Brad S

    2009-04-17

    Gating of large conductance Ca(2+)-activated K(+) channels (BK or maxi-K channels) is controlled by a Ca(2+)-sensor, formed by the channel cytoplasmic C-terminal domain, and a voltage sensor, formed by its S0-S4 transmembrane helices. Here we analyze structural properties of a portion of the BK channel voltage sensing domain, the S3-S4 linker, using fluorescence lifetime spectroscopy. Single residues in the S3-S4 linker region were substituted with cysteine, and the cysteine-substituted mutants were expressed in CHO cells and covalently labeled with the sulfhydryl-reactive fluorophore monobromo-trimethylammonio-bimane (qBBr). qBBr fluorescence is quenched by tryptophan and, to a lesser extent, tyrosine side chains. We found that qBBr fluorescence in several of the labeled cysteine-substituted channels shows position-specific quenching, as indicated by increase of the brief lifetime component of the qBBr fluorescence decay. Quenching was reduced with the mutation W203F (in the S4 segment), suggesting that Trp-203 acts as a quenching group. Our results suggest a working hypothesis for the secondary structure of the BK channel S3-S4 region, and places residues Leu-204, Gly-205, and Leu-206 within the extracellular end of the S4 helix.

  6. BK/TD models for analyzing in vitro impedance data on cytotoxicity.

    Science.gov (United States)

    Teng, S; Barcellini-Couget, S; Beaudouin, R; Brochot, C; Desousa, G; Rahmani, R; Pery, A R R

    2015-06-01

    The ban of animal testing has enhanced the development of new in vitro technologies for cosmetics safety assessment. Impedance metrics is one such technology which enables monitoring of cell viability in real time. However, analyzing real time data requires moving from static to dynamic toxicity assessment. In the present study, we built mechanistic biokinetic/toxicodynamic (BK/TD) models to analyze the time course of cell viability in cytotoxicity assay using impedance. These models account for the fate of the tested compounds during the assay. BK/TD models were applied to analyze HepaRG cell viability, after single (48 h) and repeated (4 weeks) exposures to three hepatotoxic compounds (coumarin, isoeugenol and benzophenone-2). The BK/TD models properly fit the data used for their calibration that was obtained for single or repeated exposure. Only for one out of the three compounds, the models calibrated with a single exposure were able to predict repeated exposure data. We therefore recommend the use of long-term exposure in vitro data in order to adequately account for chronic hepatotoxic effects. The models we propose here are capable of being coupled with human biokinetic models in order to relate dose exposure and human hepatotoxicity. PMID:25827406

  7. Systematic study of spatiotemporal dynamics of intense femtosecond laser pulses in BK-7 glass

    Indian Academy of Sciences (India)

    Ram Gopal; V Deepak; S Sivaramakrishnan

    2007-04-01

    In this paper we present a systematic study of the spatial and temporal effects of intense femtosecond laser pulses in BK-7 over a broad range of input powers, 1–1000 times the critical power for self-focusing (cr) by numerically solving the nonlinear Schrödinger equation (NLS). Most numerical studies have not been extended to such high powers. A clear-cut classification of spatio-temporal dynamics up to very high powers into three regimes – the group-velocity dispersion (GVD) regime, the ionization regime and the dominant plasma regime – as done here, is a significant step towards a better understanding. Further, we examine in detail the role of GVD in channel formation by comparing BK-7 to an `artificial' medium. Our investigations bring forth the important observation that diffraction plays a minimal role in the formation of multiple cones and that plasma plays a diffraction-like role at very high powers. A detailed study of the spatio-temporal dynamics in any condensed medium over this range of powers has not been reported hitherto, to the best of our knowledge. We also suggest appropriate operational powers for various applications employing BK-7 on the basis of our results.

  8. BK virus as a potential oncovirus for bladder cancer in a renal transplant patient.

    Science.gov (United States)

    Yin, Wen-Yao; Lee, Ming-Che; Lai, Ning-Sheng; Lu, Ming-Chi

    2015-04-01

    Renal transplant patients have high risk for bladder cancer. The reactivation of BK virus is common in renal transplant patients especially in the urinary tract. There was some evidence suggesting that the reactivation of BK virus (BKV) in renal transplant patients may associate with the development of bladder cancer. Here we demonstrated that a patient that had persistent elevated BKV viruria (urine BKV DNA concentration more than 10(11) copies/ml) after renal transplantation. Then, bladder cancer was found in 13 months after kidney transplantation. The urine BKV DNA concentration was detected by real-time PCR and the BKV DNA in the bladder tumor was detected by PCR. BKV DNA was found in the marginal and central part of the bladder tumor. After removal of the bladder cancer, the urine BKV viral load in this patients dropped dramatically to <10(2) copies/ml. However, the urine viral load had increased modestly to 10(6) copies/ml in 3 months after surgery. Since there is a close correlation between the urine BK viral load and the presence of bladder cancer, we suggested that there might be a causal relationship between the reactivation of BKV and the development of bladder cancer in renal transplant patient.

  9. LA VISIÓN DEL PERSONAL DE SALUD SOBRE LA DONACIÓN Y EL TRASPLANTE DE ÓRGANOS: UNA REVISIÓN DE LA LITERATURA

    Directory of Open Access Journals (Sweden)

    Francisco Javier Mercado-Martínez

    2015-01-01

    Full Text Available El objetivo de este estudio fue revisar los estudios empíricos sobre la visión del personal de salud respecto a la donación y trasplante de órganos. Se hizo una revisión panorámica de la literatura en español, inglés y portugués; realizándose la búsqueda en dos buscadores y ocho bases de datos. El periodo abarca de 1985 al 2013. Se hizo análisis de contenido y frecuencias. De 316 artículos identificados, 248 fueron seleccionados. Según los hallazgos, los trabajos se concentraron en términos temporales y espaciales; predominando aquellos con metodologías cuantitativas. Las publicaciones priorizaron la perspectiva del personal médico y enfermería sobre las de otros actores, como directivos y coordinadores de donación. Las actitudes del personal sanitario hacia la donación de órganos de fallecido fue el tema más estudiado. Se concluye que una producción creciente de tipo cuantitativo analiza la perspectiva de médicos y enfermeras sobre la donación y trasplante de órganos de fallecido.

  10. Ca2+- and voltage-gated potassium (BK) channel activators in the 5β-cholanic acid-3α-ol analogue series with modifications in lateral chain

    OpenAIRE

    Bukiya, Anna N.; Patil, Shivaputra; Li, Wei; Miller, Duane; Dopico, Alex M.

    2012-01-01

    Large conductance, calcium- and voltage-gated potassium (BK) channels regulate various physiological processes and represent an attractive target for drug discovery. Numerous BK channel activators are available. However, these agents usually interact with the ubiquitously distributed channel-forming subunit and thus cannot selectively target a particular tissue. Here, we performed structure-activity relationship study of lithocholic acid (LCA), a cholane that activates BK channels via the acc...

  11. Viabilitas dan Kemampuan Bakteri Kitinolitik Bacillus sp. BK17 dalam Formulasi Tablet untuk Mengurangi Layu Fusarium pada Benih Cabai Merah (Capsicum annuum L.)

    OpenAIRE

    Sitohang, Arance Yoane Itoi Imaulina

    2015-01-01

    Chitinolytic bacteria Bacillus sp. BK17 has been known to inhibit the growth of Fusarium oxysporum on chili seeds. Bacterial cell viability is an important factor in using the cell for biological control. This study was aimed to evaluate viability of chitinolytic bacteria Bacillus sp. BK17 and its potential in tablet formulation as a biological control againstF. oxysporum. Viability of Bacillus sp. BK17 cell was reduced in 40 days of storage. Bacillus sp. BK17 in tablet formulation was able t...

  12. EXPERIMENTACIÓN FETAL, TRASPLANTES, COSMÉTICA Y SU RELACIÓN CON EL ABORTO PROVOCADO

    Directory of Open Access Journals (Sweden)

    José Luis Redondo Calderón

    2012-01-01

    Full Text Available La generalización del aborto provocado da lugar a gran cantidad de células, tejidos y órganos que se emplean en diversos campos de la Medicina bien en investigación o en tratamientos. Entre ellos destacan la Cardiología, Hematología, Metabolismo, Embriología, Neurología, Inmunología, Oftalmología, Dermatología y Trasplantes. También implica a potenciadores del sabor y cosméticos. El utilitarismo ha propiciado que se multipliquen los bancos de células y tejidos procedentes de abortos provocados. Se manipula el lenguaje para su justificación. Surgen unos intereses creados y una complicidad con el aborto por parte de los investigadores y de la sociedad. No pueden separarse como dos actos el aborto y la «donación» de tejido fetal, hay una relación simbiótica ya que se utilizan tejidos frescos. No es posible un consentimiento válido. Se observa la contradicción de que no se desea ni se valora al nasciturus pero sí sus órganos. Cuando se quitan los derechos a alguien es porque se le quiere explotar como a un nuevo esclavo. La investigación debe tener unas bases morales. No debe incrementarse el conocimiento a cualquier precio. No todo lo legal y bien intencionado es moralmente aceptable. El deber de omisión es aplicable. Los medios para alcanzar un objetivo deben ser éticos. Es necesario un esfuerzo educativo para recuperar el respeto al embrión y feto humanos. Algunos progresos técnicos no son conformes a la naturaleza y dignidad humanas. Deben potenciarse la investigación y los tratamientos que demuestren que no recurren a células, tejidos ni órganos procedentes de abortos provocados.

  13. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  14. Source Material and Concentration of Wildfire-Produced Pyrogenic Carbon Influence Post-Fire Soil Nutrient Dynamics

    Directory of Open Access Journals (Sweden)

    Lucas A. Michelotti

    2015-04-01

    Full Text Available Pyrogenic carbon (PyC is produced by the thermal decomposition of organic matter in the absence of oxygen (O. PyC affects nutrient availability, may enhance post-fire nitrogen (N mineralization rates, and can be a significant carbon (C pool in fire-prone ecosystems. Our objectives were to characterize PyC produced by wildfires and examine the influence that contrasting types of PyC have on C and N mineralization rates. We determined C, N, O, and hydrogen (H concentrations and atomic ratios of charred bark (BK, charred pine cones (PC, and charred woody debris (WD using elemental analysis. We also incubated soil amended with BK, PC, and WD at two concentrations for 60 days to measure C and N mineralization rates. PC had greater H/C and O/C ratios than BK and WD, suggesting that PC may have a lesser aromatic component than BK and WD. C and N mineralization rates decreased with increasing PyC concentrations, and control samples produced more CO2 than soils amended with PyC. Soils with PC produced greater CO2 and had lower N mineralization rates than soils with BK or WD. These results demonstrate that PyC type and concentration have potential to impact nutrient dynamics and C flux to the atmosphere in post-fire forest soils.

  15. Trasplante renal y disminución de la mortalidad en los programas de diálisis crónica

    Directory of Open Access Journals (Sweden)

    Walter G. Douthat

    2014-02-01

    Full Text Available El trasplante renal (TR presenta mejor supervivencia, calidad de vida y costos que la diálisis en la insuficiencia renal crónica (IRC. Estudiamos pacientes en diálisis que recibieron TR durante 2010, las causas de finalización del tratamiento y la supervivencia en diálisis. Evaluamos si criterios más amplios para la aceptación de trasplantes hubieran afectado los resultados del procedimiento en ese período. Incluimos 118 pacientes en diálisis, edad media 56.9 ± 18.4 años, tiempo en diálisis 45.5 ± 59.6 meses, 35 (30% presentaban diabetes como causa de IRC, y 58 (49% estaban en espera del TR. Treinta y cuatro finalizaron diálisis, 18 por TR y 12 por fallecimiento. Las principales causas de muerte fueron cardiovasculares, 6 (50% e infecciones, 2 (17%. La supervivencia al año fue 85% para el grupo total, 98% para los pacientes inscriptos en lista de espera y 72% para no inscriptos. Durante 2010 se realizaron 88 TR (62 con donantes cadavéricos [DC], 18 donantes vivos y 8 dobles trasplantes páncreas-riñón. Los receptores de DC tenían en promedio 50.7 años, 67 meses en diálisis, 8 (13% eran diabéticos, 12 (20% con TR previos y 3 cross match contra panel de anticuerpos > 20%. Los donantes tenían edad media 45 años, 28 (45% con criterios expandidos y 27.7 h de isquemia fría. A los 11.4 meses de seguimiento, 13 (21% presentó rechazo agudo, la supervivencia para injerto fue de 88% y 93% para pacientes. La principal causa de finalización de diálisis fue TR, sin detectarse que el empleo de DC afectara la supervivencia del TR.

  16. Experiência com transplante cardíaco heterotópico em pacientes com resistência pulmonar elevada: seguimento tardio Experiencia con trasplante cardíaco heterotópico en pacientes con resistencia pulmonar elevada: seguimiento tardío Experience with heterotopic heart transplantation in patients with elevated pulmonary vascular resistance: late follow-up

    Directory of Open Access Journals (Sweden)

    Jose Henrique Andrade Vila

    2010-02-01

    selecionados.FUNDAMENTO: En los últimos años el número de artículos sobre trasplante cardíaco heterotópico y, en particular, del seguimiento a largo plazo de estos pacientes, ha sido escaso en la literatura, inclusive internacional, lo que llevó al presente relato. OBJETIVO: Relatar la experiencia clínica inicial y la evolución tardía de cuatro pacientes sometidos a trasplante cardíaco heterotópico, su indicación y principales complicaciones. MÉTODOS: Las cirugías se realizaron entre 1992 y 2001, y la indicación de trasplante heterotópico, en todas, fue mediante RVP, variable de 4,8 UW; a 6.5 UW, con gradiente transpulmonar superior a 15 mmHg. En el tercer paciente, se realizó una anastomosis directa entre las arterias pulmonares sin empleo de tubo prostético, y, en el corazón nativo, se realizó una valvuloplastia mitral y aneurismectomía de VI. El esquema inmunosupresor inmediato fue doble, con ciclosporina y azatioprina en los tres primeros pacientes y ciclosporina y micofenolato mofetil en el cuarto paciente. RESULTADOS: Un óbito inmediato por falla del injerto, un óbito luego de dos años y medio por endocarditis en trombo intraventricular en el corazón nativo, y un tercer óbito seis años después del trasplante, por complicaciones postoperatorias de una cirugía en la válvula aórtica del corazón nativo. El restante, 15 años después del trasplante, se encuentra bien, en clase funcional II (NYHA, seis años después de una oclusión quirúrgica de la válvula aórtica del corazón nativo. CONCLUSIÓN: El trasplante cardíaco heterotópico es un procedimiento con resultado inferior al trasplante cardíaco ortotópico, por presentar mayor RVP. Los trombos intraventriculares en el corazón nativo, que exige anticoagulación prolongada, así como las complicaciones de válvula aórtica, también en el corazón nativo, pueden exigir tratamiento quirúrgico. Sin embargo, en un paciente, la sobrevida de 15 años mostró la eficacia a largo plazo de

  17. The role of N-terminal and C-terminal Arg residues from BK on interaction with kinin B2 receptor.

    Science.gov (United States)

    Filippelli-Silva, Rafael; Martin, Renan P; Rodrigues, Eliete S; Nakaie, Clovis R; Oliveira, Laerte; Pesquero, João B; Shimuta, Suma I

    2016-04-01

    Bradykinin (BK) is a nonapeptide important for several physiological processes such as vasodilatation, increase in vascular permeability and release of inflammatory mediators. BK performs its actions by coupling to and activating the B2 receptor, a family A G-protein coupled receptor. Using a strategy which allows systematical monitoring of BK R1 and R9 residues and B2 receptor acidic residues Glu5.35(226) and Asp6.58(298), our study aims at clarifying the BK interaction profile with the B2 receptor [receptor residue numbers are normalized according to Ballesteros and Weinstein, Methods Neurosci. 25 (1995), pp. 366-428) followed by receptor sequence numbering in brackets]. N- and C-terminal analogs of BK (-A1, -G1, -K1, -E1 and BK-A9) were tested against wild type B2, Glu5.35(226)Ala and Asp6.58(298)Ala B2 mutant receptors for their affinity and capability to elicit responses by mechanical recordings of isolated mice stomach fundus, measuring intracellular calcium mobilization, and competitive fluorimetric binding assays. BK showed 2- and 15-fold decreased potency for Glu5.35(226) and Asp6.58(298) B2 mutant receptors, respectively. In B2-Glu5.35(226)Ala BK analogs showed milder reduction in evaluated parameters. On the other hand, in the B2-Asp6.58(298)Ala mutant, no N-terminal analog was able to elicit any response. However, the BK-A9 analog presented higher affinity parameters than BK in the latter mutant. These findings provide enough support for defining a novel interaction role of BK-R9 and Asp6.58(298) receptor residues. PMID:26584354

  18. Erbium-doped ion-exchanged waveguide lasers in BK-7 glass

    OpenAIRE

    Feuchter, T.; Mwarania, E.K.; Wang, J.; Reekie, L.; J. S. Wilkinson

    1992-01-01

    Ion exchange in glass is a simple, flexible, technique to realize optical fiber compatible planar waveguide devices. Recently, neodymium-doped waveguide lasers operating at 1060 and 1300 nm have been demonstrated in this technology. Lasers operating at 1540 nm are desirable for telecommunication applications and we report here, for the first time, ion-exchanged waveguide lasers in erbium-doped glass emitting at this wavelength. Lasers in BK-7 glass doped with 0.5 wt% Er2O3 and pumped at 980 n...

  19. Low-loss waveguides fabricated in BK7 glass by high repetition rate femtosecond fiber laser

    International Nuclear Information System (INIS)

    For the first time femtosecond-laser writing has inscribed low-loss optical waveguides in Schott BK7 glass, a commercially important type of borosilicate widely used in optical applications. The use of a variable repetition rate laser enabled the identification of a narrow processing window at 1 MHz repetition rate with optimal waveguides exhibiting propagation losses of 0.3 dB/cm and efficient mode matching to standard optical fibers at a 1550 nm wavelength. The waveguides were characterized by complementary phase contrast and optical transmission microscopy, identifying a micrometer-sized guiding region within a larger complex structure of both positive and negative refractive index variations

  20. Perspectivas futuras de tratamiento en la insuficiencia cardíaca: del trasplante de células a la regeneración cardíaca

    OpenAIRE

    Prosper, F.; Herreros, J.; J. Barba

    2004-01-01

    En los últimos años hemos asistido a un interés creciente por el tratamiento de la insuficiencia cardíaca mediante el trasplante de células madre. Mientras que los estudios con células madre de músculo (mioblastos) se iniciaron hace más de 10 años, la posibilidad de que las células madre de la médula ósea tengan un enorme potencial de diferenciación y proliferación ha estimulado la investigación con otros tipos de células madre. Estos estudios experimentales han demost...

  1. Las células T reguladoras y su influencia en la sobrevida del trasplante renal Regulatory T cells and their influence in kidney allograft survival

    Directory of Open Access Journals (Sweden)

    Sonia Y. Velásquez

    2007-10-01

    Full Text Available La respuesta inmune desencadenada frente a un trasplante alogénico conduce usualmente a una respuesta efectora que resulta en el rechazo del aloinjerto; sin embargo, algunos individuos mantienen un trasplante funcionante a largo plazo sin signos de rechazo (tolerancia operacional, aun en ausencia de inmunosupresión. Se ha sugerido que los mismos mecanismos son responsables para la tolerancia hacia antígenos propios y aloantígenos. Uno de estos mecanismos es la regulación inmune y se han identificado varias subpoblaciones de células con propiedades reguladoras. Entre ellas, la población celular mejor caracterizada corresponde a las células T reguladoras (Tregs. Aunque las Tregs en ratones son CD4+CD25+, en humanos el fenotipo de las Treg está restringida a las células T CD4 con alta expresión de CD25 (CD25high y del factor de transcripción Foxp3. El análisis fenotípico y funcional de las células T reguladoras o supresoras circulantes en pacientes trasplantados tal vez sea útil para la detección de pacientes tolerantes operacionales. Además, una futura manipulación in vitro de estas células con fines terapéuticos podría conducir a lograr la inducción de tolerancia in vivo en el trasplante clínico. Aquí, revisamos la evidencia experimental y clínica del papel de las células reguladoras en la biología del trasplante.The immune response elicited by an allogenic transplant usually leads to an effector response resulting in allograft rejection; however, some individuals maintain a long-term functioning transplant without signs of rejection (operational tolerance even in the absence of immunosuppression. It has been suggested that the same mechanisms are responsible for tolerance to self-antigens and alloantigens. One of such mechanisms is immune regulation and several cell subsets with regulatory properties have been identified. Among them, the best characterized cell populations are the regulatory T cells (Treg. Although

  2. Molecular investigations of BK(Ca) channels and the modulatory beta-subunits in porcine basilar and middle cerebral arteries

    DEFF Research Database (Denmark)

    Johansson, Helle Wulf; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    arteries using reverse transcription polymerase chain reaction (RT-PCR) and quantitative real-time PCR. Western blotting was used to detect immunoreactivity for the porcine BK(Ca) channel alpha-subunit and beta-subunit proteins. The BK(Ca) channel alpha-subunit RNA and protein distribution patterns were...... visualized using in situ hybridization and immunofluorescence studies, respectively. The study verified that the BK(Ca) channel alpha-subunit is located to smooth muscle cells of porcine basilar and middle cerebral arteries. The mRNA transcript for beta1-, beta2- and beta4-subunit were shown by RT-PCR...... in porcine basilar and middle cerebral arteries. However, at the protein level, only, the beta1-subunit protein was found by western blotting....

  3. Resultados clínicos de trasplantes de riñón en pacientes con enfermedad renal en etapa terminal secundaria a nefritis lupus, enfermedad poliquística renal y nefropatía diabética

    Directory of Open Access Journals (Sweden)

    John Fredy Nieto-Ríos

    2016-04-01

    Full Text Available Antecedentes:Pacientes con nefritis lúpica pueden progresar a enfermedad renal crónica terminal (10-22%; en estos pacientes el trasplante renal debe ser considerado como la terapia de elección. Objetivo: Evaluar los desenlaces clínicos de un grupo de pacientes con enfermedad renal crónica terminal por nefropatía lúpica, enfermedad renal poliquística y nefropatía diabética que fueron sometidos a trasplante renal en el Hospital Pablo Tobón Uribe.Métodos:Estudio retrospectivo, descriptivo, realizado en un solo centro de trasplante renal, durante el período 2005-2013.Resultados:Se evaluaron 136 pacientes: 27 con nefritis lúpica (19.9%, 31 con enfermedad renal poliquística (22.8% y 78 con nefropatía diabética (57.4%. La supervivencia del injerto a uno, tres y cinco años fue de de 96.3%, 82.5% y 82.5% en nefropatía lúpica, 90%, 86% y 76.5% en enfermedad renal poliquística y 91.7%, 80.3% y 67.9% en nefropatía diabética respectivamente, sin diferencias estadísticas significativas (Long Rank test= 0.488. La tasa de recurrencia de nefritis lúpica posterior al trasplante renal fue de 0.94%/persona-año. Tener lupus vs diabetes o enfermedad renal poliquística no fue un factor de riesgo para disminución del tiempo de supervivencia del injerto (Hazard ratio= 1.43; 95% IC= 0.52-3.93.Conclusiones:Los pacientes enfermedad renal crónica terminal secundaria a nefritis lúpica, que son llevados a trasplante renal tienen tasas de éxito similar en cuanto a supervivencia del injerto y del paciente, al compararlos con otras enfermedades renales. La tasa de complicaciones y el riesgo de recurrencia de la nefropatía lúpica son bajos. El trasplante renal debe ser considerado como la terapia de elección para los pacientes con enfermedad renal crónica estadio terminal secundaria a nefritis lúpica.

  4. A single-center epidemiological study of BK virus infection and analysis of risk factors in patients with renal transplantation

    Directory of Open Access Journals (Sweden)

    Ji-gang LI

    2014-10-01

    Full Text Available Objective To investigate the epidemiological characteristics of BK virus (BKV infection in living renal transplantation patients, and analyze the risk factors of BKV infection and BKV nephropathy (BKVN. Methods The BKV DNA load in urine and blood samples of 43 renal transplant recipients, who had received renal transplantation in 309 Hospital from Feb. 2012 to Feb. 2013, was determined at preoperative period and 0.5, 1, 3, 6, 9, 12 and 15 months after transplantation. Meanwhile, the biopsy of grafted kidney was performed in those patients with continuously elevated serum creatinine and those with higher BKV DNA load. Patients were divided into 3 groups as follows according to the test results: BK viruria group, BK viremia group and pathologically diagnosed BKVN group. Data of each group were then recorded, including gender, age, postoperative diabetes (PTDM, acute rejection (AR, delayed recovery of graft function (DGF, postoperative pulmonary infection, preoperative immune induction therapy, postoperative immunosuppressive regimen, and other information. The risk factors for postoperative BKV infection and BKVN were analyzed. Results After an average of 15-month follow-up, it was found that the incidence of BKV viruria was 46.5%, that of BKV viremia was 14.0%, and that of BKVN was 2.3%. Sixth month after transplantation was found to be the peak time of viruria and viremia. FK506 was significantly associated with viremia in living donor renal transplantation. The immunosuppressive regimen was the immune related independent risk factor for BK viremia developing BKVN after living renal transplantation. Conclusion The incidence of BK viremia and BKVN is lower in living donor renal transplantation than in cadaver renal transplantation, but that of viruria is similar in both groups. Immunosuppressive scheme based on FK506 is an immune related independent risk factor leading to BK viremia proceeding to BKVN in living donor kidney

  5. Percepción de la calidad de vida referida por el paciente adulto con trasplante renal

    Directory of Open Access Journals (Sweden)

    María Isabel Durán Muñoz

    2014-03-01

    Full Text Available La percepción personal de un individuo de su situación de vida, dentro del contexto cultural y de valores en el que vive, y en relación con sus objetivos, expectativas, valores e intereses, se denomina, calidad de vida. Como en estudios de pacientes crónicos, los factores más influyentes en la percepción de la calidad de vida, se clasifican en: paciente, medicamento, enfermedad y calidad de la interacción entre paciente y sistema sanitario. Objetivos: Describir la percepción que tienen los pacientes sobre su calidad de vida, e identificar factores que influyen en esta percepción. Material y métodos: Estudio descriptivo transversal en pacientes adultos, con trasplante renal, que acuden a nuestra consulta hospitalaria y son autosuficientes en el tratamiento. Todos los pacientes han recibido charlas grupales sobre el manejo de su tratamiento antes del alta. Recogida de datos con cuestionario anónimo autoadministrado: Escala validada: cuestionario de salud SF-12 (versión 2, durante 4 meses. Se excluyeron pacientes que rechazaron participar y que necesitaban ayuda en el manejo del tratamiento. Se estimó un tamaño muestral de 222 pacientes. Variables dependientes: Calidad de vida. Variables independientes: Factores socio-demográficos, tipo inmunosupresores, educación sanitaria recibida por profesionales de la salud. Se solicitó consentimiento informado y se obtuvo informe favorable del Comité Ético de Investigación Clínica. Resultados: Participaron 209 pacientes. Edad media 55,2(±12,15 rango 21-80 años, siendo el 61,8 % hombres. El 42% eran jubilados, el 38,2% tenían estudios secundarios, el 71% convivían en pareja. El inmunosupresor más utilizado: Micofenolato de sodio (MYFORTIC® (65,5% y el 46,7% tomaban dos inmunosupresores. La información sanitaria sobre efectos secundarios la consideran insuficiente un 20,5%. La media de la percepción de la calidad de vida es de 44,72±8,11 para el componente físico y 47,47±8,8 para

  6. Gluon density and $F_{2}$ functions from BK equation with impact parameter dependence in DIS on nuclei

    CERN Document Server

    Sergey, Bondarenko

    2008-01-01

    The DIS process on nuclei is considered in the framework of LO BK equation with local impact parameter dependence. Solving BK equation parameters for initial conditions of GBW type found in \\cite{Serg1} were used. Integrated gluon density function and $F_2$ nucleus structure function for different nuclei are calculated. Obtained results are compared with the different parameterizations of integrated gluon density function from \\cite{Flor,Eskola1,Eskola2,Tywon}. The anomalous dimensions and saturation scales for different nuclei are calculated at different energies. Fitting obtained results, expressions for the form of saturation scale are obtained for the proton and different nuclei as functions of impact parameter and energy.

  7. Preliminary study on rotary ultrasonic machining of Bk-7 optical glass rod

    International Nuclear Information System (INIS)

    This paper presents an experimental observation on rotary ultrasonic machining (RUM) of BK7 optical glass rod. BK7 is a common technical optical glass for high quality optical components due to its high linear optical transmission in the visible range and is chemically stable. RUM is a hybrid machining process that combines the material removal mechanisms of diamond grinding and ultrasonic machining (USM) and it is non-thermal, non-chemical, creates no change in the microstructure, chemical or physical properties of the work piece. In the RUM, a controlled static load is applied to the rotating core drill with metal bonded diamond abrasive and is ultrasonically vibrated in the axial direction. A water-soluble coolant was used to cool the tool and sample during machining processes. By using DOE (Design of Experiment) approach, the effect of spindle speed and feed rate to the ultrasonic machinability had been developed. The main effects and two-factor interactions of process parameters (spindle speed) and feed rate) on output variables (MRR, surface roughness, opaqueness, chipping thickness and chipping size) are studied. (author)

  8. On the Operator ⨁Bk Related to Bessel Heat Equation

    Directory of Open Access Journals (Sweden)

    Wanchak Satsanit

    2010-01-01

    Full Text Available We study the equation (∂/∂tu(x,t=c2⊕Bku(x,t with the initial condition u(x,0=f(x for x∈Rn+. The operator ⊕Bk is the operator iterated k-times and is defined by ⊕Bk=((∑i=1pBxi4-(∑j=p+1p+qBxi4k, where p+q=n is the dimension of the Rn+, Bxi=∂2/∂xi2+(2vi/xi(∂/∂xi, 2vi=2αi+1, αi>-1/2, i=1,2,3,…,n, and k is a nonnegative integer, u(x,t is an unknown function for (x,t=(x1,x2,…,xn,t∈Rn+×(0,∞, f(x is a given generalized function, and c is a positive constant. We obtain the solution of such equation, which is related to the spectrum and the kernel, which is so called Bessel heat kernel. Moreover, such Bessel heat kernel has interesting properties and also related to the kernel of an extension of the heat equation.

  9. Adjuvant Ciprofloxacin for Persistent BK Polyomavirus Infection in Kidney Transplant Recipients

    Directory of Open Access Journals (Sweden)

    David Arroyo

    2014-01-01

    Full Text Available Background. BK virus (BKV infection is a common complication following kidney transplantation. Immunosuppression reduction is the cornerstone of treatment while adjuvant drugs have been tried in small uncontrolled studies. We sought to examine our center’s experience with the use of ciprofloxacin in patients with persistent BKV infection. Methods. Retrospective evaluation of the effect of a 30-day ciprofloxacin course (250 mg twice daily on BKV infection in kidney transplant recipients who had been diagnosed with BK viruria ≥106 copies/mL and viremia ≥500 copies/mL and in whom the infection did not resolve after immunosuppression reduction and/or treatment with other adjuvant agents. BKV in plasma and urine was evaluated after 3 months following treatment with ciprofloxacin. Results. Nine kidney transplant recipients received ciprofloxacin at a median of 130 days following the initial reduction in immunosuppression. Three patients showed complete viral clearance and another 3 had a ≥50% decrease in plasma viral load. No serious adverse events secondary to ciprofloxacin were reported and no grafts were lost due to BKV up to 1 year after treatment. Conclusion. Ciprofloxacin may be a useful therapy for persistent BKV infection despite conventional treatment. Randomized trials are required to evaluate the potential benefit of this adjuvant therapy.

  10. Risk Factors for the Development of BK Virus Nephropathy in Renal Transplant Recipients.

    Science.gov (United States)

    Pai, D; Mann, D M; Malik, A; Hoover, D R; Fyfe, B; Mann, R A

    2015-10-01

    The BK polyoma virus has, in recent years, become a significant cause of renal allograft dysfunction and failure. Among 260 adult kidney transplant recipients, those with biopsy-proven BK virus nephropathy (BKVN) were compared with those without BKVN with regard to gender, age, race, rejection episodes, time on dialysis, number of organs transplanted, HLA match, live donor versus deceased donor, cold ischemia time, delayed graft function, cytomegalovirus (CMV) serostatus of donor and recipient, induction therapy, and maintenance immunosuppression. Episodes of rejection (35.7% of patients with BKVN vs 8.5% of patients without BKVN; P = .01), transplantation of >1 organ (35.7% of patients with BKVN vs 9.0% of patients without BKVN; P = .01), positive CMV serology in both donor and recipient (71.4% of patients with BKVN vs 41.1% of patients without BKVN; P = .03), and a greater cumulative dose of daclizumab use at the time of induction (2.24 ± 0.05 mg/kg in patients with BKVN vs 2.03 ± 0.14 mg/kg in patients without BKVN; P = .04) were statistically significant risk factors for the development of BKVN. Those who developed BKVN received a higher mean cumulative dose of rabbit antithymoglobulin for induction therapy, but that difference failed to achieve statistical significance (P = .07). PMID:26518952

  11. Calidad de vida y estrategias de afrontamiento en pacientes con insuficiencia renal crónica sometidos a hemodiálisis, diálisis peritoneal o trasplante renal

    Directory of Open Access Journals (Sweden)

    Paola Andrea Acosta Hernández

    2008-01-01

    Full Text Available Se comparó la calidad de vida y las estrategias de afrontamiento en 120 pacientes con Insuficiencia Renal Crónica sometidos a hemodiálisis, diálisis peritoneal o trasplante renal, teniendo en cuenta la edad, sexo, escolaridad, estado civil y ocupación. Los instrumentos utilizados fueron una ficha sociodemográfica, la prueba de calidad de vida WHOQOL-100 (Organización Mundial de la Salud, 1998 y el Cuestionario de Estrategias de Afrontamiento (Lazarus & Folkman, 1985. Se encontró que los pacientes en tratamiento de trasplante reportaban mayor calidad de vida y mejores estrategias de afrontamiento en comparación con los otros tratamientos, siendo mayoreslas puntuaciones en personas con edad de transición entre adultez media y tardía, mujeres, con estudios universitarios, casados y empleados. Se discuten las implicaciones de estos hallazgos.

  12. Receptores de trasplante renal de donantes en asistolia y muerte cerebral: diferencias en los cuidados enfermeros Recipients of kidney transplants from donors in asystole and brain death: differences in nursing care

    Directory of Open Access Journals (Sweden)

    Mª Concepción García Viana

    2012-03-01

    Full Text Available Hoy en día es indiscutible que el trasplante renal es el tratamiento sustitutivo de elección para pacientes con enfermedad renal crónica. En nuestro hospital realizamos fundamentalmente dos tipos de trasplante renal, el clásico donante en muerte cerebral y el donante en asistolia. El objetivo de nuestro estudio fue evaluar si existían diferencias en las cargas de trabajo del personal de enfermería dependiendo de un tipo de trasplante u otro. Se trata de un estudio transversal con 73 pacientes que recibieron un trasplante renal durante el año 2010, 18 procedentes de donante en muerte cerebral y 55 en asistolia. Los trasplante renales de donante en asistolia presentaron mayor incidencia de fallo primario del injerto (15% vs 1,4% así como mayor retraso de la función renal (18 días vs 0 días. Debido a esto, nuestra labor asistencial se vio incrementada en este tipo de trasplante por precisar un mayor número de biopsias renales que implican unos cuidados de preparación y de vigilancia de sus complicaciones, la necesidad de más sesiones de hemodiálisis y la administración de un mayor número de dosis de timoglobulina. No se objetivaron diferencias significativas en la incidencia de infecciones entre ambos tipo de trasplante, así como en la estancia media hospitalaria, aunque esto último podría estar influido por el tamaño de la muestra. A pesar de las complicaciones mencionadas, la función renal a medio plazo de ambos tipos de trasplante fue similar, lo que alienta la utilización de los donantes en asistolia.Nowadays it is indisputable that kidney transplant is the preferred replacement therapy for patients with chronic kidney disease. In our hospital we carry out basically two types of kidney transplants, the classic brain dead donor and the asystolic donor. The aim of our study was to evaluate whether there were differences in the workload of nursing staff depending on the type of transplant. This is a transversal study of 73

  13. Viviendo con trasplante renal, sin protección social en salud: ¿Qué dicen los enfermos sobre las dificultades económicas que enfrentan y sus efectos?

    Directory of Open Access Journals (Sweden)

    Francisco Javier Mercado-Martínez

    2014-10-01

    Full Text Available El trasplante es el mejor tratamiento para la insuficiencia renal, de acuerdo con la biomedicina; sin embargo, es una tecnología cara. Este artículo examina las dificultades económicas y sus efectos en personas con trasplante renal, pero sin protección social en salud. Para el estudio se desarrolló una investigación cualitativa en México. Participaron 21 pacientes trasplantados; se aplicaron entrevistas semiestructuradas, y se realizó un análisis de contenido. Los resultados muestran que las personas enfermas enfrentan dificultades económicas, debido a los costes de las terapias renales, particularmente, de las medicinas. Todo ello tiene efectos negativos: las personas con pocos recursos dejan el tratamiento con medicamentos, abandonan el protocolo, no asisten a las consultas médicas y disminuyen los gastos domésticos, incluyendo el de alimentación; además de suponer una merma en los ingresos familiares. En conclusión, el trasplante renal empobrece a las personas enfermas sin protección social en salud; es urgente la implementación de un sistema de protección social para esta población.

  14. A transição no transplante hepático: um estudo de caso La transición en el trasplante: un estudio de caso The transition in liver trasplantation: a case study

    Directory of Open Access Journals (Sweden)

    Liliana Andreia Neves da Mota

    2011-12-01

    Full Text Available Contexto: as transições de saúde/doença são uma dimensão importante da prática de enfermagem. É com a ajuda à pessoa na vivência de transições saudáveis que os enfermeiros podem ser verdadeiramente significativos. O doente transplantado hepático vive, durante o período pós-transplante, uma enorme necessidade de adaptação à nova condição. Objetivos:operacionalizar a teoria de Médio alcance de Meleis à vivência de uma transição saúde/doença de um doente numa situação de transplante hepático, em contexto de hepatite fulminante. Metodologia: estudo de caso operacionalizando a teoria de Médio alcance de Meleis a uma situação concreta. Neste sentido, foi efetuada uma análise aos registos eletrónicos de enfermagem, assim como uma entrevista semiestruturada ao doente selecionado por conveniência para o estudo de caso. Discussão: a teoria de médio alcance de Meleis é uma teoria exequível na área da transplantação hepática. Com base nesta teoria é possível implementar um processo de Enfermagem individualizado, uma vez que é possível precaver o sentido da transição do doente. Conclusão: é fundamental que os enfermeiros alicercem a sua prática na evidência, para que tenham práticas mais sustentadas.Contexto: las transiciones entre la salud y la enfermedad son una importante dimensión de la práctica de Enfermería. Es con la ayuda a la persona en la vivencia de transiciones saludables que los enfermeros pueden ser verdaderamente significativos. El paciente trasplantado hepático vive durante el postrasplante una enorme necesidad de adaptación a la nueva condición. Objetivos: aplicar la teoría de Medio alcance de Meleis a la vivencia de una transición salud/enfermedad de un paciente en una situación de trasplante hepático, en contexto de hepatitis fulminante. Metodología: se realizó un estudio de caso aplicando la teoría de Medio alcance de Meleis a una situación concreta. En este sentido, se

  15. Possible antiviral effect of ciprofloxacin treatment on polyomavirus BK replication and analysis of non-coding control region sequences.

    Science.gov (United States)

    Umbro, Ilaria; Anzivino, Elena; Tinti, Francesca; Zavatto, Assunta; Bellizzi, Anna; Rodio, Donatella Maria; Mancini, Carlo; Pietropaolo, Valeria; Mitterhofer, Anna Paola

    2013-01-01

    Acute renal dysfunction (ARD) is a common complication in renal transplant recipients. Multiple factors contribute to ARD development, including acute rejection and microbial infections. Many viral infections after kidney transplantation result from reactivation of "latent" viruses in the host or from the graft, such as the human Polyomavirus BK (BKV). We report the case of a 39 year-old recipient of a 2nd kidney graft who experienced BKV reactivation after a second episode of acute humoral rejection. A 10-day treatment with the quinolone antibiotic ciprofloxacin was administered with an increase of immunosuppressive therapy despite the active BKV replication. Real Time PCR analysis performed after treatment with ciprofloxacin, unexpectedly showed clearance of BK viremia and regression of BK viruria. During the follow-up, BK viremia persisted undetectable while viruria decreased further and disappeared after 3 months.BKV non-coding control region sequence analysis from all positive samples always showed the presence of archetypal sequences, with two single-nucleotide substitutions and one nucleotide deletion that, interestingly, were all representative of the subtype/subgroup I/b-1 we identified by the viral protein 1 sequencing analysis.We report the potential effect of the quinolone antibiotic ciprofloxacin in the decrease of the BKV load in both blood and urine.

  16. Draft Genome Sequence of an Invasive Multidrug-Resistant Strain, Pseudomonas aeruginosa BK1, Isolated from a Keratitis Patient

    KAUST Repository

    Jeganathan, Lakshmi Priya

    2014-03-27

    Pseudomonas aeruginosa infections are difficult to treat due to the presence of a multitude of virulence factors and antibiotic resistance. Here, we report the draft genome sequence of P. aeruginosa BK1, an invasive and multidrug-resistant strain, isolated from a bacterial keratitis patient in southern India.

  17. Electron microscopic features of a brain tumor induced in hamster by BK virus, a human papova virus.

    Directory of Open Access Journals (Sweden)

    Tsuboi,Masahiro

    1979-12-01

    Full Text Available In order to locate the target cells for malignant transformation by BK virus (a human papova virus in hamster brain, electron microscopic observation of tumor originally induced in hamster brain by BK virus was performed. With light microscopy, the BK virus-induced tumor (Vn 17 bore a close resemblance to human malignant ependymoma. Under the electron microscope, numerous microvilli and few cilia were visible on the surface of the tumor cells. These tumor cells were joined to each other by desmosomes. Gap junctions were not observed. Multilayered cuboidal cells were observed around the lumen and blood vessels in the tumor. With regard to fine structure, three types of Vn 17 cells were recognized; ependymal like cells, tanycytes with prominent cell processes, and undifferentiated cells with few cytoplasmic organelles. There was no basal lamina between the ependymal cells and the connective tissue stroma. The Vn 17 cells showed some similarity to the ultrastructural features of the epemdymal cells of newborn rabbits, suggesting that the target cells for Vn 17 may be cells related to ependyma. Malignant transformation of the cells would be initiated in the early stages after BK virus inoculation into the brain of newborn hamsters.

  18. Phosphorylation of BK channels modulates the sensitivity to hydrogen sulfide (H2S

    Directory of Open Access Journals (Sweden)

    Guzel F. Sitdikova

    2014-11-01

    Full Text Available Introduction: Gases, such as nitric oxide (NO, carbon monoxide (CO or hydrogen sulfide (H2S, termed gasotransmitters, play an increasingly important role in understanding of how electrical signaling of cells is modulated. H2S is well known to act on various ion channels and receptors. In a previous study we reported that H2S increased calcium-activated potassium (BK channel activity. Aims: The goal of the present study is to investigate the modulatory effect of BK channel phosphorylation on the action of H2S on the channel as well as to recalculate and determine the H2S concentrations in aqueous sodium hydrogen sulfide (NaHS solutions.Methods: Single channel recordings of GH3, GH4 and GH4 STREX cells were used to analyze channel open probability, amplitude and open dwell times. H2S was measured with ananion selective electrode. Results: The concentration of H2S produced from NaHS was recalculated taking pH, temperature salinity of the perfusate and evaporation of H2S into account. The results indicate that from a concentration of 300 µM NaHS, only11-13%, i.e. 34-41 µM is effective as H2S in solution. GH3, GH4 and GH4 STREX cells respond differently to phosphorylation. BK channel open probability (Po of all cells lines used was increased by H2S in ATP containing solutions. PKA prevented the action of H2S on channel Po in GH4 and GH4 STREX, but not in GH3 cells. H2S, high significantly increased Po of all PKG pretreated cells. In the presence of PKC, which lowers channel activity, H2S increased channel Po of GH4 and GH4 STREX, but not those of GH3 cells. H2S increased open dwell times of GH3 cells in the absence of ATP significantly. A significant increase of dwell times with H2S was also observed in the presence of okadaic acid.Conclusions: Our results suggest that phosphorylation by PKG primes the channels for H2S activation and indicate that channel phosphorylation plays an important role in the response to H2S.

  19. Cooperación jurídica internacional en materia de donación y trasplante de organos: hacia un nuevo paradigma

    Directory of Open Access Journals (Sweden)

    Joaquín Cayón de las CUEVAS

    2013-04-01

    Full Text Available RESUMEN El trasplante de órganos puede contribuir decisivamente no sólo a salvar vidas sino también a mejorar la calidad de las mismas. Sin embargo, el problema fundamental al que se enfrenta este tipo de terapias es la desproporción entre la oferta y la demanda. El número de donantes es, por definición, muy limitado y la donación puede no resultar posible por motivos diversos tales como la falta de autorización familiar o la ausencia de condiciones necesarias. Así las cosas, la dificultad en el acceso a las terapias de trasplante constituye el reflejo de una de las desigualdades en salud. Por otra parte, la escasez de órganos hace pervivir el indeseable fenómeno de la comercialización internacional. Resulta evidente que el problema de la insuficiencia de donantes afecta a toda la comunidad trasplantadora internacional dado que las necesidades de trasplantes son equivalentes en las diferentes regiones del mundo. En este sentido, el futuro pasa por propiciar una progresiva integración de las políticas públicas en materia de donación y trasplantes de órganos, superando el actual estadio de cooperación intergubernamental, loable pero insuficiente, para adentrarnos gradualmente en un nuevo paradigma de coordinación internacional de ámbito regional, condicionado a la previa armonización de la legislación de las naciones afectadas, que permita cifras homologables de donantes. Este nuevo paradigma de coordinación debe instrumentar mecanismos de prevención del fenómeno del turismo de trasplantes pero también facilitar y potenciar el intercambio internacional de órganos, removiendo desigualdades en el acceso al tratamiento trasplantador. RESUMO O transplante de órgãos pode ser valiosa não só para salvar vidas, mas também para melhorar a qualidade dos pacientes. No entanto, o problema fundamental dessas terapias é o desequilíbrio entre oferta e demanda. O número de doadores é muito limitado e a doação pode não ser

  20. Progressive renal failure due to renal infiltration by BK polyomavirus and leukaemic cells: which is the culprit?

    Science.gov (United States)

    Sangala, Nicholas; Dewdney, Alex; Marley, Nicholas; Cranfield, Tanya; Venkat-Raman, Gopalakrishnan

    2011-02-01

    Renal infiltration with leukaemic cells is a common finding in patients suffering with chronic lymphocytic leukaemia (CLL) but rarely does it lead to significant renal dysfunction. Similarly, BK nephropathy is a recognized cause of graft failure in renal transplant recipients but rarely causes significant disease in native kidneys. In the few reports where leukaemic infiltration of the kidney has led to significant renal impairment, the pathological process causing renal dysfunction is not identified on biopsy. In these cases, it is unclear whether BK polyomavirus (BKV) nephropathy has been excluded. We describe a case of dual pathologies in a patient with Binet stage C CLL and deteriorating renal function where renal biopsy reveals leukaemic infiltration of the kidney occurring alongside BKV nephropathy. The relative importance of each pathology in relation to the rapid decline to end-stage renal failure remains unclear, but the presence of both pathologies appears to impart a poor prognosis. Additionally, we describe the novel histological finding of loss of tubular integrity resulting in tubular infiltration and occlusion by leukaemic cells. It is possible that the patient with advanced CLL is at particular risk of BK activation, and the presence of BK nephropathy may compromise tubular integrity allowing leukaemic cell infiltration and obstruction of tubules. This case bares remarkable resemblance to the first and only other report of its kind in the literature. It is not clear how available immunocytochemistry for polyoma infection is outside transplant centres, and it is possible that BK nephropathy is being under-diagnosed in patients with CLL in the context of declining renal function. At present, the combination of BKV nephropathy and leukaemic infiltration represents a management conundrum and the prognosis is poor. Further research is required in order to better understand the pathological process and therefore develop management strategies.

  1. Improving the specific activity of β-mannanase from Aspergillus niger BK01 by structure-based rational design.

    Science.gov (United States)

    Huang, Jian-Wen; Chen, Chun-Chi; Huang, Chun-Hsiang; Huang, Ting-Yung; Wu, Tzu-Hui; Cheng, Ya-Shan; Ko, Tzu-Ping; Lin, Cheng-Yen; Liu, Je-Ruei; Guo, Rey-Ting

    2014-03-01

    β-Mannanase has found various biotechnological applications because it is capable of degrading mannans into smaller sugar components. A highly potent example is the thermophilic β-mannanase from Aspergillus niger BK01 (ManBK), which can be efficiently expressed in industrial yeast strains and is thus an attractive candidate for commercial utilizations. In order to understand the molecular mechanism, which helps in strategies to improve the enzyme's performance that would meet industrial demands, 3D-structural information is a great asset. Here, we present the 1.57Å crystal structure of ManBK. The protein adopts a typical (β/α)8 fold that resembles the other GH5 family members. Polysaccharides were subsequently modeled into the substrate binding groove to identify the residues and structural features that may be involved in the catalytic reaction. Based on the structure, rational design was conducted to engineer ManBK in an attempt to enhance its enzymatic activity. Among the 23 mutants that we constructed, the most promising Y216W showed an 18±2.7% increase in specific activity by comparison with the wild type enzyme. The optimal temperature and heat tolerance profiles of Y216W were similar to those of the wild type, manifesting a preserved thermostability. Kinetic studies showed that Y216W has higher kcat values than the wild type enzyme, suggesting a faster turnover rate of catalysis. In this study we applied rational design to ManBK by using its crystal structure as a basis and identified the Y216W mutant that shows great potentials in industrial applications.

  2. Hemorrhagic Cystitis due to BK Reactivation in a Young Female Treated for Hodgkin-Disease

    Directory of Open Access Journals (Sweden)

    R. Le Calloch

    2011-01-01

    Full Text Available Hodgkin's lymphoma is a disease with a high rate of curability under classic chemo-radiotherapy regimes. Complications due to chemotherapy could include viral reactivation due to chronic lymphopenia. BK virus (BKV is a polyoma virus belonging to the Papovaviridae family with antibody seroprevalences in healthy populations varying from 60% to 80%. Initial infections are asymptomatic usually occur in early childhood, after which the viruses remain latent in the kidneys or urothelium. Reactivation of BKV occurs in individuals with severe immunosuppression during HIV infections, transplantation or, exceptionally, after classical chemotherapy. BKV incidence is approximately 0% to 5% in immunocompetent individuals. Reactivation is associated with nephropathy and haemorrhagic cystitis. Herein, we present a case of a haemorrhagic cystitis due to BKV reactivation in a patient with Hodgkin's disease treated with chemotherapy.

  3. Successful hyperbaric oxygen therapy for refractory BK virus-associated hemorrhagic cystitis after cord blood transplantation.

    Science.gov (United States)

    Hosokawa, K; Yamazaki, H; Nakamura, T; Yoroidaka, T; Imi, T; Shima, Y; Ohata, K; Takamatsu, H; Kotani, T; Kondo, Y; Takami, A; Nakao, S

    2014-10-01

    BK virus-associated hemorrhagic cystitis (BKV-HC) is a common and major cause of morbidity in recipients of allogeneic hematopoietic stem cell transplantation. A 32-year-old woman developed severe BKV-HC on day 24 after cord blood transplantation (CBT). Despite supportive therapies - such as hyperhydration, forced diuresis, and urinary catheterization - macroscopic hematuria and bladder irritation persisted for over a month. Hyperbaric oxygen (HBO) therapy at 2.1 atmospheres for 90 min per day was started on day 64 after CBT. Macroscopic hematuria resolved within a week, and microscopic hematuria was no longer detectable within 2 weeks. Hematuria did not recur after 11 sessions of HBO therapy, and no significant side effects were observed during or after treatment. HBO therapy could thus be useful in controlling refractory BKV-HC after CBT. PMID:25040402

  4. Measurement of B-->K{*}(892)gamma branching fractions and CP and Isospin asymmetries.

    Science.gov (United States)

    Aubert, B; Karyotakis, Y; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Grauges, E; Martinelli, M; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Battaglia, M; Brown, D N; Kerth, L T; Kolomensky, Yu G; Lynch, G; Osipenkov, I L; Tackmann, K; Tanabe, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schroeder, T; Asgeirsson, D J; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Randle-Conde, A; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Atmacan, H; Gary, J W; Liu, F; Long, O; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Martinez, A J; Schalk, T; Schumm, B A; Seiden, A; Wang, L; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Bloom, P C; Ford, W T; Gaz, A; Hirschauer, J F; Nagel, M; Nauenberg, U; Smith, J G; Wagner, S R; Ayad, R; Toki, W H; Wilson, R J; Feltresi, E; Hauke, A; Jasper, H; Karbach, T M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Nogowski, R; Schubert, K R; Schwierz, R; Volk, A; Bernard, D; Latour, E; Verderi, M; Clark, P J; Playfer, S; Watson, J E; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Fioravanti, E; Franchini, P; Luppi, E; Munerato, M; Negrini, M; Petrella, A; Piemontese, L; Santoro, V; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Contri, R; Guido, E; Lo Vetere, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Tosi, S; Chaisanguanthum, K S; Morii, M; Adametz, A; Marks, J; Schenk, S; Uwer, U; Bernlochner, F U; Klose, V; Lacker, H M; Bard, D J; Dauncey, P D; Tibbetts, M; Behera, P K; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Arnaud, N; Béquilleux, J; D'Orazio, A; Davier, M; Derkach, D; Firmino da Costa, J; Grosdidier, G; Le Diberder, F; Lepeltier, V; Lutz, A M; Malaescu, B; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; Clarke, C K; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Paramesvaran, S; Wren, A C; Brown, D N; Davis, C L; Denig, A G; Fritsch, M; Gradl, W; Hafner, A; Alwyn, K E; Bailey, D; Barlow, R J; Jackson, G; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Henderson, S W; Sciolla, G; Spitznagel, M; Yamamoto, R K; Zhao, M; Patel, P M; Robertson, S H; Schram, M; Lazzaro, A; Lombardo, V; Palombo, F; Stracka, S; Bauer, J M; Cremaldi, L; Godang, R; Kroeger, R; Sonnek, P; Summers, D J; Zhao, H W; Simard, M; Taras, P; Nicholson, H; De Nardo, G; Lista, L; Monorchio, D; Onorato, G; Sciacca, C; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; Losecco, J M; Wang, W F; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelli, G; Gagliardi, N; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Del Amo Sanchez, P; Ben-Haim, E; Bonneaud, G R; Briand, H; Chauveau, J; Hamon, O; Leruste, Ph; Marchiori, G; Ocariz, J; Perez, A; Prendki, J; Sitt, S; Gladney, L; Biasini, M; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Lopes Pegna, D; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Anulli, F; Baracchini, E; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Esteve, L; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yèche, Ch; Zito, M; Allen, M T; Aston, D; Bartoldus, R; Benitez, J F; Cenci, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Franco Sevilla, M; Gabareen, A M; Graham, M T; Grenier, P; Hast, C; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L

    2009-11-20

    We present an analysis of the decays B{0}-->K{*0}(892)gamma and B{+}-->K{*+}(892)gamma using a sample of about 383 x 10{6} BB[-over ] events collected with the BABAR detector at the PEP-II asymmetric energy B factory. We measure the branching fractions B(B{0}-->K{*0}gamma)=(4.47+/-0.10+/-0.16) x 10{-5} and B(B{+}-->K{*+}gamma)=(4.22+/-0.14+/-0.16) x 10{-5}. We constrain the direct CP asymmetry to be -0.033K{*}gamma)<0.028 and the isospin asymmetry to be 0.017

  5. Mathematical modeling of surface roughness in magnetic abrasive finishing of BK7 optical glass.

    Science.gov (United States)

    Pashmforoush, Farzad; Rahimi, Abdolreza; Kazemi, Mehdi

    2015-10-01

    Magnetic abrasive finishing (MAF) is one of the advanced machining processes efficiently used to finish hard-to-machine materials. Simulation and modeling of the process is of particular importance to understand the mechanics of material removal and consequently achieve a high-quality surface with a minimum of surface defects. Hence, in this paper, we performed a numerical-experimental study to mathematically model the surface roughness during the MAF of BK7 optical glass. For this purpose, the initial roughness profile was estimated using fast Fourier transform (FFT) and a Gaussian filter. We obtained the final surface profile based on the material removal mechanisms and the corresponding chipping depth values evaluated by finite element analysis. We then validated experimentally the simulation results in terms of the arithmetic average surface roughness (R(a ). The comparison between the obtained results demonstrates that the theoretical and experimental findings are in good agreement when predicting the parameters' effect on surface roughness behavior. PMID:26479596

  6. Simultaneous BK Polyomavirus (BKPyV)-associated nephropathy and hemorrhagic cystitis after living donor kidney transplantation.

    Science.gov (United States)

    Helanterä, Ilkka; Hirsch, Hans H; Wernli, Marion; Ortiz, Fernanda; Lempinen, Marko; Räisänen-Sokolowski, Anne; Auvinen, Eeva; Mannonen, Laura; Lautenschlager, Irmeli

    2016-03-01

    BK polyomavirus (BKPyV) commonly reactivates after kidney transplantation, and can cause polyomavirus-associated nephropathy (PyVAN), whereas after allogeneic stem cell transplantation the most frequent manifestation of BKPyV is polyomavirus-associated hemorrhagic cystitis (PyVHC). Despite high-level BKPyV replication in both, the pathogenesis and manifestation of both BKPyV entities appears to differ substantially. We describe an unusual case of simultaneous PyVAN and PyVHC presenting with acute symptoms in a BKPyV-IgG positive recipient eight months after kidney transplantation from a haploidentical living donor, who was BKPyV-IgG negative. Symptoms of cystitis and viremia subsided rapidly after reduction of immunosuppression. PMID:26771744

  7. Differential expression of BK channel isoforms and beta-subunits in rat neuro-vascular tissues

    DEFF Research Database (Denmark)

    Poulsen, Asser Nyander; Johansson, Helle Wulf; Hay-Schmidt, Anders;

    2009-01-01

    We investigated the expression of splice variants and beta-subunits of the BK channel (big conductance Ca(2+)-activated K(+) channel, Slo1, MaxiK, K(Ca)1.1) in rat cerebral blood vessels, meninges, trigeminal ganglion among other tissues. An alpha-subunit splice variant X1(+24) was found expressed...... (RT-PCR) in nervous tissue only where also the SS4(+81) variant was dominating with little expression of the short form SS4(0). SS4(+81) was present in some cerebral vessels too. The SS2(+174) variant (STREX) was found in both blood vessels and in nervous tissue. In situ hybridization data supported...

  8. Different behaviour of BK-virus infection in liver transplant recipients.

    Science.gov (United States)

    Umbro, Ilaria; Tinti, Francesca; Muiesan, Paolo; Mitterhofer, Anna Paola

    2016-01-28

    Polyomavirus BK (BKV) infects up to 90% of the general population. After primary infection, occurring early during childhood, a state of non-replicative infection is established in the reno-urinary tract, without complications for immunocompetent hosts. In immunocompromised individuals, particularly transplanted patients, asymptomatic BKV viremia and/or viruria can be observed. Renal grafts may also be sources of infection as BKV prefers kidneys rather than other solid organs for transplantation such as the liver. The mechanism behind the higher incidence of BKV infection in kidney transplant patients, compared to liver or heart transplantation, is unclear and the prevalence of BKV infection in non-renal solid organ transplants has not been yet thoroughly investigated. We evaluated the prevalence of Polyomavirus BK infection among liver transplant recipients. A PubMed search was conducted using the terms BKV infection AND liver transplant recipients; BKV AND non-renal solid organ transplant*; BKV infection AND immunosuppression; the search was limited to title/abstract and English-language articles published from 2000, to March 2015. Eleven relevant studies suggest that the prevalence of BKV viruria and/or viremia among liver transplant recipients is less than that reported in kidney or heart transplant recipients, except when chronic kidney disease (CKD) is present at the same time. Data also suggest that viruric and viremic patients have higher levels of serum creatinine than BKV negative patients. Moreover, no specific immunosuppressive drugs are associated with the onset of BKV nephropathy. The comorbidity of transplantation and CKD could play a major role in promoting BKV replication.

  9. Liver transplantation in patients with hepatocellular carcinoma: factors implicated in tumor relapse Trasplante hepático en pacientes con hepatocarcinoma: factores implicados en la recidiva tumoral

    Directory of Open Access Journals (Sweden)

    D. Martínez Ares

    2004-01-01

    Full Text Available Introduction: liver segmental resection and liver transplantation are both treatments intended for healing liver cancer. An adequate selection of patients eligible for transplantation is crucial, since organs available for transplants are usually scarce. For this reason, awareness of the prognostic factors of relapse is of great importance. We present a comprehensive review of our series in order to better understand these prognostic factors. Material and methods: we revised the cases of patients with hepatocellular carcinoma who underwent liver transplantation during the period 1994-2000, and present a detailed analysis of a series of variables which may be probably implicated in the appear-ance of relapse and which have an effect on survival. Results: after a mean follow-up of 33 months, the mortality rate was 27.5% and relapse occurred in 18.75% of cases. No history of alcohol abuse, the number and size of the nodules, the presence of macro and microscopic vascular invasion, and pTNM stage T4 were all factors associated with a significantly increased risk of relapse (pIntroducción: tanto la resección hepática segmentaria como el trasplante hepático son tratamientos con intención curativa para el hepatocarcinoma. La adecuada selección de los pacientes para el trasplante es de vital importancia dada la escasa disponibilidad de órganos. Por ello resulta fundamental el conocer los factores predictivos de recidiva tumoral, motivo por el que hacemos una exhaustiva revisión de nuestra serie. Material y métodos: revisamos los pacientes con hepatocarcinoma trasplantados en el periodo 1994-2000, y analizamos detalladamente una serie de variables con probable implicación en la recidiva tumoral y repercusión sobre la supervivencia. Resultados: tras un seguimiento medio de 33 meses, la mortalidad fue del 27,5% y la tasa de recidiva del 18,75%. La ausencia de alcoholismo, el número y el tamaño de nódulos, la invasión vascular macro y microsc

  10. Trasplante pulmonar: Evolución y complicaciones. Experiencia de Clínica Las Condes LUNG TRANSPLANTATION: EVOLUTION AND COMPLICATIONS. CLINICAL EXPERIENCE

    Directory of Open Access Journals (Sweden)

    M. TERESA PARADA C

    2003-04-01

    Full Text Available El trasplante pulmonar es una alternativa terapéutica para pacientes con enfermedad pulmonar severa sin respuesta a tratamiento. Objetivos: Evaluar los resultados y complicaciones de los pacientes trasplantados en Clínica Las Condes. Material y método: 21 pacientes trasplantados entre abril 1999 a mayo de 2003: 10 trasplantes simples y 11 bipulmonares, edad x 48 años (13-70;13 hombres; patología predominante fibrosis pulmonar idiopática: 10 (48%. Espirometría basal en patología restrictiva CVF: x 1.827 ml (43 % (1.170 - 2.430 ml y obstructiva: VEF1 x 818 ml (24% (352 - 1.756 ml, todos dependientes de oxígeno. Inmunosupresión triasociada: prednisona, azatioprina y ciclosporina o tacrolimus. Resultados: 3 pacientes fallecen a los 30 días por hemorragia cerebral, hemoptisis masiva y sepsis respectivamente. Seguimiento de 2 a 45 meses. Evolución espirométrica (VEF1: 1 año 2.107 ml (67% , 2 años 2.012 ml (65% y 3 años 2.440 ml (74%. Todos suspenden oxígeno y realizan actividad física. Complicaciones: Disfunción primaria de injerto 2, rechazo agudo 4, lesión vía aérea 2, neumonia por Citomegalovirus 2, síndrome de bronquiolitis obliterante (SBO 3 y fallecen dos. Conclusiones: El trasplante pulmonar mejora calidad de vida en pacientes con enfermedad pulmonar terminal y nuestros resultados confirman que es una alternativa posible en nuestro paísBackground: Lung transplantation is a valid treatment for some patients with severe lung disease who have a poor prognosis with medical treatment. Objective: to evaluate the results and complications of lung transplantation in a series of patients at Clinica Las Condes. Patients and methods: 21 lung transplanted patients from April 1999 to May 2003; 10 single and 11 bilateral; mean age 48 years, range 13 to 70 years; 13 men (62%. The most frequent diagnosis was idiopathic pulmonary fibrosis (10 patients; 48%. Mean FVC for restrictive disorders was 1 827 ml (43% predicted and mean FEV1 for

  11. Role of BKCa channels in cephalic vasodilation induced by CGRP, NO and transcranial electrical stimulation in the rat

    DEFF Research Database (Denmark)

    Gozalov, A.; Jansen-Olesen, I.; Klærke, Dan Arne;

    2007-01-01

    by the NO donor glyceryltrinitrate (GTN) or by CGRP is partially mediated via large conductance calcium-activated potassium (BK(Ca)) channels. The effects of the BK(Ca) channel selective inhibitor iberiotoxin on dural and pial vasodilation induced by CGRP, GTN and endogenously released CGRP by transcranial...... electrical stimulation (TES) were examined. Iberiotoxin significantly attenuated GTN-induced dural and pial artery dilation in vivo and in vitro, but had no effect on vasodilation induced by CGRP and TES. Our results show that GTN- but not CGRP-induced dural and pial vasodilation involves opening of BK...

  12. Hydrogen Peroxide Stimulates the Ca2+-activated Big-Conductance K Channels (BK) Through cGMP Signaling Pathway in Cultured Human Endothelial Cells

    OpenAIRE

    Dong, De-Li; Yue, Peng; Yang, Bao-Feng; Wang, Wen-Hui

    2008-01-01

    We used the whole cell patch-clamp technique to examine the effect of hydrogen peroxide (H2O2) on the Ca2+-activated BK channels in human endothelial cells. We confirmed the previous finding that a 200 pS BK channel activity was detected when the cell membrane potential was clamped at 50 mV. Application of H2O2 or adding glucose oxidase (GO) stimulated BK channels. The stimulatory effect of H2O2 and GO was absent in cells treated with ebselen, a scavenger of reactive oxygen species (ROS). To ...

  13. Monitorización y efectos secundarios de los inmunosupresores en el trasplante Monitoring and secondary effects of immunosuppressants in the transplant

    Directory of Open Access Journals (Sweden)

    B. Sádaba

    2006-08-01

    Full Text Available El éxito del trasplante de órganos y su consideración como un tratamiento claramente establecido en algunas indicaciones se debe al desarrollo de fármacos inmunosupresores. Aunque no fue el primero de los fármacos utilizados, la introducción de la ciclosporina en los años 80 en el tratamiento inmunosupresor permitió el incremento del número de trasplantes y el éxito de esta práctica. Desde ese momento, la inmunosupresión se ha basado en la utilización de una combinación de fármacos, inicialmente ciclosporina, corticoides y azatioprina. En los últimos años se han introducido nuevos fármacos que han abierto las posibilidades de tratamiento. Pero todavía quedan algunas cuestiones pendientes, debido a la toxicidad asociada a su uso y a la posibilidad de interacciones con otros fármacos, lo cual complica su manejo y puede comprometer el pronóstico de estos enfermos. Inhibidores de la calcineurina y de la mTOR son los fármacos implicados con mayor frecuencia en interacciones con otros fármacos, lo cual obliga a anticiparse a esta posibilidad cuando se cambia la medicación concomitante.The success of organ transplants and their consideration as a clearly established treatment in some indications is due to the development of immunosuppressant drugs. While it was not the first of the drugs to be employed, the introduction of cyclosporin in the 1980s in immunosuppressant treatment made possible an increase in the number of transplants and the success of this practice. From then onwards, immunosuppression has been based on the use of a combination of drugs, initially cyclosporin, corticoids and azathioprine. In recent years new drugs have been introduced that have opened up the possibilities of treatment. But many pending questions remain, due to the toxicity associated with their use and the possibility of interaction with other drugs, which complicates their use and can compromise the prognoses of these patients. Calcineurin

  14. Expression of BKCa channels and the modulatory ß-subunits in the rat and porcine trigeminal ganglion

    DEFF Research Database (Denmark)

    Wulf-Johansson, Helle; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways and the c......Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways...

  15. Probing new physics through B->K l+ l- decays in R-parity violating minimal supersymmetric standard model

    CERN Document Server

    Mir, Azeem

    2009-01-01

    We study the decay rate of process B->K l+ l- (l=e,mu) and some of its other related observables, like forward backward asymmetry (A_{FB}), polarization asymmetry (PA) and CP-asymmetry (A_{CP}) in R-parity violating (R_{p}) Minimal Supersymmetric Standard Model (MSSM). The analysis shows that R_{p}Yukawa coupling products contribute significantly to the branching fraction of B->K l+ l- within 1 sigma and 2 sigma. Study shows that PA and A_{FB} are sensitive enough to R_{p}Yukawa coupling products and turn out to be good predictions for measurement in future experiments.The CP-asymmetry calculated in this framework agrees well with the recently reported value(i.e. 7%).

  16. Calcium- and voltage-gated potassium (BK) channel activators in the 5β-cholanic acid-3α-ol analogue series with modifications in the lateral chain.

    Science.gov (United States)

    Bukiya, Anna N; Patil, Shivaputra A; Li, Wei; Miller, Duane D; Dopico, Alex M

    2012-10-01

    Large conductance, calcium- and voltage-gated potassium (BK) channels regulate various physiological processes and represent an attractive target for drug discovery. Numerous BK channel activators are available. However, these agents usually interact with the ubiquitously distributed channel-forming subunit and thus cannot selectively target a particular tissue. We performed a structure-activity relationship study of lithocholic acid (LCA), a cholane that activates BK channels via the accessory BK β1 subunit. The latter protein is highly abundant in smooth muscle but scarce in most other tissues. Modifications to the LCA lateral chain length and functional group yielded two novel smooth muscle BK channel activators in which the substituent at C24 has a small volume and a net negative charge. Our data provide detailed structural information that will be useful to advance a pharmacophore in search of β1 subunit-selective BK channel activators. These compounds are expected to evoke smooth muscle relaxation, which would be beneficial in the pharmacotherapy of prevalent human disorders associated with increased smooth muscle contraction, such as systemic hypertension, cerebral or coronary vasospasm, bronchial asthma, bladder hyperactivity, and erectile dysfunction. PMID:22945504

  17. Mice with deficient BK channel function show impaired prepulse inhibition and spatial learning, but normal working and spatial reference memory.

    Directory of Open Access Journals (Sweden)

    Marei Typlt

    Full Text Available Genetic variations in the large-conductance, voltage- and calcium activated potassium channels (BK channels have been recently implicated in mental retardation, autism and schizophrenia which all come along with severe cognitive impairments. In the present study we investigate the effects of functional BK channel deletion on cognition using a genetic mouse model with a knock-out of the gene for the pore forming α-subunit of the channel. We tested the F1 generation of a hybrid SV129/C57BL6 mouse line in which the slo1 gene was deleted in both parent strains. We first evaluated hearing and motor function to establish the suitability of this model for cognitive testing. Auditory brain stem responses to click stimuli showed no threshold differences between knockout mice and their wild-type littermates. Despite of muscular tremor, reduced grip force, and impaired gait, knockout mice exhibited normal locomotion. These findings allowed for testing of sensorimotor gating using the acoustic startle reflex, as well as of working memory, spatial learning and memory in the Y-maze and the Morris water maze, respectively. Prepulse inhibition on the first day of testing was normal, but the knockout mice did not improve over the days of testing as their wild-type littermates did. Spontaneous alternation in the y-maze was normal as well, suggesting that the BK channel knock-out does not impair working memory. In the Morris water maze knock-out mice showed significantly slower acquisition of the task, but normal memory once the task was learned. Thus, we propose a crucial role of the BK channels in learning, but not in memory storage or recollection.

  18. No Evidence for Infection of UK Prostate Cancer Patients with XMRV, BK Virus, Trichomonas vaginalis or Human Papilloma Viruses

    OpenAIRE

    Groom, Harriet C. T.; Warren, Anne Y; David E Neal; Kate N Bishop

    2012-01-01

    The prevalence of specific infections in UK prostate cancer patients was investigated. Serum from 84 patients and 62 controls was tested for neutralisation of xenotropic murine leukaemia virus-related virus (XMRV) Envelope. No reactivity was found in the patient samples. In addition, a further 100 prostate DNA samples were tested for XMRV, BK virus, Trichomonas vaginalis and human papilloma viruses by nucleic acid detection techniques. Despite demonstrating DNA integrity and assay sensitivity...

  19. The bradykinin BK2 receptor mediates angiotensin II receptor type 2 stimulated rat duodenal mucosal alkaline secretion

    Directory of Open Access Journals (Sweden)

    Helander Herbert F

    2003-02-01

    Full Text Available Abstract Background This study investigates bradykinin and nitric oxide as potential mediators of AT2-receptor-stimulated duodenal mucosal alkaline secretion. Duodenal mucosal alkaline secretion was measured in methohexital- and α-chloralose-anaesthetised rats by means of in situ pH-stat titration. Immunohistochemistry and Western blot were used to identify the BK2 receptors. Results The AT2 receptor agonist CGP42112A (0.1 μg kg-1 min-1 administered intravenously increased the duodenal mucosal alkaline secretion by ~50 %. This increase was sensitive to the selective BK2 receptor blocker HOE140 (100 ng/kg iv, but not to luminal administration of the NOS blocker L-NAME (0.3 mM. Mean arterial pressure did not differ between groups during the procedures. Immunohistochemistry showed a distinct staining of the crypt epithelium and a moderate staining of basal cytoplasm in villus enterocytes. Conclusion The results suggest that the AT2-receptor-stimulated alkaline secretion is mediated via BK2 receptors located in the duodenal cryptal mucosal epithelium.

  20. Pérdida de glutatión desde pulmones de conejo en solución de preservación para trasplante: Efectos clínicos y funcionales a corto plazo Loss of glutathione from rabbit lungs in transplant preservation solution

    OpenAIRE

    MARíA E SOLOVERA R; JUAN E CHEYRE F; ANDREA VECCHIOLA C; PILAR CELIS L; PABLO SANDOVAL A; GISELLA BORZONE T

    2009-01-01

    El daño por isquemia-reperfusión es causa de morbimortalidad en pacientes con trasplante pulmonar. Se desconoce si la solución de preservación habitual del pulmón puede contribuir a la deficiencia de antioxidantes, favoreciendo el estrés oxidativo en el receptor. Objetivo: Evaluar si existe pérdida de glutatión desde pulmones de conejo a la solución de preservación para trasplante. Resultados: Encontramos una disminución en el contenido de glutatión total del pulmón, sin aumento en el conteni...

  1. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    Science.gov (United States)

    Radchenko, V. M.; Ryabinin, M. A.; Stupin, V. A.

    2010-03-01

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  2. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    International Nuclear Information System (INIS)

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  3. Determining the Solar Inactivation Rate of BK Polyomavirus by Molecular Beacon.

    Science.gov (United States)

    Reano, Dane C; Yates, Marylynn V

    2016-07-01

    The application of molecular beacons (MB) that bind to precise sequences of mRNA provides a near-universal approach in detecting evidence of viral replication. Here, we demonstrate the detection of BK Polyomavirus (BKPyV), an emerging indicator of microbiological water quality, by a quantum dot-based MB. The MB allowed us to rapidly characterize the inactivation rate of BKPyV following exposure to a solar simulator (kobs = 0.578 ± 0.024 h(-1), R(2) = 0.92). Results were validated through a traditional cell-culture assay with immunofluorescence detection (kobs = 0.568 ± 0.011 h(-1), R(2) = 0.97), which exhibited a strong correlation to MB data (R(2) = 0.93). Obtaining solar inactivation rates for BKPyV demonstrates the first use of a MB in characterizing a microbiological inactivation profile and helps assess the appropriateness of adopting BKPyV as an indicator organism for water quality. PMID:27269231

  4. The dystrophin complex controls bk channel localization and muscle activity in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Hongkyun Kim

    2009-12-01

    Full Text Available Genetic defects in the dystrophin-associated protein complex (DAPC are responsible for a variety of pathological conditions including muscular dystrophy, cardiomyopathy, and vasospasm. Conserved DAPC components from humans to Caenorhabditis elegans suggest a similar molecular function. C. elegans DAPC mutants exhibit a unique locomotory deficit resulting from prolonged muscle excitation and contraction. Here we show that the C. elegans DAPC is essential for proper localization of SLO-1, the large conductance, voltage-, and calcium-dependent potassium (BK channel, which conducts a major outward rectifying current in muscle under the normal physiological condition. Through analysis of mutants with the same phenotype as the DAPC mutants, we identified the novel islo-1 gene that encodes a protein with two predicted transmembrane domains. We demonstrate that ISLO-1 acts as a novel adapter molecule that links the DAPC to SLO-1 in muscle. We show that a defect in either the DAPC or ISLO-1 disrupts normal SLO-1 localization in muscle. Consistent with observations that SLO-1 requires a high calcium concentration for full activation, we find that SLO-1 is localized near L-type calcium channels in muscle, thereby providing a mechanism coupling calcium influx with the outward rectifying current. Our results indicate that the DAPC modulates muscle excitability by localizing the SLO-1 channel to calcium-rich regions of C. elegans muscle.

  5. Optimization, purification, and characterization of L-asparaginase from Actinomycetales bacterium BkSoiiA.

    Science.gov (United States)

    Dash, Chitrangada; Mohapatra, Sukanti Bala; Maiti, Prasanta Kumar

    2016-01-01

    Actinobacteria are promising source of a wide range of important enzymes, some of which are produced in industrial scale, with others yet to be harnessed. L-Asparaginase is used as an antineoplastic agent. The present work deals with the production and optimization of L-asparaginase from Actinomycetales bacterium BkSoiiA using submerged fermentation in M9 medium. Production optimization resulted in a modified M9 medium with yeast extract and fructose as carbon and nitrogen sources, respectively, at pH 8.0, incubated for 120 hr at 30 ± 2 °C. The crude enzyme was purified to near homogeneity by ammonium sulfate precipitation following dialysis, ion-exchange column chromatography, and finally gel filtration. The sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis (PAGE) revealed an apparent molecular weight of 57 kD. The enzyme was purified 95.06-fold and showed a final specific activity of 204.37 U/mg with 3.49% yield. The purified enzyme showed maximum activity at a pH 10.0 and was stable at pH 7.0 to 9.0. The enzyme was activated by Mn(2+) and strongly inhibited by Ba(2+). All these preliminary characterization suggests that the L-asparaginase from the source may be a tool useful to pharmaceutical industries after further research.

  6. Characterization of Immunodominant BK Polyomavirus 9mer Epitope T Cell Responses

    Science.gov (United States)

    Cioni, M.; Leboeuf, C.; Comoli, P.; Ginevri, F.

    2016-01-01

    Uncontrolled BK polyomavirus (BKPyV) replication in kidney transplant recipients (KTRs) causes polyomavirus‐associated nephropathy and allograft loss. Reducing immunosuppression is associated with clearing viremia and nephropathy and increasing BKPyV‐specific T cell responses in most patients; however, current immunoassays have limited sensitivity, target mostly CD4+ T cells, and largely fail to predict onset and clearance of BKPyV replication. To characterize BKPyV‐specific CD8+ T cells, bioinformatics were used to predict 9mer epitopes in the early viral gene region (EVGR) presented by 14 common HLAs in Europe and North America. Thirty‐nine EVGR epitopes were experimentally confirmed by interferon‐γ enzyme‐linked immunospot assays in at least 30% of BKPyV IgG–seropositive healthy participants. Most 9mers clustered in domains, and some were presented by more than one HLA class I, as typically seen for immunodominant epitopes. Specific T cell binding using MHC class I streptamers was demonstrated for 21 of 39 (54%) epitopes. In a prospective cohort of 118 pediatric KTRs, 19 patients protected or recovering from BKPyV viremia were experimentally tested, and 13 epitopes were validated. Single HLA mismatches were not associated with viremia, suggesting that failing immune control likely involves multiple factors including maintenance immunosuppression. Combining BKPyV load and T cell assays using immunodominant epitopes may help in evaluating risk and reducing immunosuppression and may lead to safe adoptive T cell transfer. PMID:26663765

  7. Ultra-precision ductile grinding of BK7 using super abrasive diamond wheel

    Institute of Scientific and Technical Information of China (English)

    ZHAO Qingliang; Brinksmeier Ekkard; Riemer Oltmann; Rickens Kai

    2007-01-01

    In this paper,a novel conditioning technique using copper bonded diamond grinding wheels of 91 μm grain size and electrolytic in-process dressing (ELID) is first developed to precisely and effectively condition a nickelelectroplated monolayer coarse-grained diamond grinding wheel of 151 μm grain size.Under optimised conditioning parameters,the super abrasive diamond wheel was well conditioned in terms of a minimized run-out error and flattened diamond grain surfaces of constant peripheral envelope.The conditioning force was monitored by a force transducer,while the modified wheel surface status was in-situ monitored by a coaxial optical distance measurement system.Finally,the grinding experiment on BK7 was conducted using the well-conditioned wheel with the corresponding surface morphology and subsurface damage measured by atomic force microscope (AFM) and scanning electric microscope (SEM),respectively.The experimental result shows that the newly developed conditioning technique is applicable and feasible to ductile grinding optical glass featuring nano scale surface roughness,indicating the potential of super abrasive diamond wheels in ductile machining brittle materials.

  8. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    Science.gov (United States)

    Abdel-Aziz, M. M.; Azim, Osama A.; Abdel-Wahab, L. A.; Seddik, Mohamed M.

    2006-10-01

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti 2O 3), Hafnium dioxide (HfO 2), and Lima (mixture of oxides SiO 2/Al 2O 3); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A.

  9. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    International Nuclear Information System (INIS)

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti2O3), Hafnium dioxide (HfO2), and Lima (mixture of oxides SiO2/Al2O3); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A

  10. Human BK Polyomavirus—The Potential for Head and Neck Malignancy and Disease

    Directory of Open Access Journals (Sweden)

    Raquel Burger-Calderon

    2015-07-01

    Full Text Available Members of the human Polyomaviridae family are ubiquitous and pathogenic among immune-compromised individuals. While only Merkel cell polyomavirus (MCPyV has conclusively been linked to human cancer, all members of the polyomavirus (PyV family encode the oncoprotein T antigen and may be potentially carcinogenic. Studies focusing on PyV pathogenesis in humans have become more abundant as the number of PyV family members and the list of associated diseases has expanded. BK polyomavirus (BKPyV in particular has emerged as a new opportunistic pathogen among HIV positive individuals, carrying harmful implications. Increasing evidence links BKPyV to HIV-associated salivary gland disease (HIVSGD. HIVSGD is associated with elevated risk of lymphoma formation and its prevalence has increased among HIV/AIDS patients. Determining the relationship between BKPyV, disease and tumorigenesis among immunosuppressed individuals is necessary and will allow for expanding effective anti-viral treatment and prevention options in the future.

  11. P-waves imaging of the FRI and BK zones at the Grimsel Rock Laboratory

    International Nuclear Information System (INIS)

    This report is one of a series documenting the results of the Nagra-DOE Cooperative (NDC-I) research program in which the cooperating scientists explore the geological, geophysical, hydrological, geochemical, and structural effects anticipated from the use of a rock mass as a geological repository for nuclear waste. Tomographic imaging studies using a high frequency (10 Khz.) piezoelectric source and a three component receiver were carried out in two different regions of the underground Nagra Grimsel test facility in Switzerland. Both sites were in fractured granite, one being in a strongly foliated granite (FRI site), and the other being in a relatively homogeneous granite (BK zone). The object of the work was to determine if the seismic techniques could be useful in imaging the fracture zones and provide information on the hydrologic conditions. Both amplitude and velocity tomograms were obtained from the Data. The results indicate that the fracture zones strongly influenced the seismic wave propagation, thus imaging the fracture zones that were hydrologically important. 11 refs., 24 figs

  12. Continuum Limit of $B_K$ from 2+1 Flavor Domain Wall QCD

    CERN Document Server

    Aoki, Y; Blum, T; Boyle, P A; Brömmel, D; Christ, N H; Dawson, C; Izubuchi, T; Jung, C; Kelly, C; Kenway, R D; Lightman, M; Mawhinney, R D; Ohta, Shigemi; Sachrajda, C T; Scholz, E E; Soni, A; Sturm, C; Wennekers, J; Zhou, R

    2010-01-01

    We determine the neutral kaon mixing matrix element $B_K$ in the continuum limit with 2+1 flavors of domain wall fermions, using the Iwasaki gauge action at two different lattice spacings. These lattice fermions have near exact chiral symmetry and therefore avoid artificial lattice operator mixing. We introduce a significant improvement to the conventional NPR method in which the bare matrix elements are renormalized non-perturbatively in the RI-MOM scheme and are then converted into the MSbar scheme using continuum perturbation theory. In addition to RI-MOM, we introduce and implement four non-exceptional intermediate momentum schemes that suppress infrared non-perturbative uncertainties in the renormalization procedure. We compute the conversion factors relating the matrix elements in this family of RI-SMOM schemes and MSbar at one-loop order. Comparison of the results obtained using these different intermediate schemes allows for a more reliable estimate of the unknown higher-order contributions and hence ...

  13. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Aziz, M.M. [Physics Department, Faculty of Education, Ain Shams University, Cairo 11566 (Egypt)]. E-mail: melaziz@link.net; Azim, Osama A. [Vacuum Coating Manager, Arab International Optronics Co., El-salam City, Cairo 11566 (Egypt); Abdel-Wahab, L.A. [Head of Thermal Analysis Lab, National Center for Radiation Research and Technology, Cairo 11566 (Egypt); Seddik, Mohamed M. [Engineering Physics Department, Faculty of Engineering, Ain Shams University, Cairo 11566 (Egypt)

    2006-10-15

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti{sub 2}O{sub 3}), Hafnium dioxide (HfO{sub 2}), and Lima (mixture of oxides SiO{sub 2}/Al{sub 2}O{sub 3}); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A.

  14. Costo-utilidad del trasplante renal frente a la hemodiálisis en el tratamiento de la insuficiencia renal crónica terminal en un hospital peruano Cost utility of renal transplant vs. hemodialysis in the treatment of end stage chronic kidney failure in a peruvian hospital

    Directory of Open Access Journals (Sweden)

    Ricardo E. Loza-Concha

    2011-09-01

    Full Text Available Objetivos. Determinar y comparar las razones de costo-utilidad de los trasplantes renales con donante cadavérico (TRDC practicados en el Hospital Nacional Guillermo Almenara Irigoyen los años 2000-2001, frente a hemodiálisis (HD, cinco años después del inicio del tratamiento. Material y métodos. Se realizó un estudio de costo utilidad, estudiando a todos los pacientes continuadores cinco años post TRDC, a quienes se asignó como controles, dos pacientes con cinco años de HD pareados por edad, sexo y tiempo de enfermedad. Se evaluaron los costos de cada procedimiento, los años de vida ajustados a la calidad (AVAC utilizando el cuestionario SF-36v2TM y se calcularon las razones de costo utilidad (CU y costo utilidad incremental (CUI. Resultados. Se realizaron 58 TRDC los años 2000-2001. Cinco años después, 17 (29 % pacientes fallecieron y 27 (47 % continuaron con su tratamiento post-TRDC. Treinta y uno (53 % TRDC fracasaron; 26 % por rechazo al trasplante, 55 % por complicación y 19 % por tratamiento irregular. Los puntajes SF-36v2TM promedio obtenidos por los TRDC y HD fueron 95±13 y 87±18 puntos respectivamente. En ambos años, los AVAC obtenidos por los TRDC y HD fueron de 251 y 229 puntos respectivamente; las razones de CU para los TRDC y los HD fueron de USD 11 984 y USD 9243, y la razón de CUI fue de USD 40 669. Conclusiones. Los TRDC realizados los años 2000-2001, cinco años después resultaron menos costo útiles que las HD; y los TRDC realizados el 2000 tuvieron una menor razón de costo utilidad incremental que los efectuados el 2001, probablemente por su mayor razón de tratamientos irregulares.Objectives. To assess and compare the cost utility of the cadaveric donor renal transplant (CDRT at the Hospital Nacional Guillermo Almenara Irigoyen between 2000 to 2001, against haemodialysis (HD, 5 years after treatment initiation. Materials and Methods. A cost utility study design was used, which evaluated every patient

  15. Estudio secuencial y cuantitativo del quimerismo hemopoyético en pacientes sometidos a un trasplante alogénico de progenitores hemopoyéticos con depleción linfoide T o con acondicionamiento sub-mieloablativo.

    OpenAIRE

    Fernández Avilés, Francesc

    2004-01-01

    [spa] El objetivo principal de esta Tesis Doctoral es analizar cual es la frecuencia y la relevancia clínica de la persistencia de células linfoides T y de células mieloides originarias del receptor (quimerismo mixto) tras un trasplante alogénico de progenitores hemopoyéticos. La hipótesis de trabajo es comprobar si el estudio secuencial y cuantitativo del patrón de quimerismo mixto en linfocitos T y en neutrófilos permite predecir el rechazo del injerto alogénico o la recidiva leucémica, res...

  16. Reconstrucción total y parcial de cejas con trasplante de unidades foliculares: 10 años de experiencia Total and partial eyebrows reconstruction with folicular unit transplat: 10 years of experience

    OpenAIRE

    Llorens, D.; Planas, J.; Rengel, J.; Ortiz, J.

    2013-01-01

    Las cejas son elementos integrales en el carácter de la cara y en la expresión del espectro de emociones. Su patrón de cabello es complejo: toma varias direcciones y está colocado en diferente posición y con forma distinta en hombres y mujeres. Esta complejidad de características hace de su reconstrucción un reto. Se han establecido tres líneas básicas para conseguir dicho fin: injertos compuestos, colgajos y trasplante de unidades foliculares. Exponemos la experiencia de 10 años en la recons...

  17. Efectos de la glutamina parenteral en pacientes sometidos a trasplante de médula ósea Effects of parenteral glutamine in patients submitted to bone marrow transplantation

    OpenAIRE

    C. Gómez Candela; Castillo, R.; A. I. de Cos; IGLESIAS, C; M. C. Martín; Aguado, M J; Ojeda, E.

    2006-01-01

    El Trasplante de Médula Ósea (TMO), es un tratamiento utilizado en las neoplasias malignas hematológicas y tumores sólidos. La quimioterapia y/o radioterapia asociadas a que están sometidos estos pacientes, induce efectos secundarios, con un alto estrés metabólico. La glutamina es considerada como un aminoácido condicionalmente esencial y se ha mostrado eficaz en estados catabólicos severos. El objetivo del estudio fue valorar el efecto del tratamiento con Nutrición Parenteral (NP) suplementa...

  18. Reconstitución de la inmunidad celular T frente a citomegalovirus y control de la viremia en el paciente receptor de trasplante alogénico de precursores hematopoyéticos

    OpenAIRE

    Tormo Palop, Nuria

    2015-01-01

    Durante los últimos años la incidencia de la enfermedad orgánica causada por el Citomegalovirus (EOC) en los pacientes receptores de un trasplante alogénico de células precursoras hemotopoyéticas ha disminuido por el uso profiláctico o anticipado del ganciclovir e, indirectamente, el advenimiento de procedimientos muy sensibles para detectar la presencia del CMV en la sangre periférica (viremia): la PCR y la prueba de la antigenemia pp65 (AG). Aun así, la EOC continúa siendo una causa demasia...

  19. Trasplante de células progenitoras hematopoyéticas en enfermedades autoinmunes Hematopoietic stem cell transplantation in autoimmune diseases

    Directory of Open Access Journals (Sweden)

    Flavio Albarracín

    2008-04-01

    Full Text Available El trasplante de células progenitoras hematopoyéticas, células con capacidad de autorrenovación y reconstitución de todos los tipos de células sanguíneas, se utiliza en el tratamiento de numerosas enfermedades potencialmente letales incluyendo leucemias y linfomas. Hoy en día es posible además aplicarlo en el tratamiento de enfermedades autoinmunes graves, como esclerosis múltiple, lupus eritematoso sistémico o esclerosis sistémica, resistentes a la terapia convencional. Estudios en modelos animales nos demuestran que la transferencia de células progenitoras hematopoyéticas podría revertir el proceso de autoinmunidad, un fenómeno que puede explicarse mediante diferentes mecanismos. El resultado de los estudios clínicos que se están llevando a cabo, así como también estudios en pacientes y modelos animales, ayudarán a determinar el rol que el transplante de células progenitoras hematopoyéticas puede jugar en el tratamiento de enfermedades autoinmunes.Transplantation of hematopoietic stem cells, which are capable of self renewal and reconstitution of all types of blood cells, can be a treatment for numerous potential lethal diseases, including leukemias and lymphomas. It may now be applicable for the treatment of severe autoimmune diseases, such as therapy-resistant multiple sclerosis, lupus and systemic sclerosis. Studies in animal models show that the transfer of hematopoietic stem cells can reverse autoimmunity. The outcome of ongoing clinical trials, as well as of studies in patients and animal models, will help to determine the role that stem-cell transplantation can play in the treatment of autoimmune diseases.

  20. Trasplante de médula ósea: abordaje de la Terapia Ocupacional = Transplant of bony marrow : boarding th Occupational Theapy

    Directory of Open Access Journals (Sweden)

    Alahmar Bianchin, M

    2007-09-01

    Full Text Available ResumenEl trasplante de médula ósea (TMO es una modalidad terapéutica que se utiliza en una variedad de enfermedades oncológicas y hematológicas, con el objetivo de prolongar la remisión completa o la cura de la enfermedad. La unidad de TMO del Hospital de Base de San José Del Río Preto - San Pablo, Brasil, cuenta con un equipo formado por doctores, enfermeros, terapeuta ocupacional, psicólogo, nutricionista y asistente social. El estudio presente tiene por objetivo describir la importancia de la intervención de la Terapia Ocupacional a través del uso de actividades en la fase de aislamiento que conlleva el TMO, proporcionando así, una mejor aceptación y adaptación en relación al tratamiento SummaryBone Marrow Transplant is a therapeutical procedure that has been very used in a variety of oncological illnesses, also in hereditary and acquired hematologica illnesses, whith the objective to draw out illness complete remission or the cure. During the isolation of bone marrow transplant unit, many are the psycopathological reartions that patients can present in treatment adaptation period. With the intention of assisting the customer during this phase, the occupational therapy aims at this context, to supply a quality treatment, through activities with objective to raise they self- esteern, to diminish the ideness, to reduce stress it among othres generated for the illness. Therefore when carrying though much activities the costumer will be able to live since a simple satisfaction moment lentil one better acceptance and treatment adaptation.

  1. Analysis of real-time mixture cytotoxicity data following repeated exposure using BK/TD models.

    Science.gov (United States)

    Teng, S; Tebby, C; Barcellini-Couget, S; De Sousa, G; Brochot, C; Rahmani, R; Pery, A R R

    2016-08-15

    Cosmetic products generally consist of multiple ingredients. Thus, cosmetic risk assessment has to deal with mixture toxicity on a long-term scale which means it has to be assessed in the context of repeated exposure. Given that animal testing has been banned for cosmetics risk assessment, in vitro assays allowing long-term repeated exposure and adapted for in vitro - in vivo extrapolation need to be developed. However, most in vitro tests only assess short-term effects and consider static endpoints which hinder extrapolation to realistic human exposure scenarios where concentration in target organs is varies over time. Thanks to impedance metrics, real-time cell viability monitoring for repeated exposure has become possible. We recently constructed biokinetic/toxicodynamic models (BK/TD) to analyze such data (Teng et al., 2015) for three hepatotoxic cosmetic ingredients: coumarin, isoeugenol and benzophenone-2. In the present study, we aim to apply these models to analyze the dynamics of mixture impedance data using the concepts of concentration addition and independent action. Metabolic interactions between the mixture components were investigated, characterized and implemented in the models, as they impacted the actual cellular exposure. Indeed, cellular metabolism following mixture exposure induced a quick disappearance of the compounds from the exposure system. We showed that isoeugenol substantially decreased the metabolism of benzophenone-2, reducing the disappearance of this compound and enhancing its in vitro toxicity. Apart from this metabolic interaction, no mixtures showed any interaction, and all binary mixtures were successfully modeled by at least one model based on exposure to the individual compounds. PMID:27317371

  2. La práctica de la diligencia judicial de autopsia en los supuestos de fallecidos en los que se han extraído órganos para su trasplante

    Directory of Open Access Journals (Sweden)

    P.J. Pérez Jorge

    2015-06-01

    Full Text Available En España, el número de donaciones de fallecidos judiciales es mayor que en otros países de nuestro entorno, posiblemente porque el modelo español facilita en gran medida la interconexión activa entre el médico forense, el Juez de guardia y los coordinadores de trasplantes. Desde esta perspectiva humana, enaltece a la sociedad, basándose en la solidaridad y el altruismo por parte del donante y su familia. También la dota de un alto nivel sociocultural y técnico, tanto por la cantidad como por la calidad de los profesionales que intervienen en todo el operativo de trasplantes. En el presente trabajo se analiza la intervención judicial y del médico forense en las donaciones de órganos de cadáveres judiciales, enfatizando sobre las situaciones que en la práctica se pueden producir con respecto a las autopsias, así como en la necesidad de planes de actuación y protocolos que faciliten la intervención de los distintos operadores implicados para minimizar, en la medida de lo posible, el número de negativas judiciales.

  3. Early monitoring of the human polyomavirus BK replication and sequencing analysis in a cohort of adult kidney transplant patients treated with basiliximab

    Directory of Open Access Journals (Sweden)

    Mischitelli Monica

    2011-08-01

    Full Text Available Abstract Background Nowadays, better immunosuppressors have decreased the rates of acute rejection in kidney transplantation, but have also led to the emergence of BKV-associated nephropathy (BKVAN. Therefore, we prospectively investigated BKV load in plasma and urine samples in a cohort of kidney transplants, receiving basiliximab combined with a mycophenolate mofetil-based triple immunotherapy, to evaluate the difference between BKV replication during the first 3 months post-transplantation, characterized by the non-depleting action of basiliximab, versus the second 3 months, in which the maintenance therapy acts alone. We also performed sequencing analysis to assess whether a particular BKV subtype/subgroup or transcriptional control region (TCR variants were present. Methods We monitored BK viruria and viremia by quantitative polymerase chain reaction (Q-PCR at 12 hours (Tx, 1 (T1, 3 (T2 and 6 (T3 months post-transplantation among 60 kidney transplant patients. Sequencing analysis was performed by nested-PCR with specific primers for TCR and VP1 regions. Data were statistically analyzed using χ2 test and Student's t-test. Results BKV was detected at Tx in 4/60 urine and in 16/60 plasma, with median viral loads of 3,70 log GEq/mL and 3,79 log GEq/mL, respectively, followed by a significant increase of both BKV-positive transplants (32/60 and median values of viruria (5,78 log GEq/mL and viremia (4,52 log GEq/mL at T2. Conversely, a significantly decrease of patients with viruria and viremia (17/60 was observed at T3, together with a reduction of the median urinary and plasma viral loads (4,09 log GEq/mL and 4,00 log GEq/mL, respectively. BKV TCR sequence analysis always showed the presence of archetypal sequences, with a few single-nucleotide substitutions and one nucleotide insertion that, interestingly, were all representative of the particular subtypes/subgroups we identified by VP1 sequencing analysis: I/b-2 and IV/c-2. Conclusions Our

  4. Functional coupling of TRPV4 channels and BK channels in regulating spontaneous contractions of the guinea pig urinary bladder.

    Science.gov (United States)

    Isogai, Ayu; Lee, Ken; Mitsui, Retsu; Hashitani, Hikaru

    2016-09-01

    We investigated the role of TRPV4 channels (TRPV4) in regulating the contractility of detrusor smooth muscle (DSM) and muscularis mucosae (MM) of the urinary bladder. Distribution of TRPV4 in DSM and MM of guinea-pig bladders was examined by fluorescence immunohistochemistry. Changes in the contractility of DSM and MM bundles were measured using isometric tension recording. Intracellular Ca(2+) dynamics were visualized by Cal-520 fluorescent Ca(2+) imaging, while membrane potential changes were recorded using intracellular microelectrode technique. DSM and MM expressed TRPV4 immunoreactivity. GSK1016790A (GSK, 1 nM), a TRPV4 agonist, evoked a sustained contraction in both DSM and MM associated with a cessation of spontaneous phasic contractions in a manner sensitive to HC-067047 (10 μM), a TRPV4 antagonist. Iberiotoxin (100 nM) and paxilline (1 μM), large conductance Ca(2+)-activated K(+) (BK) channel blockers restored the spontaneous contractions in GSK. The sustained contractions in DSM and MM were reduced by nifedipine (10 μM), a blocker of L-type voltage-dependent Ca(2+) channels (LVDCCs) by about 40 % and by nominally Ca(2+)-free solution by some 90 %. GSK (1 nM) abolished spontaneous Ca(2+) transients, increased basal Ca(2+) levels and also prevented spontaneous action potential discharge associated with DSM membrane hyperpolarization. In conclusion, Ca(2+) influx through TRPV4 appears to activate BK channels to suppress spontaneous contractions and thus a functional coupling of TRPV4 with BK channels may act as a self-limiting mechanism for bladder contractility during its storage phase. Despite the membrane hyperpolarization in GSK, Ca(2+) entry mainly through TRPV4 develops the tonic contraction. PMID:27497848

  5. Energy up-conversion and trapping: Dynamics of 5f states of Bk4+ in CeF4

    International Nuclear Information System (INIS)

    Energy transfer mechanisms of excited 5f states of Bk4+ (0.05 atom %) in CeF4 containing circa 0.95 atom % Cf4+ have been investigated at 4 K. The observed anti-Stokes fluorescence arises from both up-conversion and two-photon excitation. Nonexponential decays of Stokes fluorescence are ascribed to both excitation-excitation annihilation and site-dependent trapping processes and, therefore, are not describable by the Inokuti-Hirayama or exciton annihilation models. Based on the Forster-Dexter energy transfer theory, a new model is developed to fit the observed fluorescence decay data. 16 refs., 3 figs

  6. Isospin Symmetry Breaking in B->K^* \\gamma Decay due to an Extra Generation of Vector Quarks

    CERN Document Server

    Ahmady, M R; Ahmady, Mohammad R.; Chishtie, Farrukh

    2005-01-01

    The extra contributions due to an extra generation of vector-like quarks to the isospin symmetry breaking observable associated with the radiative B->K^* \\gamma decay is obtained. It is shown that this additional contribution is sensitive to the nonunitarity parameter U^{sb}, which is a measure of the the strength of the non-zero tree-level flavor changing neutral current in this model. The significance of this result is that, once accurate experimental resultson the isospin asymmetry becomes available, one can constrain the U^{sb} independent of the mass of the extra quarks and so a much more stringent acceptablemodel parameter space could be obtained.

  7. Non-perturbative Renormalization of Four-Fermion Operators Relevant to $B_K$ with Staggered Quarks

    CERN Document Server

    Jeong, Hwancheol; Kim, Jongjeong; Lee, Weonjong; Pak, Jeonghwan; Park, Sungwoo

    2014-01-01

    We present preliminary results of matching factors of the four-fermion operators relevant to $B_K$, which are obtained using the non-perturbative renormalization (NPR) method in the RI-MOM scheme with HYP-smeared improved staggered fermions. We use the MILC asqtad coarse ($a \\cong 0.12\\,$fm) ensembles with $20^3 \\times 64$ geometry and $am_{\\ell}/am_s = 0.01/0.05$. We compare NPR results with those of one-loop perturbative matching.

  8. Voltage-dependent Ca2+ channels, not ryanodine receptors, activate Ca2+-dependent BK potassium channels in human retinal pigment epithelial cells

    OpenAIRE

    Wimmers, Sönke; Halsband, Claire; Seyler, Sebastian; Milenkovic, Vladimir; Strauß, Olaf

    2008-01-01

    Purpose In different tissues the activation of large conductance Ca2+-activated (BK) potassium channels has been shown to be coupled to voltage-gated Ca2+ channels as well as ryanodine receptors. As activation of BK channels leads to hyperpolarization of the cell, these channels provide a negative feedback mechanism for Ca2+-induced functions. Many cellular functions of the retinal pigment epithelium (RPE) are coupled to changes in [Ca2+]i. The aim of this study was to identify which Ca2+-ent...

  9. 肾移植术后BK病毒相关性肾病的研究现状%Study on BK virus-associated nephropathy after renal transplantation

    Institute of Scientific and Technical Information of China (English)

    肖荆; 田野

    2008-01-01

    BACKGROUND: BK viral infection after renal transplantation influences the prognosis of BK virus-associated nephropathy in renal transplant recipients. The disease has been widely studied in foreign countries.OBJECTIVE: This study was designed to sum up the diagnosis and treatment of BK virus-associated nephropathy after renal transplantation.RETRIVAL STRATEGY: Using the terms "renal transplantation; BK virus" in the English language, manuscripts responsible for BK virus-associated nephropathy after renal transplantation that were published from January 2000 to January 2007 were retrieved from the PubMed database. A total of 206 manuscripts were obtained and primarily screened. Inclusion criteria: studies addressing BK virus-associated nephropathy after renal transplantation. Exclusion criteria: repetitive studies.LITERATURE EVALUATION: The included manuscripts were primarily from PubMed database. Manuscripts were primarily original and review studies.DATA SYNTHESIS: BK virus can be found in the urine of 3%-40% of adult renal transplant recipients. BK virus reactivation rate is very high, but the histological manifestations of BK virus associated nephropathy are found only in a small number of renal transplant recipients. The prognosis of BK virus associated nephropathy is very poor. BK virus associated nephropathy develops into renal failure, leading to transplant loss, in 30%-50% patients. BK virus-caused renal transplant disease must be diagnosed according to histological manifestations. Viral infection should be primarily confirmed, but serological measurements have no predominant effects. Electron microscopy should be involved in the assessment of renal graft biopsy, especially when renal failure factors are unknown, as through the use of electron microscope, viral particles in the nucleus, cytoplasm and outside of the cells could be detectable. Viral antigen in the urine sample of patients with BK viruria can be detected by nucleic acid hybridization method

  10. Establecimiento de las condiciones para el trasplante de células de médula ósea en un modelo de enfermedad de Huntington y su efecto funcional a través de la conducta motora

    Directory of Open Access Journals (Sweden)

    Teresa Serrano Sánchez

    2012-06-01

    Full Text Available Título en ingles: Establishment of the conditions for the bone marrow cells transplants in a model of Huntington´s disease and functional effect on the motor  behavior Resumen  La enfermedad de Huntington  (EH es un trastorno degenerativo hereditario que afecta a personas con predisposición genética. No existe hasta hoy un tratamiento efectivo; la enfermedad avanza lentamente y el paciente termina en incapacidad o muerte después de 15 o 20 años. Los estudios relacionados con el tratamiento de las manifestaciones clínicas que aparecen en la enfermedad, incluyen tratamientos medicamentosos y el uso de trasplante de células. En la actualidad se conoce que es posible reproducir  algunas características de la enfermedad en modelos experimentales para ensayar posibles terapéuticas (ej. el modelo de lesión estriatal por inyección de ácido quinolínico; [AQ]. No se conoce el efecto restaurativo de las células de médula ósea (CMO en este modelo. Objetivos: 1 Caracterizar  morfológicamente la lesión por inyección intraestriatal de AQ. 2 Caracterizar inmunocitoquímicamente las CMO. 3 Evaluar la concentración óptima de CMO para el trasplante en el modelo y 4 Evaluar el estado funcional del trasplante de CMO, a través de la conducta motora. Resultados: Se estableció la dosis de AQ para lesionar de manera adecuada al estriado, se caracterizaron inmunofenotípicamente las CMO, se estableció la concentración celular óptima para el trasplante de CMO y se realizó la evaluación  funcional del trasplante. Conclusiones: 1 La dosis de 1,2 µL de AQ, fue capaz de lesionar adecuadamente el estriado, con una menor afectación de estructuras fuera del estriado. 2 Las CMO fueron positivas para los marcadores CD34, CD38, CD45 y CD90, lo que sugiere que esta población es heterogénea. 3 La mejor concentración de CMO para el trasplante fue la de 100 000 cél/ml,  ya que se obtuvo la mejor supervivencia y migración celular. 4 Las

  11. Reconstrucción total y parcial de cejas con trasplante de unidades foliculares: 10 años de experiencia Total and partial eyebrows reconstruction with folicular unit transplat: 10 years of experience

    Directory of Open Access Journals (Sweden)

    D. Llorens

    2013-03-01

    Full Text Available Las cejas son elementos integrales en el carácter de la cara y en la expresión del espectro de emociones. Su patrón de cabello es complejo: toma varias direcciones y está colocado en diferente posición y con forma distinta en hombres y mujeres. Esta complejidad de características hace de su reconstrucción un reto. Se han establecido tres líneas básicas para conseguir dicho fin: injertos compuestos, colgajos y trasplante de unidades foliculares. Exponemos la experiencia de 10 años en la reconstrucción de cejas a través del trasplante de unidades foliculares en la Clínica Planas de Barcelona (España con 58 pacientes consecutivos tratados en ese lapso y 94 cejas reconstruidas. Planteamos un estudio retrospectivo, observacional, transverso y descriptivo. Se analizaron la distribución de frecuencias y medidas de tendencia central de las variables. Los resultados obtenidos nos han permitido concluir que la técnica de trasplante de unidades foliculares es la mejor alternativa para la reconstrucción total y parcial de las cejas en casos seleccionados, con minúscula morbilidad, resultados netamente superiores y con una mínima interferencia en la vida del paciente.Eyebrows are integral elements in the character of the face and the expression of the spectrum of emotions. Its hair pattern is complex: it takes several directions and is placed in a different position and differently in men and women. This complexity of features makes reconstruction a challenge. In this way, we have established three basic areas to achieve this end: composite grafts, flaps and follicular units transplant. We report the experience of 10 years in the reconstruction of eyebrows throughout the follicular units transplantation technique at Clínica Planas in Barcelona ( Spain with 58 consecutive patients treated in this period and 94 eyebrows. A retrospective, observational, transverse and descriptive study was raised. We analyzed the frequency distribution and

  12. Recurrence of hepatocellular carcinoma after liver transplantation presenting as anastomotic biliary stricture Presentación del carcinoma hepatocelular recurrente tras el trasplante de hígado en forma de estenosis biliar anastomótica

    Directory of Open Access Journals (Sweden)

    S. Y. Chen

    2008-07-01

    Full Text Available A 52-year-old man visited our hospital complaining of anorexia and fatigue two months after receiving orthotopic liver transplantation for hepatocellular carcinoma. A laboratory investigation demonstrated a clinical picture of obstructive jaundice. T-tube cholangiography showed biliary stricture over the anastomotic site. Percutaneous transluminal balloon dilatation and stenting was attempted but failed. Magnetic resonance cholangiography showed possible tumor recurrence over the site of the anastomotic biliary stricture. A biopsy sample was obtained via ultrasound-guided aspiration and histopathological study revealed inflammatory and fibrotic changes. With high suspicion of recurrence of the hepatocellular carcinoma, surgical exploration was performed and an intraoperative frozen section proved the recurrence. We thus diagnosed this case as a recurrence of hepatocellular carcinoma after liver transplantation. To our knowledge, there have been no previous reports of early tumor recurrence after liver transplantation being the cause of an anastomotic biliary stricture.Un varón de 52 años visitó nuestro hospital quejándose de anorexia y fatiga a los dos meses de haber recibido un trasplante hepático ortotópico a causa de un carcinoma hepatocelular. La analítica mostró un cuadro clínico de ictericia obstructiva. La colangiografía con tubo en T mostró una estenosis biliar sobre la anastomosis. Se intentó una dilatación transluminal percutánea con globo y colocación de endoprótesis, que fracasó. La colangiografía por resonancia magnética mostró una posible recurrencia tumoral sobre el lugar de la estenosis biliar anastomótica. Se extrajo una muestra de biopsia mediante aspiración bajo guía ecográfica y el estudio histopatológico mostró alteraciones inflamatorias y fibróticas. Al sospecharse la recurrencia del carcinoma hepatocelular, se realizó una exploración quirúrgica; un corte intraoperatorio congelado demostr

  13. Resultados de una encuesta sobre donación y trasplante de órganos en la zona metropolitana de Guadalajara, México Survey results regarding organ donation and transplant in metropolitan Guadalajara, Mexico

    OpenAIRE

    Luz Consuelo Zepeda-Romero; Guillermo García-García; Oscar Aguirre-Jaúregui

    2003-01-01

    OBJETIVO: Evaluar el conocimiento y la disposición de la donación de órganos y tejidos con fines de trasplante entre la población adulta del área metropolitana de Guadalajara, Jalisco, México. MATERIAL Y MÉTODOS: Se realizó una encuesta aplicando un cuestionario de 29 reactivos a personas mayores de 18 años de edad, mediante entrevista directa en la vía pública. La zona metropolitana se dividió en cuatro municipios, asignándose a cada uno de éstos el número de encuestas en proporción al númer...

  14. Energy levels of 249Bk populated in the α decay of 99253Es and β- decay of 96249Cm

    International Nuclear Information System (INIS)

    The level structure of 249Bk has been investigated by measuring the γ-ray spectra of an extremely pure 253Es sample obtained by milking this nuclide from 253Cf source material produced in the High Flux Isotope Reactor at Oak Ridge National Laboratory. Additional information on the 249Bk levels was obtained from the β--decay study of 249Cm, produced by neutron irradiation of 248Cm. Using the results of the present study together with the data from previous 248Cm(α,t) and 248Cm(3He,d) reactions, the following single-particle states have been identified in 249Bk: 7/2+[633], 0.0 keV; 3/2-[521], 8.78 keV; 1/2+[400], 377.55 keV; 5/2+[642], 389.17 keV; 1/2-[530], 569.20 keV; 1/2-[521], 643.0 keV; 5/2-[523], 672.9 keV; and 9/2+[624], 1075.1 keV. Four vibrational bands were identified at 767.9, 932.2, 1150.7, and 1223.0 keV with tentative assignments of {7/2+ [633] x1-}9/2-, {7/2+ [633] x 0-}7/2-, {7/2+ [633] x 1-}5/2-, and {7/2+ [633] x 0+}7/2+, respectively. A band at 899.9 keV was observed in γ-γ coincidence measurements and given a tentative spin assignment of 3/2. It is possibly associated with a 2- phonon coupled to the ground state, with configuration {7/2+ [633] x 2-}3/2-. Three levels at 624.3, 703.5, and 769.1 keV were assigned spins of 5/2, 7/2, and 9/2, respectively. These could be the members of the 3/2+ [651] band, expected in this energy region

  15. 铜离子交换单步掩埋BK7玻璃波导的制备与表征%Characterization of Single Step Buried Waveguides on BK7 Glass by Copper Ion Exchange

    Institute of Scientific and Technical Information of China (English)

    王鹏飞; 郑杰; 鄂书林; G.C.Righini

    2004-01-01

    利用Cu离子交换技术制备了BK7玻璃平面光波导,在632.8 nm波长下,用棱镜耦合技术测量出所制备波导的有效折射率,利用反WKB方法计算并确定了平面光波导的折射率分布,通过对折射率分布进行函数拟合,发现离子交换后的样品折射率分布近似符合改进后的高斯分布,样品的折射率分布似乎是一个掩埋波导的折射率分布,求出所制备玻璃平面光波导在570℃的扩散系数De≈1.2133×10-14m2/s.同时,对所制备波导进行了电子显微镜(EMS)和次级离子质谱(SIMS)测试,得到了铜离子在玻璃表面的浓度分布,从而证明了实验所得到的BK7玻璃平面光波导是掩埋波导.这种掩埋平面波导是由单步Cu离子交换技术得到的.

  16. Novel mechanism of hydrogen sulfide-induced guinea pig urinary bladder smooth muscle contraction: role of BK channels and cholinergic neurotransmission.

    Science.gov (United States)

    Fernandes, Vítor S; Xin, Wenkuan; Petkov, Georgi V

    2015-07-15

    Hydrogen sulfide (H2S) is a key signaling molecule regulating important physiological processes, including smooth muscle function. However, the mechanisms underlying H2S-induced detrusor smooth muscle (DSM) contractions are not well understood. This study investigates the cellular and tissue mechanisms by which H2S regulates DSM contractility, excitatory neurotransmission, and large-conductance voltage- and Ca(2+)-activated K(+) (BK) channels in freshly isolated guinea pig DSM. We used a multidisciplinary experimental approach including isometric DSM tension recordings, colorimetric ACh measurement, Ca(2+) imaging, and patch-clamp electrophysiology. In isolated DSM strips, the novel slow release H2S donor, P-(4-methoxyphenyl)-p-4-morpholinylphosphinodithioic acid morpholine salt (GYY4137), significantly increased the spontaneous phasic and nerve-evoked DSM contractions. The blockade of neuronal voltage-gated Na(+) channels or muscarinic ACh receptors with tetrodotoxin or atropine, respectively, reduced the stimulatory effect of GYY4137 on DSM contractility. GYY4137 increased ACh release from bladder nerves, which was inhibited upon blockade of L-type voltage-gated Ca(2+) channels with nifedipine. Furthermore, GYY4137 increased the amplitude of the Ca(2+) transients and basal Ca(2+) levels in isolated DSM strips. GYY4137 reduced the DSM relaxation induced by the BK channel opener, NS11021. In freshly isolated DSM cells, GYY4137 decreased the amplitude and frequency of transient BK currents recorded in a perforated whole cell configuration and reduced the single BK channel open probability measured in excised inside-out patches. GYY4137 inhibited spontaneous transient hyperpolarizations and depolarized the DSM cell membrane potential. Our results reveal the novel findings that H2S increases spontaneous phasic and nerve-evoked DSM contractions by activating ACh release from bladder nerves in combination with a direct inhibition of DSM BK channels.

  17. A comparison of HK-CONWIP and BK-CONWIP control strategies in a multi-product manufacturing system

    Directory of Open Access Journals (Sweden)

    Chukwunonyelum Emmanuel Onyeocha

    2015-12-01

    Full Text Available This paper evaluates the performance of the Hybrid Kanban Constant Work-In-Process control strategy and Basestock Kanban Constant Work-In-Process control strategy operating Shared Kanban Allocation Policy (S-KAP and Dedicated Kanban Allocation Policy (D-KAP in a multi-product serial flow line. We explored the effect of an increase of product types on the WIP inventory in the system. A simulation-based optimisation technique was used in determining the optimal settings for the strategies. The strategies were compared via pairwise comparison technique and Nelson’s ranking and selection procedure. S-KAP responds quicker to demand than D-KAP. BK-CONWIP outperforms HK-CONWIP in a serial manufacturing system. It was shown that an increase in the number of product-type increases the number of PAC and WIP inventory.

  18. No evidence for infection of UK prostate cancer patients with XMRV, BK virus, Trichomonas vaginalis or human papilloma viruses.

    Directory of Open Access Journals (Sweden)

    Harriet C T Groom

    Full Text Available The prevalence of specific infections in UK prostate cancer patients was investigated. Serum from 84 patients and 62 controls was tested for neutralisation of xenotropic murine leukaemia virus-related virus (XMRV Envelope. No reactivity was found in the patient samples. In addition, a further 100 prostate DNA samples were tested for XMRV, BK virus, Trichomonas vaginalis and human papilloma viruses by nucleic acid detection techniques. Despite demonstrating DNA integrity and assay sensitivity, we failed to detect the presence of any of these agents in DNA samples, bar one sample that was weakly positive for HPV16. Therefore we conclude that these infections are absent in this typical cohort of men with prostate cancer.

  19. Trasplante hepático

    OpenAIRE

    J. I. Herrero; Pardo, F.; J Quiroga; F. Rotellar

    2006-01-01

    Liver transplantation is an efficient therapeutic option for terminal hepatic diseases. The principal indications of liver transplantation are hepatic cirrhosis, hepatic tumours (mainly, hepotocellular carcinoma) and acute liver failure. Over the years, the absolute contraindications for a transplant have lessened. Surgical techniques have also undergone changes. The results of liver transplant have improved so that survival one year after the transplant is close to ...

  20. La Poste

    CERN Multimedia

    2004-01-01

    http://www.cern.ch/cern50/ The French Post Office has issued ten commemorative envelopes bearing original images depicting CERN and its history. This special fiftieth anniversary collector's edition will be available on the French Post Office (« La Poste ») stand at the Open Day on 16 October, in the CMS experiment hall at Cessy. Information for collectors: a pictorial postmark and date stamp have been specially designed and produced for the occasion with the assistance of CERN's graphics team. Sending a philatelic souvenir is a great way to commemorate the Open Day, so La Poste will be setting up a large post-box for that very purpose next to its stand. A perfect way to send images of CERN all around the world...

  1. Marketingová situační analýza BK Lions Jindřichův Hradec

    OpenAIRE

    Hron, Patrik

    2014-01-01

    The aim of this bachelor thesis is to carry out an analysis of each part of marketing mix and the environment in which the BK Lions Jindřichův Hradec basketball club is situated. Suitable and applicable recommendations are suggested to make the marketing mix more effective based on analysis of marketing situation. The first part is focused on describing the marketing mix and marketing situational analysis at a theoretical level. The practical part describes particular marketing tools which ar...

  2. Gentamicin Blocks the ACh-Induced BK Current in Guinea Pig Type II Vestibular Hair Cells by Competing with Ca2+ at the l-Type Calcium Channel

    Directory of Open Access Journals (Sweden)

    Hong Yu

    2014-04-01

    Full Text Available Type II vestibular hair cells (VHCs II contain big-conductance Ca2+-dependent K+ channels (BK and L-type calcium channels. Our previous studies in guinea pig VHCs II indicated that acetylcholine (ACh evoked the BK current by triggering the influx of Ca2+ ions through l-type Ca2+ channels, which was mediated by M2 muscarinic ACh receptor (mAChRs. Aminoglycoside antibiotics, such as gentamicin (GM, are known to have vestibulotoxicity, including damaging effects on the efferent nerve endings on VHCs II. This study used the whole-cell patch clamp technique to determine whether GM affects the vestibular efferent system at postsynaptic M2-mAChRs or the membrane ion channels. We found that GM could block the ACh-induced BK current and that inhibition was reversible, voltage-independent, and dose-dependent with an IC50 value of 36.3 ± 7.8 µM. Increasing the ACh concentration had little influence on GM blocking effect, but increasing the extracellular Ca2+ concentration ([Ca2+]o could antagonize it. Moreover, 50 µM GM potently blocked Ca2+ currents activated by (--Bay-K8644, but did not block BK currents induced by NS1619. These observations indicate that GM most likely blocks the M2 mAChR-mediated response by competing with Ca2+ at the l-type calcium channel. These results provide insights into the vestibulotoxicity of aminoglycoside antibiotics on mammalian VHCs II.

  3. Inhalation of the BK(Ca-opener NS1619 attenuates right ventricular pressure and improves oxygenation in the rat monocrotaline model of pulmonary hypertension.

    Directory of Open Access Journals (Sweden)

    Marc Revermann

    Full Text Available BACKGROUND: Right heart failure is a fatal consequence of chronic pulmonary hypertension (PH. The development of PH is characterized by increased proliferation of vascular cells, in particular pulmonary artery smooth muscle cells (PASMCs and pulmonary artery endothelial cells. In the course of PH, an escalated right ventricular (RV afterload occurs, which leads to increased perioperative morbidity and mortality. BK(Ca channels are ubiquitously expressed in vascular smooth muscle cells and their opening induces cell membrane hyperpolarization followed by vasodilation. Moreover, BK activation induces anti-proliferative effects in a multitude of cell types. On this basis, we hypothesized that treatment with the nebulized BK channel opener NS1619 might be a therapy option for pulmonary hypertension and tested this in rats. METHODS: (1 Rats received monocrotaline injection for PH induction. Twenty-four days later, rats were anesthetized and NS1619 or the solvent was administered by inhalation. Systemic hemodynamic parameters, RV hemodynamic parameters, and blood gas analyses were measured before as well as 30 and 120 minutes after inhalation. (2 Rat PASMCs were stimulated with PDGF-BB in the presence and absence of NS1619. AKT, ERK1 and ERK2 activation were investigated by western blot analyses, and relative cell number was determined 48 hours after stimulation. RESULTS: Inhalation of a 12 µM and 100 µM NS1619 solution significantly reduced RV pressure without affecting systemic arterial pressure. Blood gas analyses demonstrated significantly reduced carbon dioxide and improved oxygenation in NS1619-treated animals pointing towards a considerable pulmonary shunt-reducing effect. In PASMC's, NS1619 (100 µM significantly attenuated PASMC proliferation by a pathway independent of AKT and ERK1/2 activation. CONCLUSION: NS1619 inhalation reduces RV pressure and improves oxygen supply and its application inhibits PASMC proliferation in vitro. Hence, BK

  4. Evaluation of the Genetic Variation of Non Coding Control Region of BK Virus Using Nested-PCR Sequencing Method in Renal Graft Patients

    Directory of Open Access Journals (Sweden)

    A Emami

    2015-05-01

    Full Text Available Background & aim: Polyomaviruses (BK is a comprehensive infection with more than of 80% prevalence in the world. One of the most important reasons of BK virus nephropathy is in the renal transplant recipients and rejection of transplanted tissue between them. Non Coding region of this virus play a regulatory role in replication and amplification of the virus. The aim of this study was to evaluate the genetic patterns of this area in renal graft at Namazi Transplantation Center, Shiraz, Iran. Methods: In the present experimental study, 380 renal allograft serums were collected. DNAs of 129 eligible samples were extracted and evaluated using a virus genome. The presence of the virus was determined by qualitative and sequencing. Of these, 129 samples were tested for the presence of virus according to the condition study, using quantitative, qualitative genomic amplification and sequencing. Results: The study showed symptoms of nephropathy, 76 (58.9% of them were males and 46 (35.7% were females with the mean age 38.0±.089 years of age. In general, 46 patients (35.7% percent were positive for BK Polyomaviruses. After comparing the genomic sequence with applications of molecular they were categorized in three groups and then recorded in gene bank. Conclusion: About 35% of renal transplant recipients with high creatinine levels were positive for the presence of BK virus. Non-coding region of respondents in the sample survey revealed that among patients with the most common genotypes were rearranged the entire transplant patients were observed at this tranplant center. Examination of these sequences indicated that this rearrangments had a specific pattern, different from the standard strain of archaea type.

  5. Impact of mTORC1 inhibition on keratinocyte proliferation during skin tumor promotion in wild-type and BK5.AktWT mice.

    Science.gov (United States)

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2014-11-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.Akt(WT) mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15-30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2-4 h) was mediated by activation of EGFR and Akt. BK5.Akt(WT) transgenic mice, where Akt1 is overexpressed in basal epidermis, are highly sensitive to TPA-induced epidermal proliferation and two-stage skin carcinogenesis. Targeting mTORC1 with rapamycin effectively inhibited TPA-induced epidermal hyperplasia and hyperproliferation as well as tumor promotion in a dose-dependent manner in both wild-type and BK5.Akt(WT) mice. A significant expansion (∼threefold) of the label retaining cell (LRC) population per hair follicle was observed in BK5.Akt(WT) mice compared to FVB/N mice. There was also a significant increase in K15 expressing cells in the hair follicle of transgenic mice that coincided with expression of phospho-Akt, phospho-S6K, and phospho-PRAS40, suggesting an important role of mTORC1 signaling in bulge-region keratinocyte stem cell (KSC) homeostasis. After 2 weeks of TPA treatment, LRCs had moved upward into the interfollicular epidermis from the bulge region of both wild-type and BK5.Akt(WT) mice. TPA-mediated LRC proliferation and migration was significantly inhibited by rapamycin. Collectively, the current data indicate that signaling through mTORC1 contributes significantly to the process of skin tumor promotion through effects on proliferation of the target cells for tumor development.

  6. Impact of mTORC1 inhibition on keratinocyte proliferation during skin tumor promotion in wild-type and BK5.AktWT mice.

    Science.gov (United States)

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2014-11-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.Akt(WT) mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15-30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2-4 h) was mediated by activation of EGFR and Akt. BK5.Akt(WT) transgenic mice, where Akt1 is overexpressed in basal epidermis, are highly sensitive to TPA-induced epidermal proliferation and two-stage skin carcinogenesis. Targeting mTORC1 with rapamycin effectively inhibited TPA-induced epidermal hyperplasia and hyperproliferation as well as tumor promotion in a dose-dependent manner in both wild-type and BK5.Akt(WT) mice. A significant expansion (∼threefold) of the label retaining cell (LRC) population per hair follicle was observed in BK5.Akt(WT) mice compared to FVB/N mice. There was also a significant increase in K15 expressing cells in the hair follicle of transgenic mice that coincided with expression of phospho-Akt, phospho-S6K, and phospho-PRAS40, suggesting an important role of mTORC1 signaling in bulge-region keratinocyte stem cell (KSC) homeostasis. After 2 weeks of TPA treatment, LRCs had moved upward into the interfollicular epidermis from the bulge region of both wild-type and BK5.Akt(WT) mice. TPA-mediated LRC proliferation and migration was significantly inhibited by rapamycin. Collectively, the current data indicate that signaling through mTORC1 contributes significantly to the process of skin tumor promotion through effects on proliferation of the target cells for tumor development. PMID:24114993

  7. Computed Tomography Findings of Human Polyomavirus BK (BKV)-Associated Cystitis in Allogeneic Hematopoietic Stem Cell Transplant Recipients

    Energy Technology Data Exchange (ETDEWEB)

    Schulze, M.; Beck, R.; Igney, A.; Vogel, M.; Maksimovic, O.; Claussen, C.D.; Faul, C.; Horger, M. (Dept. of Diagnostic Radiology, Dept. of Internal Medicine-Oncology, and Inst. of Medical Virology, Eberhard-Karls Univ., Tbingen (Germany))

    2008-12-15

    Background: Over 70% of the general population worldwide is positive for antibodies against polyomavirus hominis type 1 (BKV). Polyomavirus can be reactivated in immunocompromised patients and thereby induce urogenital tract infection, including cystitis. Purpose: To describe the computed tomography (CT) findings of human polyomavirus-induced cystitis in adult patients after allogeneic hematopoietic stem cell transplantation (allogeneic HCT). Material and Methods: The study population was a retrospective cohort of 11 consecutive adult patients (eight men, three women; age range 22-59 years, mean 42.9 years) who received allogeneic HCT between December 2003 and December 2007 and were tested positive for urinary BKV infection. All CT scans were evaluated with regard to bladder wall thickness, mucosal enhancement, distinct layering of thickened bladder wall, and presence of intravesical clots, perivesical stranding as well as attenuation values of intravesical urine. Clinical data concerning transplant and conditioning regimen variables and laboratory parameters were correlated with degree and extent of imaging findings. Results: All patients had clinical signs of cystitis with different degrees of thickening of the urinary bladder wall. Well-delineated urinary bladder layers were present in six patients. Thickening of the urinary bladder wall was continuous in nine of 11 patients. Increased attenuation of intravesical urine was found in seven patients with hemorrhagic cystitis. Four patients had intraluminal clots. Perivesical stranding was not a major CT finding, occurring in a mild fashion in three of 11 patients. The clinical classification of hemorrhagic cystitis did not correlate with the analyzed imaging parameters. Patient outcome was not influenced by this infectious complication. Conclusion: CT findings in patients with polyomavirus BK cystitis consist of different degrees of bladder wall thickening usually with good delineation of all mural layers and

  8. Computed Tomography Findings of Human Polyomavirus BK (BKV)-Associated Cystitis in Allogeneic Hematopoietic Stem Cell Transplant Recipients

    Energy Technology Data Exchange (ETDEWEB)

    Schulze, M.; Beck, R.; Igney, A.; Vogel, M.; Maksimovic, O.; Claussen, C.D.; Faul, C.; Horger, M. [Dept. of Diagnostic Radiology, Dept. of Internal Medicine-Oncology, and Inst. of Medical Virology, Eberhard-Karls Univ., Tbingen (Germany)

    2008-12-15

    Background: Over 70% of the general population worldwide is positive for antibodies against polyomavirus hominis type 1 (BKV). Polyomavirus can be reactivated in immunocompromised patients and thereby induce urogenital tract infection, including cystitis. Purpose: To describe the computed tomography (CT) findings of human polyomavirus-induced cystitis in adult patients after allogeneic hematopoietic stem cell transplantation (allogeneic HCT). Material and Methods: The study population was a retrospective cohort of 11 consecutive adult patients (eight men, three women; age range 22-59 years, mean 42.9 years) who received allogeneic HCT between December 2003 and December 2007 and were tested positive for urinary BKV infection. All CT scans were evaluated with regard to bladder wall thickness, mucosal enhancement, distinct layering of thickened bladder wall, and presence of intravesical clots, perivesical stranding as well as attenuation values of intravesical urine. Clinical data concerning transplant and conditioning regimen variables and laboratory parameters were correlated with degree and extent of imaging findings. Results: All patients had clinical signs of cystitis with different degrees of thickening of the urinary bladder wall. Well-delineated urinary bladder layers were present in six patients. Thickening of the urinary bladder wall was continuous in nine of 11 patients. Increased attenuation of intravesical urine was found in seven patients with hemorrhagic cystitis. Four patients had intraluminal clots. Perivesical stranding was not a major CT finding, occurring in a mild fashion in three of 11 patients. The clinical classification of hemorrhagic cystitis did not correlate with the analyzed imaging parameters. Patient outcome was not influenced by this infectious complication. Conclusion: CT findings in patients with polyomavirus BK cystitis consist of different degrees of bladder wall thickening usually with good delineation of all mural layers and

  9. SUSPICIOUS POST

    CERN Document Server

    Relations with the Host States Service

    2001-01-01

    If you receive a suspicious letter or package in the post, please do not open it and contact the Fire Brigade Tel. 74444. They will contact the CERN Medical Service. This is especially important in today's current situation with regard to the Anthrax scare. For further information, the Permanent Mission of Switzerland to the International Organisations in Geneva recommends the following web sites:   http://www.admin.ch/ch/f/cf/brennpunkt/03.html http://www.who.int/emc-documents/zoonoses/whoemczdi986c.html

  10. Impact of mTORC1 Inhibition on Keratinocyte Proliferation During Skin Tumor Promotion in Wild-Type and BK5.AktWT Mice

    OpenAIRE

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2013-01-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.AktWT mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15–30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2–4 h)...

  11. Infección Activa por el Citomegalovirus (CMV) en el trasplante alogénico de precursores hematopoyéticos:Investigación de nuevos factores biológicos para la estimación del riesgo y análisis integral de los mecanismos inmunitarios que la previenen y controlan

    OpenAIRE

    Giménez Quiles, Estela Berenice

    2016-01-01

    Citomegalovirus (CMV) es causa frecuente de morbididad y mortalidad en el marco del trasplante alogénico de precursores hematopoyéticos (alo-TPH). CMV puede ocasionar enfermedad orgánica o tisular (neumonía intersticial o enfermedad gastrointestinal, con mayor frecuencia), en virtud de su “citopatogenicidad” . CMV también puede causar morbididad a través de mecanismos indirectos, relacionados con su capacidad inmunosupresora y pro-inflamatoria; en ese contexto, CMV parece incrementar el ries...

  12. Protocolos clínicos de actuación ante el proceso de donación y extracción de órganos y tejidos para trasplante en donación en muerte encefálica

    OpenAIRE

    J.M. Dueñas Jurado

    2015-01-01

    En el proceso de donación y trasplante de órganos habrá un protocolo de puntos clave para mejorar resultados. La detección de donantes tiene lugar principalmente en las unidades de medicina intensiva (UMI), urgencias y plantas neurológicas. La etiología más frecuente de muerte encefálica (ME) suele ser accidentes cerebrovasculares agudos (ACVA). El mantenimiento del donante es en las UMI. La ME desencadenará cambios fisiopatológicos: inestabilidad hemodinámica, pérdida de respiración espontán...

  13. Factores diagnósticos endoscópicos y pronósticos relacionados con el Helicobacter Pylori en la enfermedad injerto contra huésped tras el trasplante alogénico de células hematopoyéticas

    OpenAIRE

    Velasco Guardado, Antonio

    2015-01-01

    [ES] INTRODUCCIÓN: El trabajo consta de tres artículos originales relacionados por un lado con el diagnóstico endoscópico e histológico en la Enfermedad de Injerto contra Huésped (EICH) tras el trasplante alogénico de células hematopoyéticas (TACH) y por otro sobre el papel que juega la infección por Helicobacter pylori (HP) en dicha enfermedad. El tracto gastrointestinal es la principal diana de la Enfermedad de Injerto contra Huésped. Su diagnóstico se basa en los hallazgos endoscópicos e ...

  14. Fracaso renal agudo en el trasplante de progenitores hematopoyéticos: análisis de la incidencia, factores de riesgo e implicaciones pronósticas. Valor pronóstico y en el diagnóstico precoz de la cistatina c plasmática

    OpenAIRE

    Solís Salguero, Miguel Ángel

    2015-01-01

    El trasplante de progenitores hematopoyéticos es el único tratamiento curativo de muchas enfermedades hematológicas, algunas alteraciones metabólicas y ciertas inmunodeficiencias. Persigue regenerar el tejido hematopoyético cuya función resulta insuficiente, bien por una enfermedad primaria de la médula ósea o a consecuencia de un tratamiento de quimioterapia y/o radioterapia. Precisa un rescate de la función hematopoyética con la obtención de células progenitoras que puedan regenerar la f...

  15. Parenteral nutrition supplemented with glutamine in patients undergoing bone marrow transplantation Nutrición parenteral suplementada con glutamina en pacientes sometido a trasplante de médula ósea

    Directory of Open Access Journals (Sweden)

    L. Alonso Pérez

    2010-02-01

    Full Text Available The objective of the study is to evaluate if the administration of glutamine in parenteral nutrition (PN solution reduces the need for antibiotics, the risk of liver disease and the duration of hospital stay in bone marrow transplantation. Material and methods: Retrospective observational study in 68 adult patients undergoing a bone marrow transplantation who required PN for mucositis. Of these patients, 40 were given PN with 2,063 ± 294 kcal/day and 98.6 ± 13.9 g of amino acids/day, supplemented with Lglutamine (13.5-27 g/day, and 28 were given isocaloric (1,966 ± 307 kcal/day and isonitrogenated (92 ± 16.3 g of amino acids/day PN with standard glutamine-free amino acid solution. Antibiotic consumption and duration of hospital stay were analysed. Of the total cohort, hepatic profile was studied at the beginning and on day 7 of PN in 50 patients without liver disease at the start of PN. Results: There were no differences between both groups with regard to total number and duration of antibiotics prescribed or hospital stay. Of the 50 patients without hepatic alterations at the beginning of PN, 2 patients in the control group and 5 in the glutamine group developed a hepatic profile compatible with liver disease secondary to PN. Comparing both groups, there were no differences in hepatic enzyme values. Conclusions: Supplementation with PN glutamine does not improve the variables studied, but the actual clinical use of glutamine in this haematological treatment should be studied further and its potential advantages identified.El objetivo del estudio es determinar si la administración de glutamina en la solución de nutrición parenteral (NP disminuye la necesidad de antibióticos, el riesgo de hepatopatía y la duración de la estancia hospitalaria en trasplante de células hematológicas. Material y método: Estudio observacional retrospectivo, con 68 pacientes adultos sometidos a trasplante de células hematológicas, que precisaron NP por

  16. Molecular mechanisms underlying the effect of the novel BK channel opener GoSlo: involvement of the S4/S5 linker and the S6 segment.

    Science.gov (United States)

    Webb, Timothy I; Kshatri, Aravind Singh; Large, Roddy J; Akande, Adebola Morayo; Roy, Subhrangsu; Sergeant, Gerard P; McHale, Noel G; Thornbury, Keith D; Hollywood, Mark A

    2015-02-17

    GoSlo-SR-5-6 is a novel large-conductance Ca(2+)-activated K(+) (BK) channel agonist that shifts the activation V1/2 of these channels in excess of -100 mV when applied at a concentration of 10 μM. Although the structure-activity relationship of this family of molecules has been established, little is known about how they open BK channels. To help address this, we used a combination of electrophysiology, mutagenesis, and mathematical modeling to investigate the molecular mechanisms underlying the effect of GoSlo-SR-5-6. Our data demonstrate that the effects of this agonist are practically abolished when three point mutations are made: L227A in the S4/S5 linker in combination with S317R and I326A in the S6C region. Our data suggest that GoSlo-SR-5-6 interacts with the transmembrane domain of the channel to enhance pore opening. The Horrigan-Aldrich model suggests that GoSlo-SR-5-6 works by stabilizing the open conformation of the channel and the activated state of the voltage sensors, yet decouples the voltage sensors from the pore gate.

  17. Immunogenicity and protection from malaria infection in BK-SE36 vaccinated volunteers in Uganda is not influenced by HLA-DRB1 alleles.

    Science.gov (United States)

    Tougan, Takahiro; Ito, Kazuya; Palacpac, Nirianne Marie Q; Egwang, Thomas G; Horii, Toshihiro

    2016-10-01

    SE36 antigen, derived from serine repeat antigen 5 (SERA5) of Plasmodium falciparum, is a promising blood stage malaria vaccine candidate. Designated as BK-SE36, the SE36 antigen was formulated with aluminum hydroxyl gel (AHG) and produced under Good Manufacturing Practice (GMP) constraints. In a Phase Ib clinical trial and follow-up study in Uganda, the risk for malaria symptoms was reduced by 72% compared with the control group. Although promising, the number of responders to the vaccine in 6-20years-olds was approximately 30% with the majority in the younger cohort. This is in contrast to the phase Ia clinical trial where response to the vaccine was 100% in Japanese malaria naive adults. A consideration that can be of importance is the involvement of host genetic factors that may influence the ability to mount an effective immune response to vaccination as well as susceptibility to malaria infection. We, therefore, analyzed allelic polymorphism of human leukocyte antigen (HLA)-DRB1 alleles using sequence-based typing (SBT). In this study, DRB1 alleles did not influence antibody response to BK-SE36 and the vaccinees susceptibility to clinical malaria. PMID:27343834

  18. High prevalence of the simultaneous excretion of polyomaviruses JC and BK in the urine of HIV-infected patients without neurological symptoms in São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz Henrique da Silva Nali

    2012-08-01

    Full Text Available OBJECTIVE: To evaluate the prevalence of the urinary excretion of BKV and JCV in HIV-infected patients without neurological symptoms. METHODS: Urine samples from HIV-infected patients without neurological symptoms were tested for JC virus and BK virus by PCR. Samples were screened for the presence of polyomavirus with sets of primers complementary to the early region of JCV and BKV genome (AgT. The presence of JC virus or BK virus were confirmed by two other PCR assays using sets of primers complementary to the VP1 gene of each virus. Analysis of the data was performed by the Kruskal-Wallis test for numerical data and Pearson or Yates for categorical variables. RESULTS: A total of 75 patients were included in the study. The overall prevalence of polyomavirus DNA urinary shedding was 67/75 (89.3%. Only BKV DNA was detected in 14/75 (18.7% urine samples, and only JCV DNA was detected in 11/75 (14.7% samples. Both BKV and JCV DNA were present in 42/75 (56.0% samples. CONCLUSION: In this study we found high rates of excretion of JCV, BKV, and simultaneous excretion in HIV+ patients. Also these results differ from the others available on the literature.

  19. Coordinación y logística del trasplante de tejidos de donantes de cadáver intra y extra-hospitalarios. "Modelo Pamplona": Cadena de actuación 1992-2006 Transplant coordination and logistics of intra and extra-hospital cadaver donor tissue. "The Pamplona Model": Sequence of tasks performed from 1992-2006

    Directory of Open Access Journals (Sweden)

    E. Maraví-Poma

    2006-08-01

    Full Text Available Fundamento. La donación de tejidos y órganos constituye la única alternativa para muchos pacientes. La muerte cerebral (MC facilita esta actitud. Aquellos hospitales no-generadores de donantes con MC, tienen que generar donantes a partir de fallecidos por parada cardiorrespiratoria, llamados donantes de tejidos (DT. En este trabajo se expone el modelo de coordinación y donación de tejidos de DT intra y extra-hospitalarios en la Comunidad Foral de Navarra. Se crea un Programa de detección, donación, extracción, denominado Modelo Pamplona, desde 1992-2006. Material y métodos. A partir de 1990 se organiza el Equipo de Trasplantes formado por un médico de la Unidad de Cuidados Intensivos del hospital Virgen del Camino, Instituto Navarro de Medicina Legal (INML y SOS-Navarra. En 1996 la Coordinación de Trasplantes del HVC es definido como centro de referencia para el Programa de Trasplantes de Tejidos de la Comunidad de Navarra. Resultados. Se desarrollan protocolos consensuados para la detección intra y extrahospitalaria de los fallecidos en parada cardiorrespiratoria: - Alarma desde hospitales del SNS-O, SOS-Navarra, jueces y forenses del INML. - Criterios de selección, búsqueda y contacto con familiares. - Aviso a equipos de serología, extracción y transporte. - Logística y reparto de los tejidos. - Incentivos pactados: económicos, administrativos y normativa al respecto. Conclusiones. El modelo Pamplona, desde el hospital Virgen del Camino resulta positivo y es único en el mundo. La coordinación intra y extrahospitalaria de trasplantes de donantes cadáver desde un hospital de referencia, es un avance científico y organizativo a tener en cuenta para la creación de equipos de extracción y trasplante de tejidos.Introduction. Tissue and organ donations are the only option for many patients. Cerebral death (CD facilitates this approach. However, hospitals that do not provide CD donors have to adapt in order to obtain donors

  20. The Research Progress of BK Virus Infection After Renal Transplantation%肾移植术后BK病毒感染研究进展

    Institute of Scientific and Technical Information of China (English)

    范宇(综述); 石炳毅; 钱叶勇(审校)

    2014-01-01

    BK病毒是一种隶属于多瘤病毒种属的DNA病毒,在正常人群中的感染率高达90%。然而,仅在免疫功能受损的个体中引发相关疾病,以接受移植手术后服用免疫抑制药物的患者最为显著。 BK病毒的持续复制被认为是导致肾移植受者移植肾功能受损的重要因素,而由其引发的BK病毒性肾病( BKVN)则已成为肾移植失败的重要原因之一。应用尿细胞学染色和检测尿液或血液中BK病毒DNA载量等方法可对BK病毒感染和BKVN进行监测并早期诊断,增加了早期治疗的成功率。然而,由于缺乏特异性的抗病毒药物,BKVN的治疗仍然是非常困难。该文即针对肾移植术后BK病毒感染的流行病学、发病机制、实验室检测方法以及治疗策略的研究予以综述。%The BK virus,a DNA virus from the polyomavirus group,infects up to 90% of the general population. However,significant clinical manifestations are rare and limited to individuals with impaired im-mune functions,especially in the renal transplant recipients who recepted immunosuppressor. Persistent BK virus replication in patients with renal allografts was identified as an important cause of progressive graft dys-function,and the BK virus nephritis ( BKVN) has emerged as an important cause of renal transplant failure. Diagnostic strategies using urine cytology and BKV load measurements in urine or plasma have led to earlier diagnosis of BKV infection and BKVN,which increased the success rate of intervention. But due to the lack of specific antiviral drugs,the treatment of BKVN is difficult. In this review,we discuss the epidemiology,patho-genesis,detction method and current treatment protocols.

  1. Observation of a resonance-like structure in the pi^+- psi' mass distribution in exclusive B-->K pi^+- psi' decays

    CERN Document Server

    Abe, K; Aihara, H; Arinstein, K; Aso, T; Aulchenko, V; Aushev, T; Aziz, T; Bahinipati, S; Bakich, A M; Balagura, V; Ban, Y; Banerjee, S; Barberio, E; Bay, A; Bedny, I; Belous, K S; Bhardwaj, V; Bitenc, U; Blyth, S; Bondar, A; Bozek, A; Bracko, M; Brodzicka, J; Browder, T E; Chang, M C; Chang, P; Chao, Y; Chen, A; Chen, K F; Chen, W T; Cheon, B G; Chiang, C C; Chistov, R; Cho, I S; Choi, S K; Choi, Y; Choi, Y K; Cole, S; Dalseno, J; Danilov, M; Das, A; Dash, M; Dragic, J; Drutskoy, A; Eidelman, S; Epifanov, D; Fratina, S; Fujii, H; Fujikawa, M; Gabyshev, N; Garmash, A; Go, A; Gokhroo, G; Goldenzweig, P; Golob, B; Grosse-Perdekamp, M; Guler, H; Ha, H; Haba, J; Hara, K; Hara, T; Hasegawa, Y; Hastings, N C; Hayasaka, K; Hayashii, H; Hazumi, M; Heffernan, D; Higuchi, T; Hinz, L; Hoedlmoser, H; Hokuue, T; Horii, Y; Hoshi, Y; Hoshina, K; Hou, S; Hou, W S; Hsiung, Y B; Hyun, H J; Igarashi, Y; Iijima, T; Ikado, K; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Jacoby, C; Joshi, N J; Kaga, M; Kah, D H; Kaji, H; Kajiwara, S; Kakuno, H; Kang, J H; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, H; Kawasaki, T; Kibayashi, A; Kichimi, H; Kim, H J; Kim, H O; Kim, J H; Kim, S K; Kim, Y J; Kinoshita, K; Korpar, S; Kozakai, Y; Krizan, P; Krokovny, P; Kumar, R; Kurihara, E; Kusaka, A; Kuzmin, A; Kwon, Y J; Lange, J S; Leder, G; Lee, J; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Li, J; Limosani, A; Lin, S W; Liu, Y; Liventsev, D; MacNaughton, J; Majumder, G; Mandl, F; Marlow, D; Matsumura, T; Matyja, A; McOnie, S; Medvedeva, T; Mikami, Y; Mitaroff, W A; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Moloney, G R; Mori, T; Müller, J; Murakami, A; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakano, E; Nakao, M; Nakayama, H; Nakazawa, H; Natkaniec, Z; Neichi, K; Nishida, S; Nishimura, K; Nishio, Y; Nishizawa, I; Nitoh, O; Noguchi, S; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, S; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, C W; Park, H; Park, K S; Parslow, N; Peak, L S; Pernicka, M; Pestotnik, R; Peters, M; Piilonen, L E; Poluektov, A; Rorie, J; Rózanska, M; Sahoo, H; Sakai, Y; Sakamoto, H; Sakaue, H; Sarangi, T R; Satoyama, N; Sayeed, K; Schietinger, T; Schneider, O; Schonmeier, P; Schümann, J; Schwanda, C; Schwartz, A J; Seidl, R; Sekiya, A; Senyo, K; Sevior, M E; Shang, L; Shapkin, M; Shen, C P; Shibuya, H; Shinomiya, S; Shiu, J G; Shwartz, B; Singh, J B; Sokolov, A; Solovieva, E; Somov, A; Stanic, S; Staric, M; Stypula, J; Sugiyama, A; Sumisawa, K; Sumiyoshi, T; Suzuki, S; Suzuki, S Y; Tajima, O; Takasaki, F; Tamai, K; Tamura, N; Tanaka, M; Taniguchi, N; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tse, Y F; Tsuboyama, T; Uchida, K; Uchida, Y; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Yu; Varner, G; Varvell, K E; Vervink, K; Villa, S; Vinokurova, A; Wang, C C; Wang, C H; Wang, J; Wang, M Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wicht, J; Widhalm, L; Wiechczynski, J; Won, E; Yabsley, B D; Yamaguchi, A; Yamamoto, H; Yamaoka, M; Yamashita, Y; Yamauchi, M; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A; Zwahlen, N

    2007-01-01

    A distinct peak is observed in the pi^+/- psi' invariant mass distribution near 4.43 GeV in B->K pi^+/- psi' decays. A fit using a Breit Wigner resonance shape yields a peak mass and width of 4433+-4(stat)+-1(syst) MeV and Gamma = 44^+17_-13(stat) ^+30_-11 MeV. The product branching fraction is determined to be Bf(B-->KZ(4430))xBf(Z(4430)-->pi^+psi') = (4.1+-1.0(stat)+-1.3(syst))x10^{-5), where Z(4430) is used to designate the observed structure. The statistical significance of the observed peak is greater than 7sigma. These results are obtained from a 605 fb-1 data sample that contains 657 million BBbar pairs collected near the Upsilon(4S) resonance with the Belle detector at the KEKB asymmetric energy e+e- collider.

  2. Transformation of primary human embryonic kidney cells to anchorage independence by a combination of BK virus DNA and the Harvey-ras oncogene

    International Nuclear Information System (INIS)

    Primary human embryonic kidney (HEK) cells were transformed by a focus assay with BK virus (BKV) DNA molecularly cloned at its unique EcoRI site. Both viral DNA sequences and viral tumor antigens were present and expressed in all the foci that the authors examined. However, cells isolated from foci were incapable of growth in soft agar. They then examined the transformation of HEK cells after their transfection with a combination of BKV DNA and either the normal or the activated form of the human Ha-ras oncogene (EJ c-Ha-ras-1). Only the cells transfected with a combination of BKV DNA and the activated form of Ha-ras DNAs were present in the transformed colonies. BKV tumor antigens and the Ha-ras p21 protein were also expressed

  3. Orientations and proximities of the extracellular ends of transmembrane helices S0 and S4 in open and closed BK potassium channels.

    Directory of Open Access Journals (Sweden)

    Xiaowei Niu

    Full Text Available The large-conductance potassium channel (BK α subunit contains a transmembrane (TM helix S0 preceding the canonical TM helices S1 through S6. S0 lies between S4 and the TM2 helix of the regulatory β1 subunit. Pairs of Cys were substituted in the first helical turns in the membrane of BK α S0 and S4 and in β1 TM2. One such pair, W22C in S0 and W203C in S4, was 95% crosslinked endogenously. Under voltage-clamp conditions in outside-out patches, this crosslink was reduced by DTT and reoxidized by a membrane-impermeant bis-quaternary ammonium derivative of diamide. The rate constants for this reoxidation were not significantly different in the open and closed states of the channel. Thus, these two residues are approximately equally close in the two states. In addition, 90% crosslinking of a second pair, R20C in S0 and W203C in S4, had no effect on the V50 for opening. Taken together, these findings indicate that separation between residues at the extracellular ends of S0 and S4 is not required for voltage-sensor activation. On the contrary, even though W22C and W203C were equally likely to form a disulfide in the activated and deactivated states, relative immobilization by crosslinking of these two residues favored the activated state. Furthermore, the efficiency of recrosslinking of W22C and W203C on the cell surface was greater in the presence of the β1 subunit than in its absence, consistent with β1 acting through S0 to stabilize its immobilization relative to α S4.

  4. BK Virus-Hemorrhagic Cystitis Following Allogeneic Stem Cell Transplantation: Clinical Characteristics and Utility of Leflunomide Treatment

    Directory of Open Access Journals (Sweden)

    Young Hoon Park

    2016-08-01

    Full Text Available Objective: BK virus-hemorrhagic cystitis (BKV-HC is a potential cause of morbidity and mortality in patients having undergone allogeneic stem cell transplantation (Allo-SCT. We analyzed the clinical features of BKV-HC following Allo-SCT and reported the utility of leflunomide therapy for BKV-HC. Materials and methods: From January 2005 to June 2014, among the 69 patients underwent Allo-SCT in our institution, the patients who experienced BKV-HC were investigated retrospectively. Results: Hemorrhagic cystitis (HC was observed in 30 patients (43.5%, and among them, 18 patients (26.1% were identified as BKV-HC. The median age of the patients (12 males and 6 females was 45 years (range, 13-63. Patients received Allo-SCT from acute myeloid leukemia (n=11, aplastic anemia (n=4, myelodysplastic syndrome (n=2, and non-Hodgkin lymphoma (n=1.The donor types were a HLA-matched sibling donor for 6 patients, HLA-matched unrelated donor for 9, and a haploidentical familial donor for 2. The median onset and duration of BKV-HC was on day 21 (range, 7-97 after transplantation and 22 days (range, 6-107. Eleven patients (62.1% had grade I-II HC and seven patients (38.9% had grade III-IV (high-grade HC. Among the seven patients who had high-grade HC, one had complete response (CR, one partial response (PR, and five no response (NR. Among the five non-responders, one died of BKV-HC associated complications. The remaining four patients were treated with leflunomide, with achieving CR (n=2 and PR (n=2. The median duration from the start of leflunomide therapy to response was 13 days (range, 8–17 days. All patients tolerated the leflunomide treatment well, with three patients having mild gastrointestinal symptoms, including anorexia and abdominal bloating. Conclusion: BKV-HC was commonly observed in patients with HC following Allo-SCT. In high-grade BKV-HC patients who fail supportive care, leflunomide may be a feasible option without significant toxicity. Materials

  5. Aspectos sócio-políticos da implantação da Central de Transplantes do Piauí Aspectos socio-políticos de la implantación de la Central de Trasplantes de Piauí Socio-political aspects of the implantation of the Transplant Center of Piauí

    Directory of Open Access Journals (Sweden)

    Adélia Dalva da Silva Oliveira

    2007-08-01

    Full Text Available Estudo qualitativo objetivando compreender os aspectos sócio-políticos que mediaram a implantação da central de transplante do Piauí, identificar os sujeitos sociais envolvidos nessa implantação e analisar a participação da sociedade civil organizada. Fizeram parte do estudo dez sujeitos diretamente relacionados com a implantação da central, sendo delimitados por meio da técnica de "bola-de-neve". Utilizou-se a entrevista semi-estruturada, gravada, transcrita e submetida à análise temática. Concluiu-se que, a implantação da central de transplante no Piauí, foi fruto de um complexo jogo de negociações e interesses entre Estado e sociedade civil organizada, já que não havia um projeto político para ações na área dos transplantes. Esse distanciamento da responsabilidade da Gestão Pública caracteriza a importância que foi dada a essa implantação.El presente documento es un Estudio cualitativo objetivando comprender los aspectos sociopolíticos que mediaron en la implantación de la Central de Trasplante de Piauí, se propone identificar los sujetos sociales involucrados en esa implantación y analizar la participación de la sociedad civil organizada. Hicieron parte del estudio diez sujetos directamente relacionados con la implantación de la central de trasplante, siendo delimitados a través de la técnica de "bola-de-nieve". Se utilizó la entrevista semi-estructurada, grabada, transcrita y sometida al análisis temático. Se concluyó que la implantación de la central de trasplante en Piauí, fue fruto de un complejo juego de negociaciones e intereses entre el Estado y la sociedad civil organizada, ya que no había un proyecto político para acciones en el área de los trasplantes. Ese distanciamiento de la responsabilidad de la Gestión Pública caracteriza la importancia que fue dada a esa implantación.A qualitative study aiming at understanding the socio-political aspects that mediate the implantation of the

  6. USO DE MEDICAMENTOS INMUNOSUPRESORES EN PACIENTES CON TRASPLANTE RENAL, HEPÁTICO Y DE MÉDULA ÓSEA, EN UNA CLÍNICA DE NIVEL III DE BOGOTÁ Use of immunosuppressive drugs in patients with kidney, liver or bone marrow transplant in a high complexity clinic in Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge J López G

    2009-01-01

    Full Text Available Antecedentes. El trasplante de órganos en la actualidad es una opción terapéutica para los pacientes que cursan estadíos terminales de ciertas patologías; el uso de inmunosupresores contribuye en gran medida a la efectividad de este tipo de tratamientos, ya que es fundamental para evitar el rechazo. El no seguimiento del consumo de medicamentos nuevos, como es el caso de los inmunosupresores que suelen tener precios relativamente elevados, junto con la ampliación injustificada de indicaciones, puede ocasionar un aumento de los costos de la terapia farmacológica y, lo más importante, causar riesgos en el paciente trasplantado. Objetivos. Describir y caracterizar el uso de medicamentos inmunosupresores en pacientes con trasplante renal, de médula ósea alogénico y hepático. Material y métodos. Estudio observacional-descriptivo de corte transversal con recolección retrospectiva de la información a un año. Se trata de un estudio de utilización de medicamentos sobre hábitos de prescripción. Resultados. El desenlace global de la terapia del trasplante produce resultados satisfactorios en un 92,5 por ciento (49 pacientes, 5,7 por ciento (3 pacientes presentan rechazo con retiro del injerto, mientras que un paciente fallece después de ser sometido al trasplante. El medicamento más prescrito es el micofenolato de mofetil, con 41 prescripciones (28%, mientras que el más consumido es la prednisona con 2,38 dosis diaria definidas /100 pacientes/día. Conclusiones. Se evidencia la presencia de micofenolato, ciclosporina y corticoides en la mayoría de los esquemas con algunas prescripciones de anticuerpos monoclonales y globulina antitimocítica.Background. Organ transplantation is currently a therapeutic option for patients at the terminal stages of diverse pathologies. The use of immunosuppressants greatly contributes to the efficacy of these treatments by preventing organ rejection. The lack of follow-up to the use of new medications

  7. Efectos de la glutamina parenteral en pacientes sometidos a trasplante de médula ósea Effects of parenteral glutamine in patients submitted to bone marrow transplantation

    Directory of Open Access Journals (Sweden)

    C. Gómez Candela

    2006-02-01

    Full Text Available El Trasplante de Médula Ósea (TMO, es un tratamiento utilizado en las neoplasias malignas hematológicas y tumores sólidos. La quimioterapia y/o radioterapia asociadas a que están sometidos estos pacientes, induce efectos secundarios, con un alto estrés metabólico. La glutamina es considerada como un aminoácido condicionalmente esencial y se ha mostrado eficaz en estados catabólicos severos. El objetivo del estudio fue valorar el efecto del tratamiento con Nutrición Parenteral (NP suplementada con glutamina sobre la duraci��n del soporte nutricional en un grupo de pacientes con TMO. También han sido analizadas las complicaciones asociadas, valoración del estado nutricional, evolución clínica a los 6 meses, diferencias en el tipo de transplante y capacidad de ingesta oral. Se trata de un Ensayo Clínico en fase IV, aleatorizado, doble ciego, paralelo y unicéntrico. El Estudio se realizó en 49 pacientes, 29% varones y 71% mujeres, con edades comprendidas entre 21-63 años, distribuidos en tres grupos diagnósticos (leucemias, linfomas y tumores sólidos, ingresados en el Servicio de Hematología de nuestro Hospital. El 50% de pacientes en cada grupo han recibido NP suplementada con glutamina (0,4 g/kg/día de L-alanil-L-glutamina y otro 50% han recibido NP Estándar. RESULTADOS: No se han encontrado diferencias significativas, ni al inicio ni al final del estudio entre ambos grupos, en relación con las variables estudiadas. CONCLUSIONES: La NP es un tratamiento efectivo para el mantenimiento del estado nutricional, en los pacientes sometidos a una terapia con efecto altamente catabólico, como es el TMO. Aunque no hemos podido demostrar la eficacia de la suplementación con glutamina en este estudio con la dosis de glutamina utilizada, sí ha resultado ser eficaz en otras publicaciones.Bone marrow transplantation (BMT is a therapy used for hematologic malignancies and solid tumors. Associated chemotherapy and radiotherapy to

  8. Eficacia de la glutamina parenteral en pacientes sometidos a trasplante autólogo de médula ósea Efficacy of parenteral glutamine in patients undergoing bone marrow transplantation

    Directory of Open Access Journals (Sweden)

    J. G. Oliva García

    2012-02-01

    Full Text Available Introducción: El Trasplante Autólogo de Médula Ósea (TASPE conlleva un alto estrés metabólico. La glutamina es considerada se ha mostrado eficaz en estados catabólicos severos, aunque hay estudios contradictorios. Objetivos: Valorar el efecto del tratamiento con nutrición parenteral (NP suplementada con glutamina en el desarrollo de mucositis y en la estancia media hospitalaria en pacientes sometidos a TASPE. Metodología: Estudio retrospectivo de pacientes con TASPE efectuados entre 2006 y 2009. En 2008 se introdujo de forma protocolizada la adición de 1 vial de L-alanil-L-glutamina (20 g en las fórmulas de NP de dichos pacientes. Se seleccionaron aleatoriamente 13 historias a partir de dicha fecha (grupo glutamina y 13 historias anteriores (grupo control (n = 26. Se comparó el grado de mucositis y la estancia hospitalaria en los dos grupos. En el subgrupo de pacientes tratados con glutamina, se comparó la dosis de glutamina que recibieron los pacientes que desarrollaron algún grado mucositis con aquellos que no presentaron dicha complicación. Resultados: Estancia media: 27,8 ± 7,4 días (grupo control vs 20,3 ± 5,3 días (grupo glutamina (p = 0,01. La gravedad de la mucositis fue menor en el grupo glutamina (p = 0,02. La dosis de L-alanail-L-glutamina ajustada por peso en los pacientes que no desarrollaron mucositis fue mayor que en los que la desarrollaron (0,32 vs 0,24 g/kg/día; p = 0,02. Conclusiones: La suplementación con glutamina reduce el grado de mucositis y la estancia hospitalaria en pacientes sometidos a transplante autólogo de médula ósea. El grado de mucositis es menor en el subgrupo de pacientes que reciben dosis más elevadas de glutamina.Introduction: Autologous bone marrow transplant (ABMT represents a high metabolic stress. Glutamine has proven to be effective in severe catabolic states, although there are controversial studies. Objectives: To assess the effect of parenteral nutrition (PN therapy

  9. Application of a real-time PCR assay to detect BK potassium channel expression in samples from Atlantic salmon (Salmo salar and Rainbow trout (Oncorhynchus mykiss acclimated to freshwater#

    Directory of Open Access Journals (Sweden)

    CA Loncoman

    2015-01-01

    Full Text Available Atlantic salmon (Salmo salar and Rainbow trout (Oncorhynchus mykiss are two fish species that spawn in fresh water (FW and, during development, acclimate to seawater (SW by secreting excess NaCl to the environment. The salmon industry measures Na+/K+ ATPase (NKA activity as a molecular marker to determine the timing of smolt transfer from FW to SW. However, the lack of other accurate molecular markers of smoltification remains a major issue for the fish farming industry. The molecular mechanism of NaCl secretion in gills from SW-acclimated fish has a thermodynamic requirement to recycle K+ out of the cell via potassium channels therefore we hypothesised that potassium channel expression in gills may be a suitable candidate to monitor the smoltification process. In support of this hypothesis, we observed increased expression of BK potassium channel mRNA in gills from S. salar under conditions of high salinity (1.2% compared to animals in FW. In this work, we designed a real-time PCR analysis in order to quantify mRNA levels of BK potassium channels in S. salar organ samples. We found differences in mRNA expression among gills, kidney and intestine. We also found a unique real-time PCR product in S. salar gills through melting curve analysis, agarose gel electrophoresis and cDNA sequencing. This PCR product showed a 98% of identity with the BK channel portion recorded by the NCBI Database and was differentially expressed in gills, kidney and intestine. This real-time PCR assay may become an important tool to study BK potassium channels expressed in the gills of S. salar and its changes during smoltification as putative new candidate to monitor this process.

  10. Post-Adolescent Issues

    Science.gov (United States)

    Search COPING & HEALING CARING FOR A CHILD: POST-ADOLESCENT ISSUES As your child reaches adulthood, there will ... intake. New issues that you and your post adolescent child may want to discus together with his/ ...

  11. Prevalence of Polyoma BK Virus (BKPyV), Epstein-Barr Virus (EBV) and Human Papilloma Virus (HPV) in Oropharyngeal Cancer.

    Science.gov (United States)

    Polz-Gruszka, Dorota; Morshed, Kamal; Jarzyński, Adrian; Polz-Dacewicz, Małgorzata

    2015-01-01

    The aim of this study was to analyze the prevalence of BK virus, Human Papillomavirus and Epstein-Barr virus in oropharyngeal cancer, and to test our hypothesis that BKV/HPV/EBV co-infection plays a role in oropharyngeal squamous cell carcinoma. The correlation between viral infection, OSCC, anatomic location, pre-treatment staging, evidence of metastases to lymph nodes, and grading was also investigated. The examination samples were collected from 62 patients from paraffin tissue blocks. Males (90.3%) with, smoking (83.9%) and alcohol abuse (67.7%) problems prevailed in the studied group. G2 histological type was recognized in 80.6% cases. T4 (77.4%) and N2 (56.5%) traits occurred in the majority of patients. No cases of metastasis were observed (M0 100%). HPV - 24.2%, EBV - 27.4% and BKV 17.7% were detected in the studied samples. We observed co-infection EBV/BKV in 8% of cases, HPV/BKV in 4.8%, and HPV/EBV in 9% cases. Only in two cases co-infection of all three viruses was found.

  12. Hydrophobic interaction between contiguous residues in the S6 transmembrane segment acts as a stimuli integration node in the BK channel

    Science.gov (United States)

    Carrasquel-Ursulaez, Willy; Contreras, Gustavo F.; Sepúlveda, Romina V.; Aguayo, Daniel; González-Nilo, Fernando

    2015-01-01

    Large-conductance Ca2+- and voltage-activated K+ channel (BK) open probability is enhanced by depolarization, increasing Ca2+ concentration, or both. These stimuli activate modular voltage and Ca2+ sensors that are allosterically coupled to channel gating. Here, we report a point mutation of a phenylalanine (F380A) in the S6 transmembrane helix that, in the absence of internal Ca2+, profoundly hinders channel opening while showing only minor effects on the voltage sensor active–resting equilibrium. Interpretation of these results using an allosteric model suggests that the F380A mutation greatly increases the free energy difference between open and closed states and uncouples Ca2+ binding from voltage sensor activation and voltage sensor activation from channel opening. However, the presence of a bulky and more hydrophobic amino acid in the F380 position (F380W) increases the intrinsic open–closed equilibrium, weakening the coupling between both sensors with the pore domain. Based on these functional experiments and molecular dynamics simulations, we propose that F380 interacts with another S6 hydrophobic residue (L377) in contiguous subunits. This pair forms a hydrophobic ring important in determining the open–closed equilibrium and, like an integration node, participates in the communication between sensors and between the sensors and pore. Moreover, because of its effects on open probabilities, the F380A mutant can be used for detailed voltage sensor experiments in the presence of permeant cations. PMID:25548136

  13. Prediction of post-post-perovskite transitions

    Science.gov (United States)

    Umemoto, K.

    2008-12-01

    In the Earth, the post-perovskite structure is the final form of MgSiO3. However, in the solar giants and exoplanets in which pressure is much higher than the Earth, we can expect further phase transitions beyond the post-perovskite phase, i.e., post-post-perovskite transitions. Here we propose by first principles two candidates of crystalline post-post-perovskite phases of NaMgF3, which is a low-pressure analog of MgSiO3: U2S3-type and P63/mmc phases. Then we demonstrate that Al2O3 should undergo a transition to the U2S3-type phase at ~3.7 Mbar. This transformation should be important for the analysis of shock data in this pressure range, since alumina is used as window material. Our calculated compression curves agree with shock data excellently, suggesting the presence of two phase transitions (corundum-to-Rh2O3(II)-type and Rh2O3(II)-type-to-CaIrO3-type) in shock data. Our prediction also suggests that the multi-Mbar crystal chemistry of planet-forming minerals might be related to that of the rare-earth sulfides. Computations were performed at the Minnesota Supercomputing Institute. Research was supported by NSF grants EAR-0135533, EAR-0230319, and ITR-0428774 (VLab).

  14. Stem-cells transplantation for myocardial regeneration Trasplante autólogo de médula ósea: propuesta basada en la evidencia, para un consenso en enfermedad cardiovascular

    Directory of Open Access Journals (Sweden)

    Francisco Cuellar Ambrosi

    2005-04-01

    éneo que se desarrolla después de un "evento índice", el cual produce daño del tejido muscular cardíaco por la pérdida de cardiomiocitos o por la alteración de la capacidad del miocardio para generar una fuerza eficiente para la contracción ventricular. La noxa inicial puede ser de aparición súbita como en el síndrome coronario agudo o insidiosa y gradual como en la enfermedad coronaria crónica y las cardiomiopatías primarias y secundarias. Independiente del factor que genere el síndrome, se produce una serie de respuestas hemodinámicas y neurohormonales con cambios moleculares complejos, que conducen a la progresión de la disfunción ventricular y a mayor pérdida de células contráctiles funcionantes por necrosis o por apoptosis. Las estrategias terapéuticas desarrolladas para interrumpir este círculo vicioso de disfunción miocárdica y remodelación ventricular, cambian las condiciones en que se produce el trabajo miocárdico, con la consecuente mejoría de la enfermedad y de la tasa de supervivencia. Sin embargo, este enfoque terapéutico, conocido como la "aproximación Jurásica", no logra recuperar el tejido lesionado durante el proceso, lo que permite la progresión de la enfermedad hasta llegar a la falla cardíaca terminal y la muerte. Estudios experimentales y clínicos han demostrado que la implantación de células progenitoras derivadas de la médula ósea producen angiogénesis y recuperación de la función cardíaca en pacientes con cardiopatía isquémica aguda y crónica. Con esta terapia se ha demostrado mejoría significativa de la sintomatología, de la capacidad funcional, del estado funcional, del tamaño del defecto de perfusión miocárdica medido por pruebas de medicina nuclear y de la fracción de eyección al igual que disminución del volumen sistólico final del ventrículo izquierdo, sin complicaciones relacionadas con el procedimiento. En conclusión, el trasplante de células progenitoras derivadas de la médula ósea es

  15. Resultados de una encuesta sobre donación y trasplante de órganos en la zona metropolitana de Guadalajara, México Survey results regarding organ donation and transplant in metropolitan Guadalajara, Mexico

    Directory of Open Access Journals (Sweden)

    Luz Consuelo Zepeda-Romero

    2003-01-01

    Full Text Available OBJETIVO: Evaluar el conocimiento y la disposición de la donación de órganos y tejidos con fines de trasplante entre la población adulta del área metropolitana de Guadalajara, Jalisco, México. MATERIAL Y MÉTODOS: Se realizó una encuesta aplicando un cuestionario de 29 reactivos a personas mayores de 18 años de edad, mediante entrevista directa en la vía pública. La zona metropolitana se dividió en cuatro municipios, asignándose a cada uno de éstos el número de encuestas en proporción al número de habitantes, estrato socioeconómico, edad y género. Se calcularon frecuencias y ji2 para diferencias de proporciones. RESULTADOS: Se encuestaron 400 individuos. El 80.4% conocía acerca de la donación de órganos y 65% sabía que está permitido por la ley; sin embargo, solamente 24% había comentado el tema en familia. El 71% de los encuestados desconocía cómo donar sus órganos y sólo 25% sabía de la existencia de la tarjeta de donación. Por otra parte, 66% estarían dispuestos a donarlos, 16.5% no lo harían y 17% estaban indecisos. La mutilación corporal fue la razón principal (40% para no donar. El 89% estarían dispuestos a autorizar la extracción de órganos de un familiar, siempre que éste hubiera manifestado su deseo en vida; de lo contrario, sólo 29% procederían con la autorización. Finalmente, 65% consideró la licencia de conducir como un medio adecuado de expresar el deseo de donar y 50% considera insuficiente la información que sobre el tema se ha difundido por los medios de comunicación. CONCLUSIONES: La mayoría de la población de la zona metropolitana de la ciudad de Guadalajara tiene conocimiento sobre la donación de órganos y estaría dispuesta a donarlos. Sin embargo, un alto porcentaje desconoce el cómo hacerlo y considera insuficiente la información difundida sobre el tema. Una campaña permanente a través de los medios de comunicación masiva podría solucionar lo anterior e incrementaría la

  16. Alterações fisiológicas da morte encefálica em potenciais doadores de órgãos e tecidos para transplantes Los cambios fisiológicos de la muerte cerebral en potenciales donadores de órganos y tejidos para trasplante Physiological changes of brain death in potential donors of organs and tissues for transplantation

    Directory of Open Access Journals (Sweden)

    Sarah Gabriel Freire

    2012-12-01

    Full Text Available Objetivou-se descrever as alterações fisiológicas da morte encefálica em potenciais doadores de órgãos e tecidos para transplantes. Estudo exploratório descritivo com dados prospectivos e abordagem quantitativa realizado nas unidades de emergência e terapia intensiva adulto de um hospital de Pernambuco no período de abril a outubro de 2011. A população constou de 32 potenciais doadores de órgãos e tecidos para transplantes. Após aprovação do Comitê de Ética em Pesquisa, os dados foram coletados, tabulados e analisados pela estatística descritiva pelo software SPSS 15.0 e apresentados em forma de tabelas. As alterações fisiológicas foram: hipotensão arterial (100%, hipotermia (75,0%, hipernatremia (62,5%, diabetes insipidus (37,5%, hiperglicemia (32,3%, infecção (25,0%, hipertensão arterial (9,4% e úlcera de córnea (3,1%. Acredita-se que o conhecimento dessas alterações possibilita à equipe de saúde direcionar o cuidado ao potencial doador segundo as suas necessidades e, assim, manter o órgão/tecido viável para transplante.El objetivo del estudio fue describir los cambios fisiológicos de la muerte cerebral en los potenciales donadores de órganos y tejidos para trasplante. Investigación exploratoria, descriptiva, con datos prospectivos y enfoque cuantitativo, hecho en las unidades de emergencia y de cuidados intensivos de adultos de un hospital de Pernambuco en el periodo de abril a octubre de 2011. La población fue formada por 32 potenciales donadores de órganos y tejidos para trasplante. Después de la aprobación en el Comité Ético de Investigación, los datos han sido recogidos, tabulados y analizados mediante estadística descriptiva por el programa informático SPSS 15.0, siendo presentados en forma de tablas. Los cambios fisiológicos fueron: hipotensión (100%, hipotermia (75,0%, hipernatremia (62,5%, diabetes insípida (37,5%, infección (25,0%, hipertensión arterial (9,4% y la úlcera de c

  17. Pérdida de glutatión desde pulmones de conejo en solución de preservación para trasplante: Efectos clínicos y funcionales a corto plazo Loss of glutathione from rabbit lungs in transplant preservation solution

    Directory of Open Access Journals (Sweden)

    MARíA E SOLOVERA R

    2009-01-01

    Full Text Available El daño por isquemia-reperfusión es causa de morbimortalidad en pacientes con trasplante pulmonar. Se desconoce si la solución de preservación habitual del pulmón puede contribuir a la deficiencia de antioxidantes, favoreciendo el estrés oxidativo en el receptor. Objetivo: Evaluar si existe pérdida de glutatión desde pulmones de conejo a la solución de preservación para trasplante. Resultados: Encontramos una disminución en el contenido de glutatión total del pulmón, sin aumento en el contenido de glutatión oxidado. Esto se asoció a la aparición y aumento sostenido de glutatión en la solución de preservación desde los 30 min. Conclusiones: Existe salida de glutatión desde el pulmón no mediada por oxidación de éste y posiblemente favorecida por el gradiente de concentración de glutatión reducido. Esta pérdida deja al tejido vulnerable frente a las condiciones de estrés oxidativo en el receptor.Introduction: Ischemia-reperfusion injury causes morbidity and mortality in lung transplant patients. It is unknown if the usual lung preservation solution favors antioxidant deficiency and thus, increased oxidative stress in the receptor. Objective: To evaluate if there is any loss of glutathione from rabbit lungs to the preservation solution. Results: We found a decrease in lung total glutathione content, without an increase in the oxidized form of this antioxidant. At the same time, we were able to measure increasing levels of glutathione in the preservation solution from 30 min on. Conclusions: There is loss of glutathione from the lung to the preservation solution that is not mediated by glutathione oxidation and likely due to passage of the reduced form along the concentration gradient, rendering the tissue vulnerable to oxidative stress once in the receptor.

  18. Commitments by hostage posting

    NARCIS (Netherlands)

    Raub, W.; Baurmann, M.; Lahno, B.

    2009-01-01

    We survey research on incurring commitments by voluntary hostage posting as a mechanism of cooperation. The Trust Game is employed as a paradigmatic example of cooperation problems. We sketch a very simple game-theoretic model that shows how voluntary hostage posting can bind the trustee and thus in

  19. Fence Posts and Rails

    Science.gov (United States)

    Turton, Roger

    2016-01-01

    "Mathematical Lens" uses photographs as a springboard for mathematical inquiry and appears in every issue of "Mathematics Teacher." Recently while dismantling an old wooden post-and-rail fence, Roger Turton noticed something very interesting when he piled up the posts and rails together in the shape of a prism. The total number…

  20. Positions of the cytoplasmic end of BK α S0 helix relative to S1-S6 and of β1 TM1 and TM2 relative to S0-S6.

    Science.gov (United States)

    Liu, Guoxia; Zakharov, Sergey I; Yao, Yongneng; Marx, Steven O; Karlin, Arthur

    2015-03-01

    The large-conductance, voltage- and Ca(2+)-gated K(+) (BK) channel consists of four α subunits, which form a voltage- and Ca(2+)-gated channel, and up to four modulatory β subunits. The β1 subunit is expressed in smooth muscle, where it slows BK channel kinetics and shifts the conductance-voltage (G-V) curve to the left at [Ca(2+)] > 2 µM. In addition to the six transmembrane (TM) helices, S1-S6, conserved in all voltage-dependent K(+) channels, BK α has a unique seventh TM helix, S0, which may contribute to the unusual rightward shift in the G-V curve of BK α in the absence of β1 and to a leftward shift in its presence. Such a role is supported by the close proximity of S0 to S3 and S4 in the voltage-sensing domain. Furthermore, on the extracellular side of the membrane, one of the two TM helices of β1, TM2, is adjacent to S0. We have now analyzed induced disulfide bond formation between substituted Cys residues on the cytoplasmic side of the membrane. There, in contrast, S0 is closest to the S2-S3 loop, from which position it is displaced on the addition of β1. The cytoplasmic ends of β1 TM1 and TM2 are adjacent and are located between the S2-S3 loop of one α subunit and S1 of a neighboring α subunit and are not adjacent to S0; i.e., S0 and TM2 have different trajectories through the membrane. In the absence of β1, 70% of disulfide bonding of W43C (S0) and L175C (S2-S3) has no effect on V50 for activation, implying that the cytoplasmic end of S0 and the S2-S3 loop move in concert, if at all, during activation. Otherwise, linking them together in one state would obstruct the transition to the other state, which would certainly change V50.

  1. Transplante cardíaco (TC: a experiência do portador da doença de Chagas Trasplante cardíaco (TC: la experiencia del portador de la enfermedad de Chagas Heart transplantation: the experience of patients with Chagas disease

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Araújo Sadala

    2009-09-01

    Full Text Available O sucesso do transplante cardíaco com portadores da doença de Chagas está condicionado a cuidados especiais durante todas as fases do transplante, com necessidade de acompanhamento específico e rigoroso pela equipe de saúde. Os receptores devem estar conscientes da permanência do Trypanossoma no organismo, e das possibilidades de reativação da infecção após o transplante. Portanto, seu conhecimento dessa condição, e a sua participação ativa no próprio tratamento, têm importância fundamental. O objetivo do estudo foi investigar a experiência do transplante cardíaco vivenciada por pacientes portadores da doença de Chagas, para buscar compreender os significados que eles atribuem a esta experiência. Os procedimentos metodológicos abrangeram: a seleção dos pacientes; as entrevistas; a análise dos dados, indicando as unidades de significado e a análise individual; a busca de convergências dos discursos; e análise hermenêutica das convergências. Da análise dos dados emergiram os seguintes temas: o tempo vivido pelo receptor, portador da Doença de Chagas; a concepção do TC apresentado pelo portador de Chagas; o cuidado na trajetória do TC.El éxito del trasplante cardíaco con portadores de la enfermedad de Chagas está condicionado a cuidados especiales durante todas las fases del trasplante, con necesidad de acompañamiento específico y riguroso por el equipo de salud. Los receptores deben estar conscientes de la permanencia del Tripanosoma en el organismo y de las posibilidades de reactivación de la infección después del trasplante. Por lo tanto, su conocimiento sobre esa condición y su participación activa en el propio tratamiento es de fundamental importancia. El objetivo del estudio fue investigar la experiencia del trasplante cardíaco experimentada por pacientes portadores de la enfermedad de Chagas, para comprender los significados que ellos atribuyen a esta experiencia. Los procedimientos metodol

  2. Transplante cardíaco: complicações apresentadas por pacientes durante a internação Trasplante de corazón: complicaciones que presentan los pacientes durante la hospitalización Heart Transplantation: complications presented by patients during the hospitalization

    Directory of Open Access Journals (Sweden)

    Elaine Araújo da Silva

    2012-12-01

    Full Text Available Com o avanço da ciência, a insuficiência cardíaca tem como possibilidade de intervenção o transplante cardíaco. Este trabalho teve como objetivos traçar o perfil demográfico dos pacientes submetidos ao transplante cardíaco e identificar as complicações apresentadas durante a internação. Trata-se de um estudo descritivo, quantitativo, realizado com 44 prontuários de pacientes submetidos a transplante de junho/2006 a julho/2009 em um Hospital Universitário de Belo Horizonte, Minas Gerais, Brasil. O projeto atendeu às recomendações da Resolução 196/96. Pelos resultados, a maioria dos pacientes era do sexo masculino, casada, escolaridade de nível fundamental e idade média de 45,2 anos. A miocardiopatia chagásica foi a principal causa de insuficiência cardíaca. As complicações predominantes foram alteração da glicemia, insuficiência renal e infecções. A taxa de mortalidade na internação foi de 20,4%. Além das complicações biológicas só foram registradas ansiedade e depressão. São necessárias pesquisas sobre o tema nos âmbitos psicossociais e espirituais, contribuindo para o desenvolvimento científico.Hoy día, con los avances de la medicina y de la tecnología para el tratamiento de la insuficiencia cardiaca irreversible, se ha utilizado como última intervención el trasplante cardíaco. Este trabajo se desarrolló con los objetivos de delinear el perfil demográfico de los pacientes sometidos a trasplante cardíaco e identificar las complicaciones presentadas por ellos después del trasplante de corazón. Estudio descriptivo y cuantitativo, realizado en conjunto con los registros de 44 pacientes sometidos a trasplante de corazón desde Jun/2006 hasta Jul/2009, en un Hospital Universitario de Belo Horizonte, Minas Gerais, Brasil. El proyecto cumplió con las recomendaciones de la Resolución 196/96. Los resultados mostraron que la mayoría de los pacientes eran del sexo masculino, casados, con educaci

  3. Post-Approval Studies

    Data.gov (United States)

    U.S. Department of Health & Human Services — The CDRH Post-Approval Studies Program encompasses design, tracking, oversight, and review responsibilities for studies mandated as a condition of approval of a...

  4. Computer Security: posting and mis-posting

    CERN Multimedia

    Stefan Lueders, Computer Security Team

    2015-01-01

    This is what can happen at CERN if you don't lock your computer screen...   “Hi, I am looking for a partner either male or female to attend salsa lessons. I have a great body and enjoy rubbing it against other people on the dance floor. I would consider dinner after with the right person. If you think you can keep up with me and enjoy getting sweaty send me a reply. Stay sexy…” This is the original text of a recent posting on the CERN Market webpage. Some people might find this appealing, some people think this is funny. Personally, I couldn’t care less. But professionally, we had to follow up as this text can be perceived as inappropriate and, thus, in violation of the Terms of Usage of the CERN Market as well as the CERN Computing Rules and its annex on private usage of the CERN computing facilities. We remind you that the CERN Market is a public website that can be used by people within but also outside CERN. All posts are visible world...

  5. Esthetic Intracanal Posts

    Science.gov (United States)

    Parčina, Ivana; Amižić

    2016-01-01

    The primary function of an endodontic post is to provide retention for the core and enable full sealing of the coronal portion of the root canal. Traditionally used metal posts do not meet the requirements of modern dental medicine due to some fairly significant drawbacks such as color, corrosion potential, non-adhesive bonding and high modulus of elasticity which can lead to root fracture. Recently, esthetic ceramic and fiber reinforced posts have been manufactured in order to avoid such imperfections. Since much attention has been devoted to the esthetic aspects of dental medicine, the use of these posts with composite/ceramic cores is very common in restorative dentistry and it is actually becoming a standard. This is due to the fact that, apart from being an esthetically pleasing material, they are also biocompatible, have good physical properties and the capacity of adhesive bonding to tooth tissue and core buildup. Nonetheless, a good clinician should know how to spot the difference between them in order to select and use the appropriate post system in each specific situation. PMID:27789912

  6. Optimization of culture conditions for producing 2-keto-D-gluconic acid by an isolated strain of Serratia sp. BK-98%产2-酮基-D-葡萄糖酸菌Serratiasp.BK-98的分离及其培养条件优化

    Institute of Scientific and Technical Information of China (English)

    张炜; 谢志鹏; 张建国

    2011-01-01

    A strain capable of producing 2-keto-D-gluconic acid (2-KDG) was isolated from soil. The phylogenetic analysis based on 16S rDNA suggested the isolate was assigned to genus Serratia and named Serratia sp. BK-98. Medium loading volume,fermentation time and initial pH were found to be most significant factors affecting 2-KDG production using Plackett-Burman (PB) design and their values were optimized to be 6.6mL in a 100mL Erlenmeyer flask of medium loading volume,57.9h of fermentation time and 5.0 of initial pH respectively with response surface methodology (RSM) based on central composite design (CCD). Under the optimized fermentation conditions,2-KDG production in a 100mL Erlenmeyer flask and in a 100L fermenter reached 187.8g/L and 192.2g/L respectively,142.6% and 148.3% increase respectively as compared with the pre-optimized conditions. A close agreement with the predicted value of 191.4g/L indicated that the proposed relationship model between the impact factors and 2-KDG production was very practical.%从土壤中分离得到一株2-酮基-D-葡萄糖酸(2-KDG)产生菌,综合16SrDNA序列和系统进化分析确定该菌属于沙雷氏菌属(Serratia),命名为Serratiasp.BK-98。采用PIackett—Burman(PB)实验设计,从影响2-酮基-D-葡萄糖酸生物合成条件的14个因素中筛选出具有显著效应的3个因子:装液量、发酵时间和初始pH。在此基础上通过中心组合设计实验(central composite design,CCD)和响应面分析(response surface methodology,RSM)确定了装液量、发酵时间和初始DH的最适值分别为6.6mL、57.9h和5.0。在优化条件下.2-KDG的100mL摇瓶发酵产量达到了187.8g/L,100L发酵罐产量达到了192.2g/L.分别较优化前提高了142.6%和148.3%.这两个实验结果均与模型的预测值191.4g/L非常接近。

  7. Post-Session Authentication

    DEFF Research Database (Denmark)

    Ahmed, Naveed; Jensen, Christian D.

    2012-01-01

    Entity authentication provides confidence in the claimed identity of a peer entity, but the manner in which this goal is achieved results in different types of authentication. An important factor in this regard is the order between authentication and the execution of the associated session....... In this paper, we consider the case of post-session authentication, where parties authenticate each other at the end of their interactive session. This use of authentication is different from session-less authentication (e.g., in RFID) and pre-session authentication (e.g., for access control.) Post......-session authentication, although a new term, is not a new concept; it is the basis of at least a few practical schemes. We, for the first time, systematically study it and present the underlying authentication model. Further, we show that an important class of problems is solvable using post-session authentication...

  8. 沙雷氏菌Serratia sp.BK-98发酵生产2-酮基-D-葡萄糖酸的工艺优化及动力学研究%Fermentation process optimization and kinetics studies of 2-keto-D-gluconic acid production by Serratia sp. BK-98

    Institute of Scientific and Technical Information of China (English)

    张炜; 谢志鹏; 罗玮; 张建国

    2011-01-01

    @@ 引言 2-酮基-D-葡萄糖酸(2-KDG)有着广泛的用途,它能被用作食品添加剂、水泥增塑剂、洗涤剂,是照片显影剂的重要成分[1];同时它也是除草剂[2]、D-核酮糖、D-阿拉伯糖,特别是D-异抗坏血酸合成过程中的重要前体.%Based on the optimization of culture conditions for producing 2-keto-D-gluconic acid (2-KDG)by Serratia sp. BK-98 in a Erlenmeyer flask, the factors of dissolved oxygen (DO) and pH affecting 2KDG batch fermentation in 100 L fermenter were further optimized to be 30 % and 6. 0 respectively. Under the DO-stat and pH-stat batch culture conditions, 2-KDG production reached 211.2 g · L-1. The kinetics of DO-stat and pH-stat batch fermentation were also investigated and the models for biomass, substrate consumption and product were established respectively based on the Logistic equation, Leudeking-Piret equation and Modified Leudeking-Piret equation. Curve fittings for the above models by using experimental data were performed by the non-linear least squares method with the software Origin 8.0. With the evaluated model parameters, the calculated values of the models and experimental data were in good agreement and the models could provide guidance for 2-KDG fermentation production.

  9. Multifractal Measure of Post Distribution in Post System

    Institute of Scientific and Technical Information of China (English)

    CHEN Li; HUANG Deng-shi

    2009-01-01

    In order to investigate the true post distribution in the whole society, microelasticity (MIE) and macroelasticity (MAE) were defined by regarding all posts as a system. On this basis, the method for measuring post distribution was proposed. Using the Legendre dual transformation between MIE and MAE to highlight the probabilities of different levels, the post distribution were analyzed hierarchically. The two-scale Cantor model verified that the multifractal measure is applicable to the post distribution evolution process.

  10. Post-partum pancreatitis.

    Directory of Open Access Journals (Sweden)

    Pai P

    1993-04-01

    Full Text Available Acute pancreatitis in pregnancy and post-partum period, rarely encountered in surgical practice, can have a lethal effect on the mother and the foetus. We report here a case of a 35 year old tertigravida who presented with high grade fever, abdominal pain with distension, tachycardia and tachypnoea. Chest examination and X-rays were suggestive of pneumonia. The abdomen was tense and tender. Peristalsis was absent. Ultrasound revealed presence of fluid in the abdominal cavity which on paracentesis was found to contain Gram positive cocci. Fluid amylase levels were high. On exploratory laparotomy, haemorrhagic oedematous pancreatitis was noticed. The patient expired on the 2nd post operative day.

  11. Post-duralpunktur hovedpine

    DEFF Research Database (Denmark)

    Dahl, J B; Rosenberg, J

    1990-01-01

    Post dural puncture headache is one of the major complications of spinal anaesthesia. In order to establish this diagnosis, the headache must be dependent on the position of the patient. The symptoms are probably due to leakage of cerebro-spinal fluid from the subarachnoid space to the epidural...... of the puncture needle and, for this reason, the finest possible needle should be employed. The only well proved prophylactic and curative treatment consists of establishing an epidural blood-patch. This procedure should be considered as the primary method of treatment in patients in whom post dural puncture...

  12. Cloning, expression in Pichia pastoris, and characterization of a thermostable GH5 mannan endo-1,4-β-mannosidase from Aspergillus niger BK01

    Directory of Open Access Journals (Sweden)

    Sigoillot Jean-Claude

    2009-11-01

    Full Text Available Abstract Background Mannans are key components of lignocellulose present in the hemicellulosic fraction of plant primary cell walls. Mannan endo-1,4-β-mannosidases (1,4-β-D-mannanases catalyze the random hydrolysis of β-1,4-mannosidic linkages in the main chain of β-mannans. Biodegradation of β-mannans by the action of thermostable mannan endo-1,4-β-mannosidase offers significant technical advantages in biotechnological industrial applications, i.e. delignification of kraft pulps or the pretreatment of lignocellulosic biomass rich in mannan for the production of second generation biofuels, as well as for applications in oil and gas well stimulation, extraction of vegetable oils and coffee beans, and the production of value-added products such as prebiotic manno-oligosaccharides (MOS. Results A gene encoding mannan endo-1,4-β-mannosidase or 1,4-β-D-mannan mannanohydrolase (E.C. 3.2.1.78, commonly termed β-mannanase, from Aspergillus niger BK01, which belongs to glycosyl hydrolase family 5 (GH5, was cloned and successfully expressed heterologously (up to 243 μg of active recombinant protein per mL in Pichia pastoris. The enzyme was secreted by P. pastoris and could be collected from the culture supernatant. The purified enzyme appeared glycosylated as a single band on SDS-PAGE with a molecular mass of approximately 53 kDa. The recombinant β-mannanase is highly thermostable with a half-life time of approximately 56 h at 70°C and pH 4.0. The optimal temperature (10-min assay and pH value for activity are 80°C and pH 4.5, respectively. The enzyme is not only active towards structurally different mannans but also exhibits low activity towards birchwood xylan. Apparent Km values of the enzyme for konjac glucomannan (low viscosity, locust bean gum galactomannan, carob galactomannan (low viscosity, and 1,4-β-D-mannan (from carob are 0.6 mg mL-1, 2.0 mg mL-1, 2.2 mg mL-1 and 1.5 mg mL-1, respectively, while the kcat values for these

  13. Post-death cloning of endangered Jeju black cattle (Korean native cattle): fertility and serum chemistry in a cloned bull and cow and their offspring.

    Science.gov (United States)

    Kim, Eun Young; Song, Dong Hwan; Park, Min Jee; Park, Hyo Young; Lee, Seung Eun; Choi, Hyun Yong; Moon, Jeremiah Jiman; Kim, Young Hoon; Mun, Seong Ho; Oh, Chang Eon; Ko, Moon Suck; Lee, Dong Sun; Riu, Key Zung; Park, Se Pill

    2013-12-17

    To preserve Jeju black cattle (JBC; endangered native Korean cattle), a pair of cattle, namely a post-death cloned JBC bull and cow, were produced by somatic cell nuclear transfer (SCNT) in a previous study. In the present study, we examined the in vitro fertilization and reproductive potentials of these post-death cloned animals. Sperm motility, in vitro fertilization and developmental capacity were examined in a post-death cloned bull (Heuk Oll Dolee) and an extinct nuclear donor bull (BK94-13). We assessed reproductive ability in another post-death cloned cow (Heuk Woo Sunee) using cloned sperm for artificial insemination (AI). There were no differences in sperm motility or developmental potential of in vitro fertilized embryos between the post-death cloned bull and its extinct nuclear donor bull; however, the embryo development ratio was slightly higher in the cloned sperm group than in the nuclear donor sperm group. After one attempt at AI, the post-death cloned JBC cow became pregnant, and gestation proceeded normally until day 287. From this post-death cloned sire and dam, a JBC male calf (Heuk Woo Dolee) was delivered naturally (weight, 25 kg). The genetic paternity/maternity of the cloned JBC bull and cow with regard to their offspring was confirmed using International Society for Animal Genetics standard microsatellite markers. Presently, Heuk Woo Dolee is 5 months of age and growing normally. In addition, there were no significant differences in blood chemistry among the post-death cloned JBC bull, the cow, their offspring and cattle bred by AI. This is the first report showing that a pair of cattle, namely, a post-death cloned JBC bull and cow, had normal fertility. Therefore, SCNT can be used effectively to increase the population of endangered JBC. PMID:23955237

  14. Post-irradiation diarrhea

    International Nuclear Information System (INIS)

    In radiotherapy of pelvic cancers, the X-ray dose to be delivered to the tumour is limited by the tolerance of healthy surrounding tissue. In recent years, a number of serious complications of irradiation of pelvic organs were encountered. Modern radiotherapy necessitates the acceptance of a calculated risk of complications in order to achieve a better cure rate. To calculate these risks, one has to know the radiation dose-effect relationship of normal tissues. Of the normal tissues most at risk when treating pelvic tumours only the bowel is studied. In the literature regarding post-irradiation bowel complications, severe and mild complications are often mixed. In the present investigation the author concentrated on the group of patients with relatively mild symptoms. He studied the incidence and course of post-irradiation diarrhea in 196 patients treated for carcinoma of the uterine cervix or endometrium. The aims of the present study were: 1) to determine the incidence, course and prognostic significance of post-irradiation diarrhea; 2) to assess the influence of radiotherapy factors; 3) to study the relation of bile acid metabolism to post-irradiation diarrhea; 4) to investigate whether local factors (reservoir function) were primarily responsible. (Auth.)

  15. Pornografinio turinio produkcijos gaminimas, platinimas ir viešas demonstravimas. Atsakomybė už tai LR BK ir kitų valstybių įstatymuose

    OpenAIRE

    Supranavičiūtė, Joana

    2011-01-01

    Lietuvos Respublikos Baudžiamojo kodekso 309 straipsnis “Disponavimas pornografinio turinio dalykais“ nustato baudžiamąją atsakomybę už pornografijos gaminimą, platinimą, reklamavimą ir viešą demonstravimą. Straipsnis skiria pornografiją į pilnamečių asmenų ir vaikų pornografiją. Nors ši veika yra kriminalizuota, praktikoje LR BK 309 straipsnis taikomas retai dėl keblumų, kylančių internetinėje erdvėje – fiziniai ir juridiniai asmenys gali lengvai išvengti baudžiamosios atsakomybės. Atsižv...

  16. Post-human Viewing

    DEFF Research Database (Denmark)

    Blaagaard, Bolette

    2013-01-01

    to become part of a global cultural flow, thus calling into question the physical connection between viewer and image. This article analyses what happens to that connection when not only the image but also the physical body is mediated and challenged in post-human relations, and examines the ensuing ethical...... implications. The author takes photojournalism and, in particular, mobile phone footage as a starting point for an exploration of the (post-human) body as evidence and sign of authenticity in the modern age of digital communications and journalism.......This article discusses the relationship between theories of photography and mobile phone footage. In doing so, it asks if theories of photography still apply in a technologically saturated world of imagery. Technology is an increasingly important part of viewing imagery today and enables imagery...

  17. Communication from La Poste

    CERN Multimedia

    2005-01-01

    We should like to remind users that post sent to the CERN site must be correctly addressed in order to reach the right destination as quickly as possible: Correspondence (goods subject to Swiss VAT): Surname, first name CERN (Department, Building & Mailbox) Route de Meyrin 385 Case Postale 1211 Genève 23 CERN (Switzerland) Official orders (goods not subject to Swiss VAT): CERN Goods Reception Order number ( Ca, Ct, Cl....) For the attention of: (surname, first name) Route de Meyrin 385 Case Postale 1211 Genève 23 CERN (Switzerland) Please inform your suppliers of the above addresses. Last minute Swiss motorway sticker on sale at the POST OFFICE, Main Building (63 R 02) 40.- CHF

  18. [Post-traumatic stress].

    Science.gov (United States)

    Ogłodek, Ewa; Araszkiewicz, Aleksander

    2012-01-01

    As civilization advanced, the number of disasters, including their types and size of the threat to humanity. In addition to natural disasters and wars, there are currently a disaster communication, environmental and technological. Disasters "new generation" include increasingly frequent bombings and terrorist attacks. These events are an impediment to long-lasting and deep impact on the mental functioning of the victims of the event. This represents a potential risk of a variety of psychopathological symptoms, which go beyond the limits of human suffering. ICD-I0 classification includes individuals sickness arising as a consequence of pathological after surviving the disaster, which include: acute stress disorder (ASD), post-traumatic stress disorder (PTSD), post-traumatic stress disorder linked to depression, symptoms anxiety, addictions, dissociative disorders and personality changes and permanent after the disaster. PMID:22400171

  19. Teaching Post Keynesian Economics

    DEFF Research Database (Denmark)

    Madsen, Poul Thøis

    2013-01-01

    Denne bog har gør gældende, at post keynesiansk økonomi har sit egen metodiske og didaktiske grundlag, og dens realistisk analyse er tiltrængt i den aktuelle økonomiske og finansielle krise. På et tidspunkt hvor det oprindelige indhold i Keynes 'General Theory ikke længere er til stede i de fleste...... disse ekspert bidrag, at Keynes og The General Theory besidder en uundværlig indsigt, der vil give de studerende en bedre forståelse af verdensøkonomien, hvori de lever. De udforsker undervisningen af post keynesiansk økonomi fra en række forskellige perspektiver, der dækker emner som open system...... teoretisering, pluralisme i undervisningen, retorik i Keynes ånd, usikkerhed, forventningerog penge....

  20. Post-partum pancreatitis.

    OpenAIRE

    Pai P; Shah H; Samsi A

    1993-01-01

    Acute pancreatitis in pregnancy and post-partum period, rarely encountered in surgical practice, can have a lethal effect on the mother and the foetus. We report here a case of a 35 year old tertigravida who presented with high grade fever, abdominal pain with distension, tachycardia and tachypnoea. Chest examination and X-rays were suggestive of pneumonia. The abdomen was tense and tender. Peristalsis was absent. Ultrasound revealed presence of fluid in the abdominal cavity which on paracent...

  1. Post-ATC Reviews

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Guatemala City,a most populous and prosperous metropolitan in Central America,was once again an eye-catcher for hosting for the second time,on April 16-19,the Council of Representatives'meeting of International Textile andClothing Bureau(ITCB)at the time when it has been already two years post the Agreement on Textiles and Clothing (ATC).

  2. Retention of Root Canal Posts

    DEFF Research Database (Denmark)

    Sahafi, A; Benetti, Ana Raquel; Flury, S;

    2015-01-01

    The aim of this study was to investigate the effect of the cement film thickness of a zinc phosphate or a resin cement on retention of untreated and pretreated root canal posts. Prefabricated zirconia posts (CosmoPost: 1.4 mm) and two types of luting cements (a zinc phosphate cement [DeTrey Zinc...... received tribochemical silicate coating according to the manufacturer's instructions. Posts were then luted in the prepared root canals (n=30 per group). Following water storage at 37°C for seven days, retention of the posts was determined by the pull-out method. Irrespective of the luting cement......, pretreatment with tribochemical silicate coating significantly increased retention of the posts. Increased cement film thickness resulted in decreased retention of untreated posts and of pretreated posts luted with zinc phosphate cement. Increased cement film thickness had no influence on retention...

  3. Post-Cruise Questionnaire - Legacy

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Post-Cruise Questionnaire is a mandatory post trip legal document that observers fill out after every trip they have completed.

  4. The post-transcriptional operon

    DEFF Research Database (Denmark)

    Tenenbaum, Scott A.; Christiansen, Jan; Nielsen, Henrik

    2011-01-01

    A post-transcriptional operon is a set of monocistronic mRNAs encoding functionally related proteins that are co-regulated by a group of RNA-binding proteins and/or small non-coding RNAs so that protein expression is coordinated at the post-transcriptional level. The post-transcriptional operon m...

  5. Post Newtonian Rigid Body

    OpenAIRE

    Xu, Chongming; Tao, Jin-he; Wu, Xuejun

    2003-01-01

    In this paper, it is the first time to construct a complete post-Newtonian (PN) model of a rigid body by means of a new constraint on the mass current density and mass density. In our PN rigid body model most of relations, such as spin vector proportional to the angular velocity, the definition on the moment of inertia tensor, the key relation between the mass quadrupole moment and the moment of inertia tensor, rigid rotating formulae of mass quadrupole moment and the moment of inertia tensor...

  6. Post-tonsillectomy hemorrhage

    DEFF Research Database (Denmark)

    Heidemann, Christian; Wallén, Mia; Aakesson, Marie;

    2008-01-01

    of PTH when coblation procedures are performed by non-experienced surgeons. We advise that implementation of coblation tonsillectomy is thoroughly planned with sufficient training of surgeons and continuous surveillance of results. If PTH rates comparable to "cold dissections tonsillectomy" cannot...... be reached intervention (learning or closing down of coblation tonsillectomy) has to be done.......Post-tonsillectomy hemorrhage (PTH) is a relatively common and potentially life-threatening complication. The objective of this study was to examine the rate of PTH and identify risk factors. A retrospective cohort study was carried out including all tonsillectomies (430 patients) performed...

  7. Enfermagem em transplante de células tronco hematopoéticas: produção científica de 1997 a 2007 El papel de la enfermería en el trasplante de células tronco hematopoyéticas: producción científica de 1997 a 2007 Nursing and hematopoietic stem cell transplantation: scientific production from 1997 to 2007

    Directory of Open Access Journals (Sweden)

    Nen Nalú Alves das Mercês

    2010-04-01

    Full Text Available OBJETIVO: Identificar as publicações de enfermagem existentes no período de 1997 a 2007 referentes à temática do transplante de medula óssea e suas principais características. MÉTODOS: Estudo bibliométrico das produções científicas indexadas nas bases de dados: BDENF, LILACS, SciElo, CEPEn e Banco de Dissertações e Teses da CAPES, utilizando os descritores: enfermagem e transplante de medula óssea no recorte temporal de 1997 a 2007 RESULTADOS: Foram incluídos 37 trabalhos em âmbito nacional, sendo 17 dissertações, 2 teses e 18 artigos publicados em periódicos brasileiros, que abordam o cuidado de enfermagem, organização e gerenciamento de Serviços de Transplante de Medula Óssea, qualidade de vida, sofrimento psíquico e produção de conhecimento. CONCLUSÕES: A produção científica, mesmo que quantitativamente pequena, está em ascensão. E está baseada em teorias, conceitos e métodos, principalmente de orientação qualitativa.OBJETIVO: Identificar las publicaciones de enfermería existentes en el período de 1997 a 2007 referentes a la temática del trasplante de médula ósea y sus principales características. MÉTODOS: Estudio bibliométrico de las producciones científicas indexadas en las bases de datos: BDENF, LILACS, SciElo, CEPEn y en el banco de disertaciones y tesis de la CAPES, utilizando los descriptores: enfermería y trasplante de medula ósea en el intervalo de 1997 a 2007 RESULTADOS: Fueron incluidos 37 trabajos del ámbito nacional, siendo 17 disertaciones, 2 tesis y 18 artículos, publicados en periódicos brasileños, que abordan el cuidado de enfermería, la organización y administración de los Servicios de Trasplante de Médula Ósea, la calidad de vida, el sufrimiento psíquico, y, la producción de conocimiento. CONCLUSIONES: La producción científica, cuantitativamente pequeña, está aumentando; ella está basada en teorías, conceptos y métodos, principalmente de orientaci

  8. Shared consultant physician posts.

    LENUS (Irish Health Repository)

    Cooke, J

    2012-01-31

    Our aim was to assess the acceptability and cost-efficiency of shared consultancy posts. Two consultant physicians worked alternate fortnights for a period of twelve months. Questionnaires were distributed to general practitioners, nurses, consultants and junior doctors affected by the arrangement. Patients or their next of kin were contacted by telephone. 1\\/17 of consultants described the experience as negative. 14\\/19 junior doctors reported a positive experience. 11 felt that training had been improved while 2 felt that it had been adversely affected. 17\\/17 GPs were satisfied with the arrangement. 1\\/86 nurses surveyed reported a negative experience. 1\\/48 patients were unhappy with the arrangement. An extra 2.2 (p<0.001) patients were seen per clinic. Length of stay was shortened by 2.49 days (p<0.001). A saving of 69,212 was made due to decreased locum requirements. We present data suggesting structured shared consultancy posts can be broadly acceptable and cost efficient in Ireland.

  9. [Post Stroke Dementia].

    Science.gov (United States)

    Ihara, Masafumi

    2016-07-01

    Post-stroke dementia (PSD) is a clinical entity that encompasses all types of dementia following an index stroke. Current evidence suggests that 25-30% of ischemic stroke survivors develop immediate or delayed vascular cognitive impairment or vascular dementia. The type of stroke can be either ischemic, hemorrhagic or hypoperfusive. There are multiple risk factors for PSD including older age, family history, genetic variants, low educational status, vascular comorbidities, prior transient ischemic attack or recurrent stroke and depressive illness. Pre-stroke dementia refers to the occurrence of cognitive impairment before the index stroke, which may be caused by a vascular burden as well as insidious neurodegenerative changes. Neuroimaging determinants of dementia after stroke include silent brain infarcts, white matter changes, lacunar infarcts and medial temporal lobe atrophy. Published clinical trials have not been promising and there is little information on whether PSD can be prevented using pharmacological agents. Control of vascular disease risk and prevention of recurrent strokes are key to reducing the burden of cognitive decline and post-stroke dementia. Modern imaging and analysis techniques will help to elucidate the mechanism of PSD and establish better treatment. PMID:27395459

  10. Post Stamp Perforation Recognition

    OpenAIRE

    Koníček, Vladimír

    2008-01-01

    Rozpoznávání zoubkování poštovních známek je důležitým faktorem při posuzování pravosti poštovní známky. Typ a rozměr zoubkování mají výrazný vliv na cenu poštovní známky. Tato práce se zabývá navrhem detektoru zoubkování poštovních známek. Cílem práce je vytvořit aplikaci, která z fotografie určí zoubkování zobrazené poštovní známky. Aplikace pro práci s obrazy využívá knihovnu OpenCV. Post stamp perforation recognition is important factor in authentication of post stamps. Type and perfor...

  11. Doença coronária obstrutiva em hepatopatas crônicos que aguardam transplante hepático Enfermedad coronaria obstructiva en hepatópatas crónicos que aguardan trasplante hepático Obstructive coronary disease in patients with chronic liver disease awaiting liver transplantation

    Directory of Open Access Journals (Sweden)

    Moacir Fernandes de Godoy

    2011-01-01

    grado importante con consecuente aumento de riesgo o incluso contraindicación para trasplante hepático. OBJETIVOS: Analizar la contribución de los factores de riesgo clásicos para la enfermedad arterial coronaria (EAC en pacientes portadores de IHA con y sin coronariopatía obstructiva. MÉTODOS: Evaluación de los factores de riesgo para EAC en 119 pacientes, en un servicio de referencia para trasplante hepático, con las siguientes características: más de 40 años de edad, portadores de IHA y sometidos a cinecoronariografía. RESULTADOS: Coronariopatía obstructiva fue detectada en 21 (17,6% de los casos. Estos pacientes presentaban realmente niveles bajos de colesterol, siendo de 129,0±53,5mg/dL con mediana de 117,0mg/dL en los hepatópatas con coronarias normales y 135,4±51,7mg/dL con mediana de 122,0mg/dL en los hepatópatas con coronariopatía obstructiva (P=0,8215. En la regresión logística multivariada, la edad, el sexo, el índice de masa corporal, así como las presencias de diabetes, de tabaquismo y de etilismo no tuvieron significancia estadística aislada en la diferenciación entre los grupos. También no hubo asociación con la etiología de la IHA. A su vez, la hipertensión arterial se mostró relevante en la asociación con EAC (P=0,0474. CONCLUSIÓN: Sólo la hipertensión arterial fue factor de riesgo con significancia estadística para el desarrollo de EAC en pacientes con IHA aguardando trasplante hepático. Por ser un factor de riesgo cambiable, este hallazgo orienta hacia una práctica de actitudes terapéuticas en la tentativa de evitarse o retardar el desarrollo de la EAC en estos pacientes.BACKGROUND: Advanced liver failure (ALF usually presents hypocholesterolemia. Nevertheless, some patients with ALF develops major coronary obstructive diseases with consequent increased risk or contraindication to liver transplantation. OBJECTIVE: To analyze the contribution of classical risk factors for coronary artery disease (CAD in patients

  12. Efecto de la edad al trasplante y de la concentración de azúcar in vitro sobre la adaptación y el crecimiento de vitroplantas de papa (Solanum tuberosum L. vars. atlantic y 1625 frito lay en invernadero.

    Directory of Open Access Journals (Sweden)

    Rafael Orozco

    2016-03-01

    Full Text Available La aclimatización y posterior crecimiento y desarrollo in vivo de plantas propagadas in vitro constituye una de las etapas culminantes del proceso de micropropagación de una especie. Esta investigación se desarrolló con el objetivo de determinar el efecto de diferentes edades al trasplante (15, 20 y 25 días de cultivo y el preacondicionamiento in vitro con tres niveles de azúcar comercial (15, 30 y 45 g L-1 sobre el crecimiento y desarrollo en invernadero de vitroplantas de papa (Solanum tuberosum L. vars. Atlantic y 1625 Frito Lay. En el primer caso se usó el medio de cultivo MS (1962 suministrado por laboratorios Gibco, a razón de 17 g L-1 y suplementado con vitaminas y aminoácidos del mismo medio. En el segundo caso se usó el medio Hyponex a razón de 2.25 g L-1 suplementado con las vitaminas y aminoácidos del medio MS. Los resultados indican que es posible trasplantar a suelo plantas de ambas variedades en cualquiera de las tres edades, sin afectar el rendimiento de minitubérculos. Sin embargo, la tasa de fotosíntesis aparente (TFA se vio favorecida al incrementarse la edad. Respecto a la influencia del preacondicionamiento in vitro con diferentes concentraciones de azúcar, las plantas de la variedad Atlantic ganaron altura, peso seco de raíz y peso fresco y seco de minitubérculos con 15 g L-1 de azúcar, mientras que en plantas de la variedad 1625, este efecto se dio en la concentración de 30 g L-1; el número de minitubérculos no fue favorecido con las concentraciones de azúcar empleadas en el medio Hyponex, pero sí en el medio MS (1962. En este último caso, la TFA sufrió una ganancia gradual al aumentar la concentración de azúcar.

  13. Fatores preditivos de diagnósticos de enfermagem em pacientes submetidos ao transplante renal Factores predictores de diagnósticos de enfermería en pacientes sometidos al trasplante de riñón Predisposing factors of nursing diagnoses in patients submitted to kidney transplantation

    Directory of Open Access Journals (Sweden)

    Jaqueline Galdino Albuquerque

    2010-02-01

    Full Text Available O objetivo do estudo foi identificar fatores preditores para diagnósticos de enfermagem de pacientes transplantados renais. Estudo transversal realizado em um hospital universitário com 58 pacientes submetidos ao transplante renal. Os dados foram coletados com um roteiro de entrevista e exame físico. Para análise dos dados foi utilizada a técnica de regressão logística considerando um nível de significância de 5%. Os fatores preditores identificados foram: Estado de Doença para o diagnóstico Fadiga; Procedência e Estado civil para Nutrição desequilibrada: mais do que as necessidades corporais; Tempo de diálise e Mudança relatada ou medida na acuidade sensorial para Percepção sensorial perturbada: auditiva; e Idade e Estado de doença para Percepção sensorial perturbada: visual.El objetivo del estudio fue identificar factores predictores de diagnósticos de enfermería de pacientes trasplantados de riñón. Estudio transversal realizado en un hospital universitario con 58 pacientes sometidos al trasplante de riñón. Los datos fueron recogidos con un guia dee entrevista y examen físico. Para el análisis de los datos fue utilizada la técnica de regresión logística considerando un nivel de significancia del 5%. Los factores predictores identificados fueron: Estado de Enfermedad para el diagnóstico Fatiga; Naturalidad y Estado civil para Desequilibrio nutricional: por exceso; Tiempo de diálisis y Cambio relatado o medido en la acuidad sensorial para Trastorno de la percepción sensorial: auditiva; y Edad y Estado de enfermedad para Trastorno de la percepción sensorial: visual.The purpose of this study was to identify predisposing factors of nursing diagnoses in patients submitted to kidney transplantation. A cross-sectional carried out in an academic hospital with 58 patients submitted to kidney transplantation. The data was collected with an interview script and physical examination. For data analysis was used the

  14. Post retention and post/core shear bond strength of four post systems.

    Science.gov (United States)

    Stockton, L W; Williams, P T; Clarke, C T

    2000-01-01

    As clinicians we continue to search for a post system which will give us maximum retention while maximizing resistance to root fracture. The introduction of several new post systems, with claims of high retentive and resistance to root fracture values, require that independent studies be performed to evaluate these claims. This study tested the tensile and shear dislodgment forces of four post designs that were luted into roots 10 mm apical of the CEJ. The Para Post Plus (P1) is a parallel-sided, passive design; the Para Post XT (P2) is a combination active/passive design; the Flexi-Post (F1) and the Flexi-Flange (F2) are active post designs. All systems tested were stainless steel. This study compared the test results of the four post designs for tensile and shear dislodgment. All mounted samples were loaded in tension until failure occurred. The tensile load was applied parallel to the long axis of the root, while the shear load was applied at 450 to the long axis of the root. The Flexi-Post (F1) was significantly different from the other three in the tensile test, however, the Para Post XT (P2) was significantly different to the other three in the shear test and had a better probability for survival in the Kaplan-Meier survival function test. Based on the results of this study, our recommendation is for the Para Post XT (P2). PMID:11203854

  15. Post-traumatic syringomyelia

    Directory of Open Access Journals (Sweden)

    Agrawal Amit

    2007-01-01

    Full Text Available Progressive post-traumatic cystic syringomyelia is an uncommon and increasingly recognized cause of morbidity following spinal cord injury. We hereby report a 35-year-old gentleman who sustained wedge compression fracture of L-1 vertebral body 15 years back and had complete paraplegia with bowel/bladder involvement. The neurological deficit recovered with minimal residual motor deficits and erectile dysfunction. He presented now with increasing neurological deficits associated with pain and paresthesia. The MRI spine showed a syrinx extending from the site of injury up to the medulla. He underwent a syringo-peritoneal shunt and at follow-up his pain and motor functions had improved but erectile dysfunction was persisting.

  16. Post-traumatic osteomyelitis

    International Nuclear Information System (INIS)

    Only 24 patients with post-traumatic osteomyelitis were found from records covering a period of five years. Twenty-two of them with complete medical histories are reviewed here. The radiographs were usually taken through plaster of Paris, and therefore the radiological diagnosis was established later than the clinical one in half of the cases. There were only four cases with a true delay. The primary radiological signs leading to the osteomyelitis diagnosis appeared on average 4.3 months after the assumed time of infection. It is our feeling that the current widespread use of antibiotics causes the diagnosis to be delayed even more than it was in the days of haematogenous osteomyelitis. Continuous formation of periosteal new bone layers indicated poorer prospects for healing of the osteomyelitis. (orig.)

  17. Post-Positivist Realism

    Institute of Scientific and Technical Information of China (English)

    Barbara; Foley

    2006-01-01

    本文作者对《重申身份》一书中所持的后实证现实主义(post-positivist realism)观点进行了深刻的批评。作者指出,从后实证现实主义立场出发论述身份问题会遭遇到逻辑与政治的难题。它所提供的答案只是症候式,而非实质性的。实际上,后现代主义在身份问题上所处的尴尬也是后实证现实主义所同样面临的。

  18. Post Newtonian Rigid Body

    CERN Document Server

    Xu, C; Wu, X; Wu, Xuejun

    2004-01-01

    In this paper, it is the first time to construct a complete post-Newtonian (PN) model of a rigid body by means of a new constraint on the mass current density and mass density. In our PN rigid body model most of relations, such as spin vector proportional to the angular velocity, the definition on the moment of inertia tensor, the key relation between the mass quadrupole moment and the moment of inertia tensor, rigid rotating formulae of mass quadrupole moment and the moment of inertia tensor, are just the extension of the main relations in Newtonian rigid body model. When all of $1/c^2$ terms are neglected, the PN rigid body model and the corresponding formulae reduce to Newtonian version. The key relation is obtained in this paper for the first time, which might be very useful in the future application to problems in geodynamics and astronomy.

  19. Post-treatment CIN

    DEFF Research Database (Denmark)

    Bais, Aagje G; Eijkemans, Marinus J C; Rebolj, Mateja;

    2009-01-01

    cytology and presence of hrHPV (80 vs. 91%, relative risk 0.87 (95% CI 0.77-0.99)). Both methods showed no significant difference in sensitivity ((86 vs. 100%) RR 0.86 (95% CI 0.63-1.16)). Comparing different post hoc modifications in the strategy of combined testing showed similar test characteristics...... when low-risk women (normal cytology and hrHPV negative at 6 months) omitted the 12 months visit (specificity 91%, p = 1.00 z = 0.00). Prediction of residual/recurrent CIN by typing of hrHPV could not be confirmed. Total health-care costs using cytology and hrHPV testing during follow-up decreased when...

  20. Post-Olympism?

    DEFF Research Database (Denmark)

    Christensen, Mette Krogh

    The Olympic ideal and the Olympic Games stand as symbols of global cooperation, international understanding and the bonding fo individuals through the medium of sports. However, throughout the twentieth century, Olympic rhetoric waas often confronted by a different reality. The Games have regularly...... been faced by crises that have threatened the spirit of Olympism and even the Games themselves. Given the many changes that have occurred in the Olympic Games during the past century it seems reasonable to ask if this global event has a future and, if so, what form it might take. Whit this larger issue...... in mind, the authors of Post-Olympism? ask probing questions about the following: 1) The infamous 1936 Olympics, 2) the effect of new techonologies on the Games, 3) the future impact of the 2008 Beijing Games on China and of China on the Olympics, 4) the local and regional impact of the Sydney 'green...

  1. Post dengue neurological complication.

    Science.gov (United States)

    Hasliza, A H; Tohid, H; Loh, K Y; Santhi, P

    2015-01-01

    Dengue infection is highly endemic in many tropical countries including Malaysia. However, neurological complications arising from dengue infection is not common; Gullain-Barre syndrome (GBS) is one of these infrequent complications. In this paper, we have reported a case in which a 39-year-old woman presented with a neurological complication of dengue infection without typical symptoms and signs of dengue fever. She had a history of acute gastroenteritis (AGE) followed by an upper respiratory tract infection (URTI) weeks prior to her presentation rendering GBS secondary to the post viral URTI and AGE as the most likely diagnosis. Presence of thrombocytopenia was the only clue for dengue in this case. PMID:27099661

  2. Qualitative Analysis of New-type Drug bk-MDMA by ESI-MS/MS%电喷雾串联质谱法定性分析新型毒品亚甲基双氧甲基卡西酮

    Institute of Scientific and Technical Information of China (English)

    周志刚; 严忠雍; 张小军; 杨宝峰

    2015-01-01

    建立一种准确定性奶茶等样品中亚甲基双氧甲基卡西酮(bk-MDMA)的电喷雾串联质谱检测方法.样品通过甲醇提取,提取液高速离心后用滤膜过滤,上机液用蠕动泵进样进行电喷雾串联质谱定性分析.通过母离子扫描和子离子扫描研究了bk-MDMA的质谱裂解途径,通过分析比较选择合适的定性离子.通过对锥孔电压、碰撞电压等质谱条件的优化和基质干扰分析,建立了合适的串联质谱检测条件.电喷雾串联质谱方法与GC-MS方法相比更加快速简便,通过串联质谱的二级质谱定性准确度更高.利用本方法对5个物证实际样品进行了分析,结果显示均含有bk-MDMA.本方法快速、准确、灵敏度高,可广泛用于司法物证鉴定等领域bk-MDMA的定性分析.

  3. Post combustion in converter steelmaking

    Energy Technology Data Exchange (ETDEWEB)

    Oghbasilasie, H.; Holappa, L.

    1997-12-31

    The purpose of this work is to study the fundamentals of post combustion and the effect of different process parameters on the post combustion ratio (PCR) and heat transfer efficiency (HTE) in converter steelmaking process. The PCR and HTE have been determined under normal operating conditions. Trials assessed the effect of lance height, vessel volume, foaming slag and pellet additions on PCR and HTE. Based on enthalpy considerations, post combustion of CO gas is regarded as one of the most effective means of increasing the heat supply to the BOP. The thermodynamic study of gas-metal-slag reactions gives the limiting conditions for post combustion inside the converter reactor. Different process parameters influencing both thermodynamic equilibria and kinetic conditions can greatly affect the post combustion ratio. Different features of converter processes as well smelting reduction processes utilizing post combustion have been reviewed. (orig.) SULA 2 Research Programme; 26 refs.

  4. Post-16 update

    Science.gov (United States)

    1999-07-01

    (post16) Faces of Physics To study a physics course post-16 is take out an option on your future. But physics itself is very varied, and so is what you might do with it. It seems right that post-16 physics courses reflect important aspects of this variety. Physics varies with why people do it. As reliable knowledge, physics is often essential to making things happen. This is physics as feeding into technology, and quite often feeding off technology. The human urge here is the urge to create things that work. It drives individual inventors; it drives large teams in multinational companies. At the opposite end of this spectrum is physics driven by curiosity, by the urge to find out. The stock examples are the grand discoveries from the expansion of the universe to the discovery of the nucleus of atoms. But the physicist's curiosity is often on a more detailed, even finicky scale: how exactly do the molecules of this polymer respond to stress?; just how do ions implanted in this material modify its conductivity? It is clear to me that a decent post-16 physics course must respect and reflect both. This is by no means a matter of `basic laws and their applications'. It is a matter of recognizing two fundamental interests, in doing and in explaining, and of recognizing that they are at once closely interdependent and worlds apart. Ideas in physics are also not of one kind. One opposition is the idea of describing Nature in terms of deterministic physical laws, as against describing Nature as the predictable outcome of probabilistic behaviour `underneath'. The first has gripped the Western imagination since at least the time of Descartes. The second has increasingly come to the fore, especially in thermodynamics with the idea that we can only make processes work by fixing the circumstances so that uncaring atoms and molecules happen by chance to do what we want. Now in quantum theory both ideas - determinism and randomness - co-exist. Post-16 physics courses are not in

  5. Japan Post: Retreat or Advance?

    OpenAIRE

    Gary Clyde Hufbauer; Julia Muir

    2012-01-01

    Legislation to reform Japan Post is again gathering steam in Tokyo. A new postal bill is taking shape, in the form of amendments to the existing Postal Privatization Law dating from the Koizumi era—all put forward under the larger banner of post-earthquake reconstruction finance and the government's efforts to minimize consumption tax hikes. The latest version of "postal reform" legislation envisages "privatization" of Japan Post through the sale of up to two-thirds of government shares, but ...

  6. NEWS: Post-16 update

    Science.gov (United States)

    Campbell, Peter

    2000-07-01

    post16.gif As a teacher of physics it is very easy to become preoccupied with particulars of courses, or topics or even single concepts. Concerned with imminent student audiences and desired learning outcomes, the daily challenge is to summon satisfactory teaching approaches and resources for the job at hand. For the conscientious teacher, assessment outcomes may too often seem a judgment on our own efforts rather than those of our students. From time to time we may step back and think bigger, for example while planning a recruitment event, or while away from work on holiday. We may be successful locally. But why, at a time when books and television documentaries popularizing science have a large following, has physics education been facing declining numbers? Many recognize that physics has an essential contribution to make to the training of science or engineering specialists, but we know that it is also important for the skilled worker, the informed citizen and, in fact, for anyone trying to make sense of the world. So what are the best ways forward for post-16 physics? To make any impact on the bigger picture requires organization, thinking and meeting time among people in diverse roles: teachers and curriculum managers; university lecturers; employers and professional bodies; unitary awarding bodies; regulatory and funding agencies; and even Government. For the past few years, the Institute of Physics post-16 Initiative has created an unrivalled opportunity to address the wider issues. Its Shaping the Future booklets series was designed to stimulate informed discussion and debate, by providing background information and analysis. Taken together, the booklets should help all those concerned with physics education to understand where we are now, and why. Literally dozens of people have contributed to a review and analysis of physics education. Each booklet is a 48-page smorgasbord in A4 landscape format, containing many examples of good practice, basic but

  7. Battery Post-Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Post-test diagnostics of aged batteries can provide additional information regarding the cause of performance degradation, which, previously, could be only inferred...

  8. Post-traumatic stress disorder

    Science.gov (United States)

    ... Post-traumatic stress disorder References American Psychiatric Association. Diagnostic and statistical manual of mental disorders . 5th ed. Arlington, VA: American Psychiatric Publishing. 2013. ...

  9. IVGEN Post Flight Analysis

    Science.gov (United States)

    Mcquillen, John; Brown, Dan; Hussey, Sam; Zoldak, John

    2014-01-01

    The Intravenous Fluid Generation (IVGEN) Experiment was a technology demonstration experiment that purified ISS potable water, mixed it with salt, and transferred it through a sterilizing filter. On-orbit performance was verified as appropriate and two 1.5 l bags of normal saline solution were returned to earth for post-flight testing by a FDA certified laboratory for compliance with United States Pharmacopiea (USP) standards. Salt concentration deviated from required values and an analysis identified probable causes. Current efforts are focused on Total Organic Content (TOC) testing, and shelf life.The Intravenous Fluid Generation (IVGEN) Experiment demonstrated the purification of ISS potable water, the mixing of the purified water with sodium chloride, and sterilization of the solution via membrane filtration. On-orbit performance was monitored where feasible and two 1.5-liter bags of normal saline solution were returned to earth for post-flight testing by a FDA-registered laboratory for compliance with United States Pharmacopeia (USP)standards [1]. Current efforts have been focused on challenge testing with identified [2] impurities (total organic-carbon), and shelf life testing. The challenge testing flowed known concentrations of contaminants through the IVGEN deionizing cartridge and membrane filters to test their effectiveness. One finding was that the filters and DI-resin themselves contribute to the contaminant load during initial startup, suggesting that the first 100 ml of fluid be discarded. Shelf life testing is ongoing and involves periodic testing of stored DI cartridges and membrane filters that are capped and sealed in hermetic packages. The testing is conducted at six month intervals measuring conductivity and endotoxins in the effluent. Currently, the packaging technique has been successfully demonstrated for one year of storage testing. The USP standards specifies that the TOC be conducted at point of generation as opposed to point of

  10. post-industrial

    Directory of Open Access Journals (Sweden)

    Omar Guerrero

    2005-01-01

    Full Text Available Hoy en día la sociedad postindustrial se manifiesta en cinco dimensiones: un sector económico; una distribución ocupacional; la centralidad del conocimiento teórico; una orientación del futuro con base en el control de la tecnología y una hechura de decisiones orientadas por la nueva tecnología intelectual. De ahí nace la motivación del presente trabajo, el cual consiste en analizar la gerencia pública en la sociedad postindustrial, a través del análisis documental. Así, en consonancia con las condiciones presentes, esta sociedad da cobijo a una administración pública que se consolida en las relaciones de dominación, es decir el gobierno de los hombres; junto a una gerencia que asume la gestión de las cosas. Actualmente, en suma, la administración pública mantiene sus rasgos esenciales, sin menoscabo de convivir una época en la cual los cambios producidos por la post- industrialización provoca el advenimiento de la modalidad d la gerencia de servicios.

  11. Recovery post ICU.

    Science.gov (United States)

    Jones, Christina

    2014-10-01

    Many ICU patients struggle to recovery following critical illness and may be left with physical, cognitive and psychological problems, which have a negative impact on their quality of life. Gross muscle mass loss and weakness can take some months to recover after the patients' Intensive Care Unit (ICU) discharge, in addition critical illness polyneuropathies can further complicate physical recovery. Psychological problems such as anxiety, depression and post traumatic stress disorder (PTSD) are common and have an negative impact on the patients' ability to engage in rehabilitation after ICU discharge. Finally cognitive deficit affecting memory can be a significant problem. The first step in helping patients to recover from such a devastating illness is to recognise those who have the greatest need and target interventions. Research now suggests that there are interventions that can accelerate physical recovery and reduce the incidence of psychological problems such as anxiety, depression and PTSD. Cognitive rehabilitation, however, is still in its infancy. This review will look at the research into patients' recovery and what can be done to improve this where needed.

  12. Characterization of highly frequent epitope-specific CD45RA+/CCR7+/- T lymphocyte responses against p53-binding domains of the human polyomavirus BK large tumor antigen in HLA-A*0201+ BKV-seropositive donors

    Directory of Open Access Journals (Sweden)

    Zajac Paul

    2006-11-01

    Full Text Available Abstract Human polyomavirus BK (BKV has been implicated in oncogenic transformation. Its ability to replicate is determined by the binding of its large tumor antigen (LTag to products of tumor-suppressor genes regulating cell cycle, as specifically p53. We investigated CD8+ T immune responses to BKV LTag portions involved in p53 binding in HLA-A*0201+ BKV LTag experienced individuals. Peptides selected from either p53-binding region (LTag351–450 and LTag533–626 by current algorithms and capacity to bind HLA-A*0201 molecule were used to stimulate CD8+ T responses, as assessed by IFN-γ gene expression ex vivo and detected by cytotoxicity assays following in vitro culture. We observed epitope-specific immune responses in all HLA-A*0201+ BKV LTag experienced individuals tested. At least one epitope, LTag579–587; LLLIWFRPV, was naturally processed in non professional antigen presenting cells and induced cytotoxic responses with CTL precursor frequencies in the order of 1/20'000. Antigen specific CD8+ T cells were only detectable in the CD45RA+ subset, in both CCR7+ and CCR7- subpopulations. These data indicate that widespread cellular immune responses against epitopes within BKV LTag-p53 binding regions exist and question their roles in immunosurveillance against tumors possibly associated with BKV infection.

  13. NEWS: Post-16 update

    Science.gov (United States)

    1999-05-01

    (post16) Making physics connect Doesn't Melvyn Bragg do a wonderful job, engaging both scientists and artists in sensitive discussion on Radio 4 about their methods and their purposes? But every week teachers have the chance to show their students that physics is a way of seeing the world that is well-connected with other aspects of knowledge and culture. The stakes are high: students who fail to appreciate this generally choose not to study the subject beyond GCSE. Most students find our preoccupation with technical detail off-putting. Accepting that we have a syllabus to cover, it's still a question of balance. In our teaching we should aim for variety in order to find ways to connect with every student's interests. Also, we can show that we (the nearest embodiment of a physicist some students will experience) are multidimensional and so fully human. Most important, teachers need flexibility to both encourage and respond to student comment and questions. The first booklet in the discussion series Shaping the Future takes up these themes. Rich in ideas for both immediate use and the longer term, it aims to stimulate debate and improve teaching. Copies cost £5.50 including postage and are available from Ingrid Ebeyer, Post-16 Initiative, Institute of Physics, 76 Portland Place, London W1N 3DH. How far is it? This question is asked in many family cars and school minibuses at the start of a journey, and answered by most in terms of hours and minutes rather than miles. What a good idea for introducing a social and historical perspective to a lesson on distance, velocity and time. How far can you actually get in a day? What is the range of human activity? Walking for eight hours will get many people about 25 miles. A pack horse will progress at much the same rate, but fast riding or a coach and team of horses will get further. Motorway driving (when the cones are on holiday) would take you nearly 500 miles. The 05.15 am train from Penzance arrives in Inverness at 7

  14. 75 FR 4039 - Proposed Posting, Posting, and Deposting of Stockyards

    Science.gov (United States)

    2010-01-26

    ... the Federal Register (74 FR 17945-17947) of our proposal to post these 20 stockyards. Since we... location CA-193 Westside Auction Yard, Newman, California. AZ-117 Robertson Horse Sales, Benson,...

  15. Post-16 update

    Science.gov (United States)

    1999-03-01

    Post-16 Initiative logo Physics in Mathematical Mood Later this year, as part of the post-16 initiative of the Institute of Physics, a booklet with the above title will be published. In draft form, the booklet was discussed at the ASE conference in January. Some of the issues raised are briefly set out here. If you have any views to contribute, please write to Simon Carson at the Institute of Physics or e-mail simon.carson@physics.org. A mathematical view of the world is intrinsically a part of physics and therefore physics should be studied in an appropriately mathematical way. However, we all know that, to some students at least, mathematics proves to be a stumbling block rather than a powerful aid to understanding. So how can we help? Realizing that as physics teachers we need to deliver the mathematics necessary to an understanding of our subject is a start. Its corollary is that we need to find the space within the physics core. We may wish to use supplementary courses such as AS mathematics or QCA's new free-standing mathematics units, but requiring additional courses as a prerequisite to a study of A-level physics may deter students. Teaching the mathematics in context may aid understanding but we also must ensure that techniques are seen in a variety of contexts and that at some point the tool is abstracted from the background. As teachers we need to be aware of the very basic mathematical difficulties that students bring with them: the use of calculators, standard form, simple algebraic manipulation, for example. Mathematical arguments need to be developed fully and carefully. Encouraging cooperation and discussion between students may help the less able to understand and the more able to appreciate and develop their own understanding through making explicit their reasoning by explaining it to others. And what of new technology? Software tools allow students to develop their understanding about graphs, for example, enabling them to investigate the

  16. POST-RELIGION: TRADITIONALISTS’ ANALYSIS

    Directory of Open Access Journals (Sweden)

    Kirill M. Tovbin

    2013-12-01

    Full Text Available Aim of the study is to describe the phenomenon of post-religion as a specific spiritual sphere of the Post-modernity. Methodology. In the introduction analyzed a variety of methodological approaches, opening his inadequacy applied to the spiritual sphere of Post-modernity: «classic» religious studies, religious studies of traditional spiritual movements and the post-modern religious studies, partly produced Traditionalist school, could - according to the author's hypothesis - become a methodological basis for the most complete analysis of post-religion. Scientific novelty. In the main part of the article crystallized the authorized concept of post-religion, its relation with traditional and religious spiritual realms. Post-religion is positioned as the top of secularism enshrined in the departure from the straight and aggressive secularism of the Modernity, but without recourse to Tradition. Post-religion a simulation spirituality, skillfully imitating the outer areas of traditional spirituality and creates a planar religiosity, radically preventing attached to the vertical line of Traditions. In this regard, are the main artificially selected parameters of post-religion: deconstruction, splitting, virtualization, and collage. Deconstruction is a transformation of spirituality in semiotic set for egocentric selectivity of modern believer. Post-religion’s splitting is deprivation of spirituality center, destruction of sacral Center and the transformation of spirituality in the plane on which the intellectual and sensual wandering post-believer from one semiotic island to another. Virtualization is a displacement field of spiritual tension in a completely virtual area, isolated from the natural conditions of existence and created as his replacement, network discussion sites and galleries. Collage is an arbitrary combination of different semiotic pieces of Tradition with the aim of creating a believable picture of tradition; it is collage leads

  17. Guidelines for specialized nutritional and metabolic support in the critically-ill patient: Update. Consensus SEMICYUC-SENPE: Liver failure and liver transplantation Recomendaciones para el soporte nutricional y metabólico especializado del paciente crítico: Actualización. Consenso SEMICYUC-SENPE: Insuficiencia hepática y trasplante hepático

    Directory of Open Access Journals (Sweden)

    J. C. Montejo González

    2011-11-01

    tiempo, a la recuperación de los pacientes mediante el control o la reversión de las alteraciones metabólicas apreciadas. En los pacientes críticos que presentan insuficiencia hepática, los conocimientos actuales indican que ésta no parece ser un factor fundamental a la hora de considerar la pauta nutricional. Como en otros pacientes críticos, la vía de aporte de nutrientes debe ser la enteral, siempre que ello sea posible. La composición de la fórmula nutricional debe estar adaptada a la situación de estrés metabólico. A pesar de la base fisiopatológica, clásicamente descrita por algunos autores, que considera al disbalance de aminoácidos un factor desencadenante y mantenedor de la encefalopatía, no hay datos suficientes para recomendar el empleo de soluciones "específicas" (enriquecidas en aminoácidos ramificados y pobres en aminoácidos aromáticos como parte del soporte nutricional en los pacientes con insuficiencia hepática aguda. En los pacientes sometidos a trasplante hepático, el aporte de nutrientes debería iniciarse de manera precoz en el postoperatorio mediante una vía de acceso transpilórica. La prevención de las alteraciones hepáticas asociadas al soporte nutricional debe ser también considerada en diferentes situaciones clínicas.

  18. Medicamentos utilizados em transplante de medula óssea: um estudo sobre combinações dos antimicrobianos potencialmente interativos Medicamentos utilizados en casos de trasplante de médula ósea: un estudio sobre combinaciones antimicrobianas potencialmente interactivas Drugs used in bone marrow transplantation: a study about combinations of antimicrobial potentially interactives

    Directory of Open Access Journals (Sweden)

    Rosimeire Barbosa Fonseca

    2008-12-01

    Full Text Available O objetivo do estudo foi caracterizar o perfil dos medicamentos e identificar combinações decorrentes da co-administração de antimicrobianos potencialmente interativos e outros agentes. 70 prescrições médicas de pacientes submetidos a transplante de medula óssea (TMO, todos internados no Instituto do Coração, São Paulo, Brasil, foram analisadas. Os medicamentos foram classificados de acordo com o sistema Alfa, e o potencial de interação e as características farmacológicas foram listados a partir da literatura. Na analise dos dados utilizou-se estatística descritiva. Verificou-se que 72,7% dos medicamentos apresentaram potencial interativo, destacando-se os precipitadores (79,2% e o fluconazol (85,7% como o antimicrobiano mais envolvido nas combinações, associado ao omeprazol em 40% da amostra. Nos pacientes de TMO, a co-administração de medicamentos potencialmente interativos foi freqüente, condição que, associada à polifarmácia e ao aprazamento simultâneo de horários na administração desses agentes, poderia predispor o paciente a eventos indesejados, afetando, deste modo, a segurança da terapia.El objetivo del estudio fue determinar el perfil de medicamentos e identificar combinaciones por administración conjunta de antimicrobianos potencialmente interactivos y otros agentes. Fueron analizadas 70 prescripciones médicas de pacientes sometidos a trasplante de médula ósea (TMO, todos internados en el Instituto del Corazón, São Paulo, Brasil. Los medicamentos fueron clasificados según el sistema Alfa. El potencial de interacción y las características farmacológicas fueron establecidas según la bibliografía. El análisis de datos a través de estadística descriptiva. El 72,7% de los medicamentos mostró potencial interactivo, destacándose los precipitadores (79,2% y como antimicrobiano más utilizado en las combinaciones el fluconazol (85,7%, siendo asociado al omeprazol en 40% de la muestra. La combinaci

  19. Drug interactions of anti-microbial agents used in hematopoietic stem cell transplantation Interacciones medicamentosas de antimicrobianos utilizados en trasplante de células madre hematopoyéticas Interações medicamentosas de antimicrobianos utilizados em transplante de células-tronco hematopoéticas

    Directory of Open Access Journals (Sweden)

    Rosimeire Barbosa Fonseca Guastaldi

    2011-08-01

    Full Text Available This study analyzed potential drug interactions (PDIs of antimicrobials used in patients of hematopoietic stem cell transplantation and identified associated factors. The sample consisted of 70 patients admitted to a hospital in São Paulo. The PDIs were analyzed through the consultation of the Drug Interactions Facts and Drug Interactions Handbook. Descriptive statistics and logistic regression were used. Half of the sample was exposed to 13 PDIs, which occurred with fluconazole (53.8%, ciprofloxacin (30.8% and sulfamethoxazole-trimethoprim (15.4%. Most (92.3% were of moderate severity, with good evidence (61.6%, early delayed effect (61.5% and need to have their therapy monitored (76.9%. Patients with four or more medications (pEl estudio analizó interacciones medicamentosas potenciales (IMP de antimicrobianos usados en pacientes sometidos a trasplante de células madre hematopoyéticas e identificó los factores asociados las IMP. La casuística fue compuesta por 70 pacientes internados en un Hospital de Sao Paulo. Las IMP fueron a través de la consulta al Drug Interactions Facts y Drug Interactions Handbook. En el análisis de los datos se utilizó estadística descriptiva y regresión logística. Mitad de la muestra fue expuesta a 13 IMP, que ocurrieron con fluconazol (53,8%, ciprofloxacina (30,8% y sulfametoxazol+trimetoprima (15,4%. La mayoría (92,3% presentó gravedad moderada, inicio de efecto demorado (61,5% y necesidad de monitorizar la terapia (76,9%. Cuatro o más medicamentos (pNeste estudo, analisaram-se as interações medicamentosas potenciais (IMP de antimicrobianos, usados em pacientes submetidos a transplante de células-tronco hematopoiéticas e foram identificdos os fatores associados às IMPs. A casuística foi composta por 70 pacientes internados em hospital do município de São Paulo. As IMPs foram analisadas através da consulta ao Drug Interactions Facts e Drug Interactions Handbook. Na análise dos dados, utilizou

  20. Post-Traumatic Stress Disorder

    Science.gov (United States)

    ... PTSD include violent personal assaults, natural or human-caused disasters, accidents, or military combat. For Consumers General Information Post-Traumatic Stress Disorder ( NIMH ) Anxiety Information Stress Information Depression Information St. John's Wort Information See more Research ...

  1. [Post-mortem microbiology analysis].

    Science.gov (United States)

    Fernández-Rodríguez, Amparo; Alberola, Juan; Cohen, Marta Cecilia

    2013-12-01

    Post-mortem microbiology is useful in both clinical and forensic autopsies, and allows a suspected infection to be confirmed. Indeed, it is routinely applied to donor studies in the clinical setting, as well as in sudden and unexpected death in the forensic field. Implementation of specific sampling techniques in autopsy can minimize the possibility of contamination, making interpretation of the results easier. Specific interpretation criteria for post-mortem cultures, the use of molecular diagnosis, and its fusion with molecular biology and histopathology have led to post-mortem microbiology playing a major role in autopsy. Multidisciplinary work involving microbiologists, pathologists, and forensic physicians will help to improve the achievements of post-mortem microbiology, prevent infectious diseases, and contribute to a healthier population.

  2. Calorie Posting in Chain Restaurants

    OpenAIRE

    Bryan Bollinger; Phillip Leslie; Alan Sorensen

    2011-01-01

    We study the impact of mandatory calorie posting on consumers' purchase decisions using detailed data from Starbucks. We find that average calories per transaction fall by 6 percent. The effect is almost entirely related to changes in consumers' food choices—there is almost no change in purchases of beverage calories. There is no impact on Starbucks profit on average, and for the subset of stores located close to their competitor Dunkin Donuts, the effect of calorie posting is actually to inc...

  3. Trasplante homólogo vascularizado de trompa y ovario

    OpenAIRE

    Carmona Herrera, Francisco

    1991-01-01

    [spa] a) INTRODUCCIÓN, HIPÓTESIS DE TRABAJO, OBJETIVOS: La esterilidad afecta a un 15% de las parejas que desean tener descendencia. Distintas estadísticas señalan que las alteraciones de la trompa de Falopio son el factor responsable de dicha esterilidad en el 15-50% de casos. El factor tubárico es de difícil solución: en general. Los resultados de la microcirugía no son lo brillantes que en un principio se esperaba. Por otra parte, a pesar de la simplificación actual de las técnicas de FIV,...

  4. Trasplante hepato-renal. Caso clínico

    OpenAIRE

    Moreno Arroyo, M. Carmen

    2006-01-01

    La hiperoxaliuria primaria tipo I es una enfermedad genética autosómica recesiva, cuyo defecto primario es el déficit, parcial o completo, de la enzima glioxilato aminotransferasa en el hígado que produce la formación de oxalato. El depósito progresivo de oxalato en el riñón es el causante, primero de urolitiasis y nefrocalcinosis, y después de un daño renal progresivo, que lleva a una insuficiencia renal crónica y posteriormente al acúmulo sistémico de oxalato en el sistema músculo-esqueléti...

  5. Post-16 update

    Science.gov (United States)

    1999-09-01

    Institute of Physics post-16 initiative, shaping the future Physics education based in IT - sorry ICT! Which, of course, makes for a nifty headline, but as is so often the case with neat slogans, little else. Two formative questions: What, in another decade, will the government of the day call `What you lot should be doing with computers'? and What, of the many things that currently exercise our intellects, will there be anything special to say about in a decade, concerning the use of computers in the teaching of physics? Advancing Physics represents some attempts to come to grips with the second of the two questions above. The first is left to a higher wisdom. In thinking about learning, what can we do with the huge processing power, increasingly available in smaller and less obtrusive packages? What will we do that helps people learn physics, both tomorrow and in 2009? Here are a few suggestions based on development work so far. Wide, reliable and shared access to well ordered learning resources. We have created a CD-ROM, with versions for both student and teacher, that provides a wide range of resources. These do not teach, but do provide. A commitment to allowing a course to evolve and adapt. Electronic publication puts the costs into origination, and not into publication and distribution. A website allows for the community of users to contribute. E-mail networks support individuals and propagate good practice. You can create and explore your own microworlds. The interactive nature of models, and the crafted relationships between the models and the natural world give an insight into the creative imaginary worlds of the physicist. The unreasonable, but pleasurable, success of mathematics in describing the natural world can come to the fore. Measurements that were not possible before are now possible. What was previously indirect, and inaccessible, now becomes a direct measurement, making relationships transparent in new and fruitful ways. The dichotomy between

  6. Thrombotic obstruction of the central venous catheter in patients undergoing hematopoietic stem cell transplantation Obstrucción trombótica del catéter venoso central en pacientes sometidos al trasplante de células-tronco hematopoyéticas Obstrução trombótica do cateter venoso central em pacientes submetidos ao transplante de células-tronco hematopoéticas

    Directory of Open Access Journals (Sweden)

    Kátia Michelli Bertoldi Arone

    2012-08-01

    Full Text Available This is an integrative literature review with the aim of summarizing the prevention measures and treatment of thrombotic obstruction of long-term semi-implanted central venous catheters, in patients undergoing hematopoietic stem cell transplantation. The sample consisted of seven studies, being two randomized controlled clinical trials, three cohort studies and two case series. Regarding the prevention measures, one single study demonstrated effectiveness, which was a cohort study on the oral use of warfarin. In relation to the treatment measures, three studies evidenced effectiveness, one highlighted the efficacy of streptokinase or urokinase, one demonstrated the benefit of using low-molecular-weight heparin and the other treated the obstruction with heparin or urokinase. Catheter patency research shows a restricted evolution that does not follow the evolution of transplantations, mainly regarding nursing care.Se trata de una revisión integradora de la literatura con objeto de sintetizar las medidas de prevención y tratamiento de obstrucción trombótica del catéter venosos central de larga permanencia y semi-implantado, en pacientes sometidos al trasplante de células-tronco hematopoyéticas. La muestra abarcó a siete estudios: dos ensayos clínicos controlados aleatorizados, tres estudios de cohorte y dos series de casos. Respecto a las medidas de prevención, fue identificado un único estudio efectivo, uno cohorte sobre el uso de la warfarina oral. Sobre las medidas de tratamiento, tres estudios evidenciaron efectividad, uno apuntó la eficacia de la estreptoquinasa o uroquinasa, otro mostró beneficio del uso de heparina de bajo peso molecular y otro trató la obstrucción con heparina o uroquinasa. Se observa que la evolución de la investigación sobre la permeabilidad del catéter fue limitada, no acompañando la evolución del trasplante, principalmente respecto a los cuidados de enfermería.Trata-se de revisão integrativa da

  7. 78 FR 2950 - Proposed Posting and Posting of Stockyards

    Science.gov (United States)

    2013-01-15

    ... owners, meat packers, swine contractors, and live poultry dealers in the livestock, poultry, and... stockyards. Proposed facility No. Stockyard name and location GA-233 Middle Georgia Goat & Chicken Auction... posted the stockyards. On January 26, 2010, we published a notice in the Federal Register (75 FR...

  8. Post-aural Nodular Fasciitis

    Directory of Open Access Journals (Sweden)

    Mohammed Al Rahbi

    2015-01-01

    Full Text Available Nodular fasciitis is a rare benign lesion. Here we report a case of post-auricular nodular fasciitis, which was misdiagnosed by fine-needle aspiration cytology (FNAC as pleomorphic adenoma. An 18-year-old male presented at Al-Nahdha Hospital, physical examination revealed a right post aural firm immobile mass. Radiology suggested the presence of a hypo-dense to iso-dense subcutaneous mass. The swelling was excised and sent for histopathological examination which suggested the diagnosis of nodular fasciitis. FNAC reported pleomorphic adenoma of unusual location should raise the suspicion of nodular fasciitis.

  9. Post tetanic thoracic vertebral change

    International Nuclear Information System (INIS)

    A case report of post tetanic vertebra disclosed multiple thoracic vertebra changes of compressed fracture involving T4, T5, T6 and T7 with partial collapse of T3, T8 and T9. The mechanism of fracture were reviewed. In ordinary compressed fracture produced by acute flexion however post tetanic fracture can be produced by following opisthotonus. Several authors believed to be due to both extensor and flexor muscle groups of violent tetanic convulsion with acute force to the weakest vertebra of T5 or T6 area

  10. Gender Mainstreaming and Sustainable Post Disaster Reconstruction,

    OpenAIRE

    Yumarni, Tri; Amaratunga, Dilanthi; Haigh, Richard

    2013-01-01

    Gender inequalities are barriers to achieve sustainable post disaster reconstruction. Mainstreaming gender equality within post disaster reconstruction process can enhance sustainability of reconstruction. Based on a detailed literature review on post disaster reconstruction, this paper identifies pre-requisite conditions for mainstreaming gender within sustainable post disaster reconstruction as ; awareness of gender needs and concerns, a strong gender policy framework, women ...

  11. Retention and failure morphology of prefabricated posts

    DEFF Research Database (Denmark)

    Sahafi, Alireza; Peutzfeldt, Anne; Asmussen, Erik;

    2004-01-01

    PURPOSE: This study evaluated the effect of cement, post material, surface treatment, and shape (1) on the retention of posts luted in the root canals of extracted human teeth and (2) on the failure morphology. MATERIALS AND METHODS: Posts of titanium alloy (ParaPost XH), glass fiber (Para......Post Fiber White), and zirconia (Cerapost) received one of several surface treatments-sandblasting, CoJet treatment, application of Metalprimer II, or sandblasting followed by silane application-and were then luted in the prepared root canal of human incisors and canines (n = 10). Following water storage...... at 37 degrees C for 7 days, retention was determined by extraction of the posts. Failure morphology of extracted posts was analyzed and quantified stereomicroscopically. RESULTS: Type of luting cement, post material, and shape of post influenced the retention and failure morphology of the posts. Because...

  12. Testing post-editing guidelines

    DEFF Research Database (Denmark)

    Flanagan, Marian; Christensen, Tina Paulsen

    2014-01-01

    There is a growing interest in machine translation (MT) and post-editing (PE). MT has been around for decades, but the use of the technology has grown significantly in the language industry in recent years, while PE is still a relatively new task. Consequently, there are currently no standard PE...

  13. Estonianization Efforts Post-Independence

    Science.gov (United States)

    Rannut, Mart

    2008-01-01

    The purpose of this paper is to provide an overview of the sociolinguistic situation in Estonia. The paper opens with a historic overview, followed by an overview of the current demographic situation and of post-Soviet language and education policies and practices. It is argued that Estonia represents a success story in terms of language policy,…

  14. Adding semantics to microblog posts

    NARCIS (Netherlands)

    E. Meij; W. Weerkamp; M. de Rijke

    2012-01-01

    Microblogs have become an important source of information for the purpose of marketing, intelligence, and reputation management. Streams of microblogs are of great value because of their direct and real-time nature. Determining what an individual microblog post is about, however, can be non-trivial

  15. Post Keynesianism Meets Feminist Economics

    NARCIS (Netherlands)

    I.P. van Staveren (Irene)

    2010-01-01

    textabstractThis article explores the relationships between post-Keynesian economics and feminist economics. It distinguishes three key concepts in each tradition that recommend serious attention in the other tradition: gender, the household and unpaid work and caring as key concepts in feminist eco

  16. Post-partum psychiatric disorders

    Directory of Open Access Journals (Sweden)

    Tanvi Vijay Tuteja

    2016-08-01

    Full Text Available Post-partum period is demanding period characterized by overwhelming biological, social and emotional changes. It requires significant personal and interpersonal adaptation, especially in case of primigravida. Childbearing from the standpoint of psychological medicine is the most complex event in human experience. Traditionally Inwood has classified post-partum psychiatric disorders (PPPD as maternity blues, post-partum (postnatal depression and puerperal psychosis (PP. However the spectrum of postpartum phenomenology is widely characterized by range of emotions from transient mood liability, irritability and weepiness to marked agitation, delusions, confusion and delirium. Untreated post-partum depression can have adverse long term effects. For the mother, the episode can be the precursor of chronic recurrent depression. For her children a mother's ongoing depression can contribute to emotional, cognitive and interpersonal problems in later life. And therefore a thorough knowledge of the same is important for all obstetrician and gynecologists. [Int J Reprod Contracept Obstet Gynecol 2016; 5(8.000: 2497-2502

  17. Subthreshold Post-Traumatic Stress Disorder

    OpenAIRE

    Eylem Ozten; Gokben Hizli Sayar

    2015-01-01

    Post-traumatic stress disorder is a very broad category among mental disorders. Since its inclusion in DSM-III, the diagnostic criteria of post-traumatic stress disorder has undergone a number of changes. The diagnosis and treatment of people who have some symptoms of post-traumatic stress disorder without meeting full criteria still remains controversial. Although subthreshold post-traumatic stress disorder has been debated since it was first defined, the presence of subthreshold post-trauma...

  18. Escore de cálcio coronariano prediz estenose e eventos na insuficiência renal crônica pré-transplante Score de calcio coronario predice estenosis y eventos en la insuficiencia renal crónica pre trasplante Coronary calcium score as predictor of stenosis and events in pretransplant renal chronic failure

    Directory of Open Access Journals (Sweden)

    Miguel Abraão Rosário

    2010-02-01

    este grupo. La evaluación del score de calcio coronario (SCC por tomografía computarizada ha estado comprobando valor pronóstico en la población sin enfermedad renal. OBJETIVO: Evaluar la exactitud del SCC para detectar EAC obstructiva y prever eventos cardiovasculares en candidatos a trasplante renal comparada a la angiografía coronaria invasiva (ACI cuantitativa. MÉTODOS: Se evaluaron a 97 pacientes con IRC y edad > 35 años. Se consideró como EAC obstructiva la presencia de estenosis > 50% o > 70% por la ACI. Datos descriptivos, concordancia, pruebas diagnósticas, Kaplan-Meier y análisis multivariado se utilizaron. RESULTADOS: El score de Agatston promedio fue de 580,6 ± 1.102,2; los valores mínimos y máximos fueron 0 y 7.994, y mediana de 176. Solamente 14 pacientes tenían score de calcio de cero. No hubo diferencias entre las etnias y la mayor presencia de calcio regional se asoció a la mayor probabilidad de estenosis coronaria en el mismo segmento. El score de calcio de Agatston presentó buena exactitud para el diagnóstico de estenosis, > 50% y > 70% con área bajo la curva ROC de 0,75 y 0,70, respectivamente. En el umbral de 400, el score de calcio identificó el subgrupo con mayor tasa de eventos cardiovasculares en tiempo promedio de seguimiento de 29,1 ± 11,0 meses. CONCLUSIÓN: El SCC en la evaluación de EAC presentó una buena performance diagnóstica y pronostica para eventos cardiovasculares en pacientes con insuficiencia renal crónica (IRC.BACKGROUND: Coronary artery disease (CAD is the major cause of death among chronic renal failure (CRF patients. Traditional, non-invasive exams to detect CAD and to predict events have shown insufficient results in this group. CT Scan evaluation of Coronary Calcium Score (CCS has proven to be of prognostic value for the population reporting no renal condition. OBJECTIVE: To investigate CCS accuracy in detecting obstructive CAD and in predicting cardiovascular events in candidates to renal transplant

  19. Post-burnout thrust measurements

    Science.gov (United States)

    McKenna, E. F.; Smith, H. T.

    1980-06-01

    Research was conducted into the problems of avoiding collision between separated payloads and spent rocket motors due to post burnout thrust, and the problem of contamination of scientific instrumentation due to outgassing of the smoldering insulation. The post burnout thrust was measured using a payload instrument module separated from an instrumented Black Brant VC Rocket in the exoatmosphere. In addition to measuring acceleration and velocities the spent motor was observed by a TV camera on board the command attitude controlled payload module. Analysis shows that the payload separated cleanly from the vehicle at a relative separation velocity of 0.69 m/sec, however the residual thrust of the spent motor overcame this differential, catching up to the payload 37 sec after separation and continuing on a parallel velocity vector at about 1.03 m/sec.

  20. Post-Acquisition IT Integration

    DEFF Research Database (Denmark)

    Henningsson, Stefan; Yetton, Philip

    2013-01-01

    The extant research on post-acquisition IT integration analyzes how acquirers realize IT-based value in individual acquisitions. However, serial acquirers make 60% of acquisitions. These acquisitions are not isolated events, but are components in growth-by-acquisition programs. To explain how...... serial acquirers realize IT-based value, we develop three propositions on the sequential effects on post-acquisition IT integration in acquisition programs. Their combined explanation is that serial acquirers must have a growth-by-acquisition strategy that includes the capability to improve...... IT integration capabilities, to sustain high alignment across acquisitions and to maintain a scalable IT infrastructure with a flat or decreasing cost structure. We begin the process of validating the three propositions by investigating a longitudinal case study of a growth-by-acquisition program....

  1. Post-Digital Literary Studies

    Directory of Open Access Journals (Sweden)

    Florian Cramer

    2016-03-01

    Full Text Available Digital humanities and digital literary studies face much the same challenges as contemporary media art: what will become of them once their media are no longer “new”, and the limitations of processing art as data have become more clearly and widely understood? This paper revisits information aesthetics and computer poetics from the 1960s and 1970s, casting them as precursors of today’s digital humanities, with many of the same issues, achievements and failures, and with their own hype cycles of boom and bust. Conversely, “post-digital” and “Post-Internet” trends in music, graphic design and visual arts may anticipate possible futures of digital humanities and literary studies after the hype has passed.

  2. Post-Industrial Cultural Criticism

    DEFF Research Database (Denmark)

    Kammer, Aske

    2015-01-01

    Integrating perspectives from research into cultural and post-industrial journalism, this article presents a pilot study of websites with reviews of arts and culture conducted by amateurs. Such websites constitute a popular space for cultural criticism, and one that challenges traditional hierarc...... reviewers have highly specialized knowledge of culture and, on that basis, argues that the emergence of this type of critic might represent a qualitative strengthening of cultural criticism.......Integrating perspectives from research into cultural and post-industrial journalism, this article presents a pilot study of websites with reviews of arts and culture conducted by amateurs. Such websites constitute a popular space for cultural criticism, and one that challenges traditional...... hierarchies within journalism. The article maps which Danish websites conduct arts and culture reviews, asks what features these websites have that facilitate public discourse, and measures the actual discussion on the websites. While academic diagnoses of the state of the online public sphere have generally...

  3. The ISAC post-accelerator

    Science.gov (United States)

    Laxdal, R. E.; Marchetto, M.

    2014-01-01

    The acceleration chain of the ISAC facility boosts the energy of both radioactive and stable light and heavy ions for beam delivery to both a medium energy area in ISAC-I and a high energy area in ISAC-II. The post-accelerator comprises a 35.4 MHz RFQ to accelerate beams of A/q ≤ 30 from 2 keV/u to 150 keV/u and a post stripper, 106.1 MHz variable energy drift tube linac (DTL) to accelerate ions of A/q ≤ 6 to a final energy between 0.15 MeV/u to 1.5 MeV/u. A 40 MV superconducting linac further accelerates beam from 1.5 MeV/u to energies above the Coulomb barrier. All linacs operate cw to preserve beam intensity.

  4. Post-Lyme disease syndrome.

    Science.gov (United States)

    Ścieszka, Joanna; Dąbek, Józefa; Cieślik, Paweł

    2015-01-01

    About 10% of patients with Lyme disease continue to experience musculoskeletal pain and cognitive dysfunction after recommended antibiotic treatment. This condition is called post-Lyme disease syndrome (PLDS) or post-treatment Lyme disease syndrome. These two terms are used interchangeably. The pathogenesis of PLDS has been controversial. The hypothesis that patients with PLDS may harbor hidden reservoirs of Borrelia burgdorferi after their initial antibiotic treatment is difficult to accept. The prospective, double-blind studies contradict this point of view. Also, recently published research applying xenodiagnosis to PLDS supports the opinion that PLDS most likely has an autoimmune background. Lengthy courses of antibiotics are not justified in patients with PLDS because of the lack of benefit, and they are fraught with hazards. Most patients with PLDS recover from persistent symptoms with time. However, it can take months before they feel completely well.

  5. Post-traumatic stress disorder

    OpenAIRE

    Jonathan I. Bisson

    2010-01-01

    Post-traumatic stress disorder (PTSD) is characterised by disabling symptoms of re-experiencing a traumatic event, avoidance behaviour, and hyperarousal (e.g., irritability or hypervigilance), lasting at least 1 month. PTSD may affect 10% of women and 5% of men at some stage, and symptoms may persist for several years.Risk factors include major trauma, lack of social support, peritraumatic dissociation, and previous psychiatric or personality factors.

  6. Country Development Diagnostics Post-2015

    OpenAIRE

    Gable, Susanna; Lofgren, Hans; Osorio-Rodarte, Israel

    2014-01-01

    With the 2015 deadline for the current Millennium Development Goals (MDGs) drawing near, the global community is shaping a new set of international development goals for the longer term. The process has involved consultations led by the UN Open Working Group guided by the 2013 report, a new global partnership of the UN High-level Panel. The work so far indicates that the post-2015 develo...

  7. Post-traumatic Stress Disorder

    OpenAIRE

    M Yadollahie; Javidi, H.

    2011-01-01

    Unexpected extreme sudden traumatic stressor may cause post-traumatic stress disorder (PTSD). Important traumatic events include war, violent personal assault (e.g., sexual assault, and physical attack), being taken hostage or kidnapped, confinement as a prisoner of war, torture, terrorist attack, severe car accidents, and natural disasters. In childhood age sexual abuse or witnessing serious injuries or unexpected death of a beloved one are among important traumatic events.PTSD can be catego...

  8. Actinomycosis - Left Post Chest Wall

    Directory of Open Access Journals (Sweden)

    Kafil Akhtar, M. Naim, S. Shamshad Ahmad, Nazoora Khan, Uroos Abedi, A.H. Khan*

    2008-01-01

    Full Text Available A forty year old female of weak body built presented with recurring small hard lumps in let posteriorchest wall for 3 years and discharging ulcers for 3 months duration. Clinically, the provisional diagnosiswas malignancy with secondary infection. FNAC showed features suggestive of dysplasia buthistopathology confirmed the diagnosis as actinomycosis. The present case is reported due to rare incidenceof actinomycosis at post chest wall with muscle involvement.

  9. Post-transplantation diabetes mellitus

    OpenAIRE

    N Zbiti; K Souly; Z Errami; L Guendouz; L Benamar; F Ezaitouni; N Ouzeddoun; R Bayahia; A Chabraoui; H Rhou

    2012-01-01

    To determine the prevalence of post-kidney transplantation diabetes (PTDM) and to assess its risk factors, we retrospectively studied 92 non-diabetic kidney transplant patients. The immunosuppressive drugs used to prevent rejection included prednisone, a calcineurin inhibitor (cyclosporine or tacrolimus) and an antimetabolite (azathioprine or mycofenolate mofetil). Diabetes was defined according to the WHO criteria and the American Diabetes Association. The mean age of our patients was 35.8 ±...

  10. Sweetpotato post-harvest assessment

    OpenAIRE

    Rees, Debbie; Van Oirschot, Quirien; Kapinga, Regina

    2003-01-01

    For any crop cultivar to be successful it must not only have good production characteristics but also characteristics that ensure the harvested crop is acceptable and suitable for its intended use. Sweetpotato Post-harvest Assessment summarizes work carried out on postharvest aspects of sweetpotato between 1994 and 2002 within collaborative projects involving the Natural Resources Institute (UK), the International Potato Center and the Tanzanian Ministry of Agriculture, with input from the Ke...

  11. Post-dural puncture headache

    Directory of Open Access Journals (Sweden)

    Ghaleb A

    2012-01-01

    Full Text Available Ahmed Ghaleb1, Arjang Khorasani2, Devanand Mangar31Department of Anesthesiology, University of Arkansas for Medical Sciences, Little Rock, AR, 2Anesthesiology Residency Program, Advocate Illinois Masonic Medical Center, Chicago, IL, 3Florida Gulf to Bay Anesthesiology, Tampa General Hospital, Tampa, FL, USAAbstract: Since August Bier reported the first case in 1898, post-dural puncture headache (PDPH has been a problem for patients following dural puncture. Clinical and laboratory research over the last 30 years has shown that use of smaller-gauge needles, particularly of the pencil-point design, are associated with a lower risk of PDPH than traditional cutting point needle tips (Quincke-point needle. A careful history can rule out other causes of headache. A postural component of headache is the sine qua non of PDPH. In high-risk patients < 50 years, post-partum, in the event a large-gauge needle puncture is initiated, an epidural blood patch should be performed within 24–48 hours of dural puncture. The optimum volume of blood has been shown to be 12–20 mL for adult patients. Complications caused by autologous epidural blood patching (AEBP are rare.Keywords: post-dural puncture headache, gauge, needles, cause, risk, incidence

  12. Post-Traumatic Stress Disorder Basics

    Science.gov (United States)

    ... Don’t Hurt Yourself For More Information Share Post-Traumatic Stress Disorder Basics Download PDF Download ePub Order a free ... might have post-traumatic stress disorder. What is post-traumatic stress disorder, or PTSD? PTSD is a real illness. You ...

  13. 10 CFR 160.6 - Posting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Posting. 160.6 Section 160.6 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) TRESPASSING ON COMMISSION PROPERTY § 160.6 Posting. Notices stating the pertinent prohibitions of §§ 160.3 and 160.4 and penalties of § 160.5 will be conspicuously posted at all entrances...

  14. 10 CFR 73.75 - Posting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Posting. 73.75 Section 73.75 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PHYSICAL PROTECTION OF PLANTS AND MATERIALS Records and Reports § 73.75 Posting. (a... criminal penalties, and associated posting requirements, under section 229 of the Atomic Energy Act...

  15. 36 CFR 261.51 - Posting.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Posting. 261.51 Section 261.51 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PROHIBITIONS Prohibitions in Areas Designated by Order § 261.51 Posting. Posting is accomplished by: (a) Placing a copy...

  16. 36 CFR 71.4 - Posting.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Posting. 71.4 Section 71.4... § 71.4 Posting. (a) The administering bureaus of the Department of the Interior shall provide for the posting of the following designation sign at entrances to Designated Entrance Fee Areas and at...

  17. Pain Management: Post-Amputation Pain

    Science.gov (United States)

    Pain Management Post-Amputation Pain Volume 8 · Issue 2 · March/April 1998 Text size Larger text Smaller text Java Required Print page Save and share ... by G. Edward Jeffries, MD, FACS Post-Amputation Pain Post-amputation pain is one of the most ...

  18. Statins for post resuscitation syndrome.

    Science.gov (United States)

    Kämäräinen, Antti; Virkkunen, Ilkka; Silfvast, Tom; Tenhunen, Jyrki

    2009-07-01

    After sudden cardiac arrest, successful resuscitation and return of spontaneous circulation, a multi-faceted ischaemia/reperfusion related disorder develops. This condition now known as post resuscitation syndrome is characterised by marked increases in the inflammatory response and changes in coagulation profile and vascular reactivity. Additionally, the production of reactive oxygen species and activation of cytotoxic cascades of metabolism add to these injury mechanisms resulting in multiorgan perfusion deficits and dysfunction. Especially in the cerebrum these injuries may be the cause of significant morbidity and mortality. Recent evidence has shown that statins (3-hydroxy-3-methylglutaryl coenzyme A reductase inhibitors) exert numerous beneficial effects in cardiovascular diseases irrespective of the lipid status. Remarkably, these pleiotropic effects seem to extended beyond cardiovascular diseases such as immunomodulative and antioxidative properties. We hypothesised that administration of statins early in the post resuscitation phase would prove beneficial in the resuscitated patient via several pleiotropic effects. These include inhibition of excessive coagulation and inflammatory response, suppression of oxygen radical production and improved vascular reactivity. The discussed effects are mediated via multiple pathways activated in the cardiac arrest victim, to which statins have been shown to have a beneficial modulating effect in experimental settings and non-cardiac arrest patients. To test this hypothesis in clinical practice, a randomized, controlled trial with sufficient power and standardised post resuscitation treatment would be necessary. The generally good tolerance of statin therapy with minimal adverse effects would support this experiment, although a parenteral form of the drug to ensure adequate dosage might be a prerequisite. PMID:19254829

  19. The post-secular city

    DEFF Research Database (Denmark)

    Greve, Anni

    calls for reconsiderations of well established research on religion in modern society. This paper presentation takes up the challenge from four angles. First it offers an argument for studying the return of religions from the view of the modern secularized individual. It is an angle already touched upon......) elements in ritual and ceremonies. Second, emergent spaces of post-secular practices are not only connected to traditional religious sites. With Schmautz (1998) it is necessary to understand a sacred site in its original social and cultural setting, and in the present experience of it. With a point...

  20. Post Mortem y Tony Manero

    OpenAIRE

    Urrutia, Carolina

    2015-01-01

    Post Mortem, el tercer largometraje de Pablo Larraín, podría ser el preludio de su cinta anterior Tony Manero ; el momento en que el protagonista (en ambas instancias interpretado por Alfredo Castro), cae irreversiblemente en la locura y se vuelve psicópata. La apuesta en ambos filmes es extrema porque asume la representación y la relectura de una época extrema, donde la demencia que se activa con el régimen militar ya parece estar instalada en la sociedad que lo origina y que ahora simplemen...

  1. [Post-traumatic stress disorder].

    Science.gov (United States)

    Ponteva, Matti; Henriksson, Markus; Isoaho, Raimo; Laukkala, Tanja; Männikkö, Timo; Punamäki, Raija-Leena; Wahlbeck, Kristian

    2009-01-01

    Psychosocial support and careful monitoring are recommended for acute stress reaction (ASR) and acute stress disorder (ASD). If symptoms require, short focused cognitive-behavioural psychotherapy can be used for ASD. Medication is rarely necessary, but sleeping pills can be used for a short period. Trauma-focused psychotherapeutic interventions are first-line treatment for post-traumatic stress disorder. SSRI or SNRI antidepressant medication is also effective. There is less evidence on antipsychotic and antiepileptic medication. Psychotherapeutic interventions and medication can be, and often are, combined. Children, the elderly, and military and peacekeeping personnel need interventions that are tailored to their needs. PMID:19839195

  2. Off to the Post Office

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Whether you want to send a Christmas card to your family,ship some items back home or receive a birthday present from your loved ones,you will need to go to the post office or use one of the express mail providers that operate in China. Sending letters or parcels,domestically or internationally,is pretty straightforward in China.As long as you know what kind of service you are looking for,and the rules that need to be followed,you should not run into any problems.Here are some tips to help make this process easier.

  3. Clinical diagnosis and treatment of BK virus infection in renal transplant recipients%肾移植受者BK病毒感染的临床诊断及治疗

    Institute of Scientific and Technical Information of China (English)

    陈立中; 黄刚; 邱江; 李军; 陈国栋; 曾文涛; 傅茜; 张磊; 纪玉莲

    2008-01-01

    目的 探讨肾移植受者BK病毒(BKV)感染的诊断及治疗方法.方法 选取肾移植术后48个月内的患者共227例.采集其血、尿样本,行BKV尿沉渣细胞学计数与实时荧光定量PCR检测病毒拷贝.对部分肾移植受者进行移植肾活检.将尿或血中BKV DNA阳性患者80例分成干预组(51例)与对照组(29例).干预组进行调整免疫抑制剂:19例环孢素A(CsA)减量,22例他克莫司(FK506)减量,10例FK506转换成CsA;对照组不进行干预,并且密切监测急性排斥反应.干预3个月后再次检测,比较组内和组间干预前后BKV活化指标的差异.结果 227例受者的尿decoy细胞、BK病毒尿症与病毒血症的阳性率分别为33.O%、33.5%和15.4%.干预组干预后尿decoy细胞、尿和血BKV数量的中位水平均为O,明显低于干预前(5.0个/10HP,1.50 x 104拷贝/ml,0拷贝/ml,均P0.05),尿BKV数量观察结束时上升(观察前:0.79×104拷贝/ml,观察后:2.21 x104拷贝/ml,P0.05).The differences between the levels of urine decoy cells,urine BKV DNA level and blood BKV DNA level of the intervention group were all significantlly greater than those of the control group(Z=-2.749,-5.089,-1.996;P=0.006,0.000,0.046 respectively).And during the intervention no acute rejection was observed.Four cases of BKVAN were diagnosed.Treatment of immunosuppression reduction showed effectiveness in 4 BKVAN recipients.The levels of decoy cells in urine,and BKV load in urine and in PB samples were all decreased.The graft functions were improved.Conclusion Urilie cytology is very convenient,useful and sensitive for the evaluation and followup ofrenal transplant patients,and can reflect renal histological presentation indirect]y.Also BKV DNAdetection in the urine and peripheral blood is important to screen the evidence of BK reaction in order to prevent irreversible graft damage of BKVAN.The treatment of immunosuppressant reduction and replacement of FK506 with CsA are effective in BKV infection

  4. Detection of BK and JC polyomaviruses in blood and urine of renal allograft recipients and analysis their significance%肾移植术后血和尿中BKV、JCV的检测及意义

    Institute of Scientific and Technical Information of China (English)

    尚丽红; 游瑞君; 武小桐; 王振兴; 张文艳

    2015-01-01

    Objective Infection of BK and JC polyomavirus can lead to polyomavirus-associated nephropathy (PVAN) in renal allograft recipients. Qualitative and quantitative monitoring for BKV and JCV in time was needed to guide early detection, diagnosis and treatment of PVAN. Methods A total of 153 urine and 155 blood samples from renal allograft recipients were col-lected, and the expression of BKV and JCV of those samples were detected by real-time PCR. Results BKV virus load was de-tected in 51/153 patients (33.3%) in urine samples and 54/155 patients (34.8%) in blood samples, respectively. JCV virus load was detected in 47/150 patients copies/ml, means it has a high specificity and sensitivity. Conclusions Real-time fluorescence quan-titative PCR was simple, quick and easy to operate. Detection of BKV and JCV by PCR could be used for early diagnosis and screen of polyomavirus-associated nephropathy (PVAN) in renal allograft recipients, and also provided important support for clini-cal diagnosis and treatment.%目的:在临床上,及时对肾移植患者体内多瘤病毒BK病毒(BKV)和JC病毒(JCV)进行定性、定量监测,对多瘤病毒相关性肾病(PVAN)的早期发现、诊断和治疗具有重要的指导意义。方法我们分别收集肾移植术后患者尿液标本153例、血液标本155例。采用实时荧光定量PCR技术,检测患者血液和尿液中BKV和JCV表达水平。结果 BKV DNA在尿中的检出率为33.3%(51/153),血液中检出率为34.8%(54/155);JCV DNA在尿中的检测率为31.3%(47/150),血液中检出率为34.6%(54/156)。肾移植术后患者BKV和JCV检测的最低检测限为2×103copies/ml,具有较高的特异性和灵敏度。结论实时荧光定量PCR方法,简单、快速、易行。在临床上,利用PCR方法对肾移植术后患者体内BKV和JCV实时监测,可作为肾移植术后多瘤病毒相关性肾病(PVAN)的早期诊断和筛选的方法,也为诊断和治疗方案提供重要依据。

  5. CERN at the Post Office

    CERN Multimedia

    2006-01-01

    In collaboration with CERN and the Conseil général de l'Ain, the French postal services of the Pays de Gex have released a new set of pre-paid envelopes paying tribute to CERN. The envelopes, which come in packets of ten, each featuring a different aspect of CERN, will be on sale from 6 June onwards. They will be available from five post offices in the Pays de Gex (Ferney-Voltaire, Prévessin-Moëns, Saint-Genis-Pouilly, Thoiry and CERN-Prévessin), as well as from the CERN Shop (Reception, Building 33). The envelopes were unveiled at an official ceremony on 23 May, which was attended by Jocelyne Boch, Vice-President of the Conseil général de l'Ain and Mayoress of Thoiry, as well as Marina Combe, Head of the Saint-Genis-Pouilly, Thoiry and CERN-Prévessin post offices, and Maximilian Metzger, CERN's Secretary-General. The last set of envelopes to feature CERN, which commemorated the Laboratory's 50th anniversary in 2004, were a huge success, with sales totalling 35 000 in less than a year. 'We received...

  6. Post-Newtonian cosmological models

    CERN Document Server

    Sanghai, Viraj A A

    2015-01-01

    We construct a framework to probe the effect of non-linear structure formation on the large-scale expansion of the universe. We take a bottom-up approach to cosmological modelling by splitting our universe into cells. The matter content within each cell is described by the post-Newtonian formalism. We assume that most of the cell is in the vicinity of weak gravitational fields, so that it can be described using a perturbed Minkowski metric. Our cells are patched together using the Israel junction conditions. We impose reflection symmetry across the boundary of these cells. This allows us to calculate the equation of motion for the boundary of the cell and, hence, the expansion rate of the universe. At Newtonian order, we recover the standard Friedmann-like equations. At post-Newtonian orders, we obtain a correction to the large-scale expansion of the universe. Our framework does not depend on the process of averaging in cosmology. As an example, we use this framework to investigate the cosmological evolution ...

  7. Post-transplantation diabetes mellitus

    Directory of Open Access Journals (Sweden)

    N Zbiti

    2012-01-01

    Full Text Available To determine the prevalence of post-kidney transplantation diabetes (PTDM and to assess its risk factors, we retrospectively studied 92 non-diabetic kidney transplant patients. The immunosuppressive drugs used to prevent rejection included prednisone, a calcineurin inhibitor (cyclosporine or tacrolimus and an antimetabolite (azathioprine or mycofenolate mofetil. Diabetes was defined according to the WHO criteria and the American Diabetes Association. The mean age of our patients was 35.8 ± 10.5 years, and there was a clear male predominance (56 men and 36 women. The graft was from living related donor in 71/92 (76% patients. The prevalence of dia-betes in post-kidney transplant was 15.2%. The factors increasing the occurrence of PTDM included advanced age, high doses of steroids and cyclosporine. Management of PTDM included diet modification, oral anti-diabetic and insulin. We conclude that the prevalence of PTDM is significant in our transplant population and risk factors for its development are multiple and require aggressive multifaceted management.

  8. [Post-Lyme disease syndrome].

    Science.gov (United States)

    Błaut-Jurkowska, Justyna; Jurkowski, Marcin

    2016-02-01

    Lyme disease is a chronic infectious disease caused by the bacteria, spirochete of the Borrelia type. Skin, nervous system, musculoskeletal system and heart may be involved in the course of the disease. The prognosis for properly treated Lyme disease is usually good. However, in about 5% of patients so called Post-Lyme disease syndrome (PLSD) develops. It is defined as a syndrome of subjective symptoms persisting despite proper treatment of Borrelia burgdorferi infection. The most common symptoms include: fatigue, muscle and joint pain, and problems with memory and concentration. Pathogenesis of PLDS remains unknown. The differential diagnosis should include neurological, rheumatic and mental diseases. Till now there is no causative treatment of PLDS. In relieving symptom rehabilitation, painkillers, anti-inflammatory and antidepressants medicines are recommended. Emotional and psychological supports are also necessary. Non-specific symptoms reported by patients with post- Lyme disease syndrome raise the suspicion of other pathologies. This can lead to misdiagnosis and implementation of unnecessary, potentially harmful to the patient's therapy. An increase in tick-borne diseases needs to increase physicians awareness of these issues. PMID:27000820

  9. Sterile post-traumatic immunosuppression.

    Science.gov (United States)

    Islam, Md Nahidul; Bradley, Benjamin A; Ceredig, Rhodri

    2016-04-01

    After major trauma, the human immune system initiates a series of inflammatory events at the injury site that is later followed by suppression of local inflammation favoring the repair and remodeling of the damaged tissues. This local immune response involves complex interactions between resident cells such as macrophages and dendritic cells, soluble mediators such as cytokines and chemokines, and recruited cells such as neutrophils, monocytes and mesenchymal stromal cells. If of sufficient magnitude, these initial immune responses nevertheless have systemic consequences resulting in a state called post-traumatic immunosuppression (PTI). However, controversy exists regarding the exact immunological changes occurring in systemic compartments triggered by these local immune responses. PTI is one of the leading causes of post-surgical mortality and makes patients vulnerable to hospital-acquired infections, multiple organ failure and many other complications. In addition, hemorrhage, blood transfusion, immunesenescence and immunosuppressant drugs aggravate PTI. PTI has been intensively studied, but published results are frequently cloudy. The purpose of this review is to focus on the contributions made by different responsive modalities to immunosuppression following sterile trauma and to try to integrate these into an overall scheme of PTI. PMID:27195120

  10. [Post-dural puncture headache].

    Science.gov (United States)

    Radke, K; Radke, O C

    2013-02-01

    Headache following dural puncture is a typical complication of neuraxial analgesia and can impair the ability to perform activities of daily living up to incapacitation. The use of thin, atraumatic needles and special puncture techniques (e.g. reinsertion of the stylet) can prevent the majority of post-dural puncture headaches (PDPH). One of the most effective measures to prevent headache after accidental dural puncture is the intrathecal or epidural administration of morphine. When the diagnosis of PDPH is confirmed after excluding relevant differential diagnoses, some of which are potentially life-threatening, caffeine, theophylline and non-opioid analgesics are effective agents to reduce the severity of the symptoms. Traditional measures, such as strict bed rest and hyperhydration can no longer be recommended. If invasive treatment of the headache is warranted an epidural blood patch is still the method of choice with a high rate of success. PMID:23400710

  11. Post-Newtonian quasirigid body

    International Nuclear Information System (INIS)

    In this paper, we construct for the first time, in the first post-Newtonian (1PN) approximation, a complete model of a quasirigid body by means of a new constraint on the mass current density and mass density. In our 1PN quasirigid body model most of the relations, such as the spin vector proportional to the angular velocity, the definition of the moment of inertia tensor, the key relation between the mass quadrupole moment and the moment of inertia tensor, the rigid rotating formulas for the mass quadrupole moment, and the moment of inertia tensor, are just an extension of the main relations in the Newtonian rigid body model. When all of the 1/c2 terms are neglected, the 1PN quasirigid body model and the corresponding formulas reduce to the Newtonian version. A key relation is obtained in this paper for the first time, which might be very useful in future applications to problems in geodynamics and astronomy

  12. Post Mortem et Tony Manero

    OpenAIRE

    Urrutia, Carolina

    2015-01-01

    Post Mortem, troisième long-métrage de Pablo Larraín, pourrait être le prélude du film précédent, Tony Manero ; le moment où le protagoniste (joué dans les deux cas par Alfredo Castro) tombe dans la folie sans retour et devient psychopathe. Le pari des deux films est extrême, car il assume la représentation et la relecture d’une époque extrême, où la démence mise en action sous le régime militaire semble être déjà installée dans la société qui lui donne naissance. Cette folie ne fait plus qu’...

  13. Post-therapeutic imaging findings

    Energy Technology Data Exchange (ETDEWEB)

    Pollice, Saverio, E-mail: saveriopollice@hotmail.it [Department of Radiology and Neuroradiology, “L. Bonomo Hospital”, 76123 Andria, BT (Italy); Muto, Mario, E-mail: mutomar@tiscali.it [Department of Neuroradiology, “Cardarelli Hospital”, Naples (Italy); Scarabino, Tommaso, E-mail: tscarabino@hotmail.com [Department of Radiology and Neuroradiology, “L. Bonomo Hospital”, 76123 Andria, BT (Italy)

    2015-05-15

    Highlights: • This study is the result of collaboration between neuroradiologists and neurosurgeons. • Comparison between neuroimaging techniques to better evaluate the complications after treatment of the spin. • Evaluation of the imaging features of complications and definition of follow-up. - Abstract: Any surgical approach modifies the normal anatomical and functional arrangement of the segmental spine which is aimed, therefore image interpretation cannot ignore a correct set of knowledge in the field of anatomy, pathophysiology, drug compliance, interventional radiology and surgery. Neuroradiological imaging has an important role before surgery to direct the surgeon or interventional radiologist during the operation, both in post-surgery, where imaging examination can rightly evaluate properties and effects of the treatment and can detect potential complications as infections, abscess, bleeding, exuberant scar, mobilization and rupture of devices. The available methods of imaging are the X-rays (XR) made at least in two projections, Computed Tomography (CT) with MPR (multiplanar) and VR (volume rendering) reconstruction, and Magnetic Resonance (MR), often performed before and after contrast media injection. Imaging assessment of spine after surgery is complex and depends upon several factors, including surgical procedures and disease for which it was performed; biomechanical of the underlying cortical and cancellous bone findings; conditions of muscles, intervertebral disk and ligaments; time since surgery procedures; duration and nature of the post-surgical syndrome. Depending upon several factors, one or a combination of complementary imaging modalities (X-rays, Computed Tomography, Magnetic Resonance) may be required to evaluate effectiveness of the treatment; to demonstrate any clinically relevant abnormality at the treated region and adjacent structures (complications such as inflammation, abscesses, bleeding and misplacement of the device); to

  14. Gynecologic Malignancies Post-LeFort Colpocleisis

    Directory of Open Access Journals (Sweden)

    Rayan Elkattah

    2014-01-01

    Full Text Available Introduction. LeFort colpocleisis (LFC is a safe and effective obliterative surgical option for older women with advanced pelvic organ prolapse who no longer desire coital activity. A major disadvantage is the limited ability to evaluate for post-LFC gynecologic malignancies. Methods. We present the first case of endometrioid ovarian cancer diagnosed after LFC and review all reported gynecologic malignancies post-LFC in the English medical literature. Results. This is the second reported ovarian cancer post-LFC and the first of the endometrioid subtype. A total of nine other gynecologic malignancies post-LFC have been reported in the English medical literature. Conclusions. Gynecologic malignancies post-LFC are rare. We propose a simple 3-step strategy in evaluating post-LFC malignancies.

  15. 10 CFR 860.6 - Posting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Posting. 860.6 Section 860.6 Energy DEPARTMENT OF ENERGY TRESPASSING ON DEPARTMENT OF ENERGY PROPERTY § 860.6 Posting. Notices stating the pertinent prohibitions of §§ 860.3 and 860.4 and penalties of § 860.5 will be conspicuously posted at all entrances of...

  16. [Post-traumatic stress disorder after childbirth].

    Science.gov (United States)

    Korábová, I; Masopustová, Z

    2016-01-01

    The aim of this paper is to introduce the issue of post-traumatic stress disorder after childbirth to health care professionals. The text focuses on the diagnostic definition of post-traumatic stress disorder after childbirth, symptoms, physiological background, prevalence, course, risk factors and consequences of post-traumatic stress disorder after childbirth for a woman, her child and her partner. Options for interventions and therapy are outlined as well. PMID:26982058

  17. PRIMIPARA POST PARTUM DEPRESSION DIAGNOSIS AND TREATMENT

    OpenAIRE

    Esha Pradnyana; Wayan Westa; Nyoman Ratep

    2013-01-01

    Pregnancy and the first child birth is an influential complex event for a mother, which is where everything including phsycal and psyological aspects. This change can make mother psyological disorder, that can lead into depression after childbearing that call post childbearing depression or post partum depression. A wide review at 59 study make a result that 13% among primipara can suffer post partum depression 12 weeks after childbearing. Estabilishmet of this diagnosis, besides from history...

  18. A post-processor for Gurmukhi OCR

    Indian Academy of Sciences (India)

    G S Lehal; Chandan Singh

    2002-02-01

    A post-processing system for OCR of Gurmukhi script has been developed. Statistical information of Punjabi language syllable combinations, corpora look-up and certain heuristics based on Punjabi grammar rules have been combined to design the post-processor. An improvement of 3% in recognition rate, from 94.35% to 97.34%, has been reported on clean images using the post-processing techniques.

  19. Image Post-Processing in Dental Practice

    OpenAIRE

    Gormez, Ozlem; Yilmaz, Hasan Huseyin

    2009-01-01

    Image post-processing of dental digital radiographs, a function which used commonly in dental practice is presented in this article. Digital radiography has been available in dentistry for more than 25 years and its use by dental practitioners is steadily increasing. Digital acquisition of radiographs enables computer-based image post-processing to enhance image quality and increase the accuracy of interpretation. Image post-processing applications can easily be practiced in dental office by ...

  20. Prevention of Post-ERCP Pancreatitis

    OpenAIRE

    Donnellan, F.; Byrne, Michael F

    2011-01-01

    Post-procedure pancreatitis is the most common complication of endoscopic retrograde cholangio pancreatography (ERCP) and carries a high morbidity and mortality occurring in at least 3%-5% of all procedures. We reviewed the available literature searching for “ERCP” and “pancreatitis” and “post-ERCP pancreatitis”. in PubMed and Medline. This review looks at the diagnosis, risk factors, causes and methods of preventing post-procedure pancreatitis. These include the evidence for patient selectio...

  1. A Review of Post and Core Application with Emphasize on Non Metallic Posts

    Directory of Open Access Journals (Sweden)

    Shahroodi MH

    2001-05-01

    Full Text Available Many different methods are suggested to restore endodontically treated teeth. Prefabricated posts can not be indicated for all teeth and cast posts require extra time and cost. In addition, with the introduction of full ceramic restorations, achieving the ideal esthetic with metal post underneath them may be problematic or impossible because the darkness of the metallic posts may show through the highly translucent all ceramic restorations. In this article the review of litature and describiton of applied methods of different procedure in restoring the root canal therapied teeth and few techniques of non metallic posts fabrication such as fiber reinforced composite and zirconium oxide posts have been described.

  2. Post-Human Body and Beauty

    OpenAIRE

    Maria Teresa Russo; Nicola Di Stefano

    2014-01-01

    El artículo pone en duda la posibilidad misma de una estética post-humana, a partir de la siguiente premisa: en lugar de post-humano, es más correcto hablar de post-natural, indicando con esta expresión una realidad producida a través de un nuevo tipo de evolución, que no cambia simplemente la naturaleza humana, sino que la des-naturaliza, transformándola radicalmente en artefacto. Esta post-naturaleza, que aspira a ser perfecta, inmortal, invulnerable, es totalmente carente de belleza. De he...

  3. STS 63: Post flight presentation

    Science.gov (United States)

    1995-02-01

    At a post flight conference, Captain Jim Wetherbee, of STS Flight 63, introduces each of the other members of the STS 63 crew (Eileen Collins, Pilot; Dr. Bernard Harris, Payload Commander; Dr. Michael Foale, Mission Specialist from England; Dr. Janice Voss, Mission Specialist; and Colonel Vladimir Titor, Mission Specialist from Russia), gave a short autobiography of each member and a brief description of their assignment during this mission. A film was shown that included the preflight suit-up, a view of the launch site, the actual night launch, a tour of the Space Shuttle and several of the experiment areas, several views of earth and the MIR Space Station and cosmonauts, the MlR-Space Shuttle rendezvous, the deployment of the Spartan Ultraviolet Telescope, Foale and Harris's EVA and space walk, the retrieval of Spartan, and the night entry home, including the landing. Several spaceborne experiments were introduced: the radiation monitoring experiment, environment monitoring experiment, solid surface combustion experiment, and protein crystal growth and plant growth experiments. This conference ended with still, color pictures, taken by the astronauts during the entire STS 63 flight, being shown.

  4. Parameterized Post-Newtonian Cosmology

    CERN Document Server

    Sanghai, Viraj A A

    2016-01-01

    Einstein's theory of gravity has been extensively tested on solar system scales, and for isolated astrophysical systems, using the perturbative framework known as the parameterized post-Newtonian (PPN) formalism. This framework is designed for use in the weak-field and slow-motion limit of gravity, and can be used to constrain a large class of metric theories of gravity with data collected from the aforementioned systems. Given the potential of future surveys to probe cosmological scales to high precision, it is a topic of much contemporary interest to construct a similar framework to link Einstein's theory of gravity and its alternatives to observations on cosmological scales. Our approach to this problem is to adapt and extend the existing PPN formalism for use in cosmology. We derive a set of equations that use the same parameters to consistently model both weak fields and cosmology. This allows us to parameterize a large class of modified theories of gravity and dark energy models on cosmological scales, ...

  5. Post Pelvic Radiotherapy Bony Changes

    Energy Technology Data Exchange (ETDEWEB)

    Huh, Seung Jae [Samsung Medical Center, Seoul (Korea, Republic of)

    2009-03-15

    There has been recent interest in radiation-induced bone injury in clinical conditions, especially for pelvic insufficiency fracture (PIF). A PIF is caused by the effect of normal or physiological stress on bone with demineralization and decreased elastic resistance. Pelvic radiotherapy (RT) can also contribute to the development of a PIF. A PIF has been regarded as a rare complication with the use of megavoltage equipment. However, recent studies have reported the incidence of PIFs as 8.2{approx}20% after pelvic RT in gynecological patients, an incidence that was higher than previously believed. The importance of understanding a PIF lies in the potential for misdiagnosis as a bony metastasis. If patients complain of pelvic pain after whole-pelvis radiation therapy, the presence of a PIF must be considered in the differential diagnosis. The use of multibeam arrangements and conformal RT to reduce the volume and dose of irradiated pelvic bone can be helpful to minimize the risk of fracture. In addition to a PIF, osteonecrosis and avascular necrosis of the femoral head can develop after radiation therapy. Osteoradionecrosis of the pelvic bone is a clinical diagnostic challenge that must be differentiated from an osseous metastasis. A post-radiation bone sarcoma can result as a long-term sequela of pelvic irradiation for uterine cervical cancer.

  6. Post partum pelvic floor changes.

    Science.gov (United States)

    Fonti, Ylenia; Giordano, Rosalba; Cacciatore, Alessandra; Romano, Mattea; La Rosa, Beatrice

    2009-10-01

    Pelvic-perineal dysfunctions, are the most common diseases in women after pregnancy. Urinary incontinence and genital prolapsy, often associated, are the most important consequences of childbirth and are determined by specific alterations in the structure of neurological and musculo-fascial pelvic support.Causation is difficult to prove because symptom occur remote from delivery.Furthermore it is unclear whether changes are secondary to the method of childbirth or to the pregnancy itself.This controversy fuels the debate about whether or not women should be offered the choice of elective caesarean delivery to avoid the development of subsequent pelvic floor disfunction.But it has been demonstrated that pregnancy itself, by means of mechanical changes of pelvic statics and changes in hormones, can be a significant risk factor for these diseases. Especially is the first child to be decisive for the stability of the pelvic floor.During pregnancy, the progressive increase in volume of the uterus subject perineal structures to a major overload. During delivery, the parties present and passes through the urogenital hiatus leading to growing pressure on the tissues causing the stretching of the pelvic floor with possible muscle damage, connective tissue and / or nervous.In this article we aim to describe genitourinary post partum changes with particular attention to the impact of pregnancy or childbirth on these changes. PMID:22439048

  7. Comparison of transcriptomic signature of post-Chernobyl and post radiotherapy thyroid tumors

    International Nuclear Information System (INIS)

    We previously identified two highly discriminating and predictive radiation-induced transcriptomic signatures by comparing series of sporadic and post radiotherapy thyroid tumors (322-gene signature), and by reanalyzing a previously published data set of sporadic and post-Chernobyl thyroid tumors (106-gene signature). The aim of the present work was (i) to compare the two signatures in terms of gene expression de-regulations and molecular features/pathways, and (ii) to test the capacity of the post radiotherapy signature in classifying the post-Chernobyl series of tumors and reciprocally of the post-Chernobyl signature in classifying the post radiotherapy-induced tumors. We now explored if post radiotherapy and post-Chernobyl papillary thyroid carcinomas (PTC) display common molecular features by comparing molecular pathways deregulated in the two tumor series, and tested the potential of gene subsets of the post radiotherapy signature to classify the post-Chernobyl series (14 sporadic and 12 post-Chernobyl PTC), and reciprocally of gene subsets of the post-Chernobyl signature to classify the post radiotherapy series (15 sporadic and 12 post radiotherapy PTC), by using conventional principal component analysis. We found that the five genes common to the two signatures classified the learning/training tumors (used to search these signatures) of both the post radiotherapy (seven PTC) and the post-Chernobyl (six PTC) thyroid tumor series as compared with the sporadic tumors (seven sporadic PTC in each series). Importantly, these five genes were also effective for classifying independent series of post radiotherapy (five PTC) and post-Chernobyl (six PTC) tumors compared to independent series of sporadic tumors (eight PTC and six PTC respectively; testing tumors). Moreover, part of each post radiotherapy (32 genes) and post-Chernobyl signature (16 genes) cross-classified the respective series of thyroid tumors. Finally, several molecular pathways deregulated in post

  8. Atrial fibrillation post cardiac bypass surgery

    OpenAIRE

    Mostafa, Ashraf; EL-Haddad, Mohamed A.; Shenoy, Maithili; Tuliani, Tushar

    2012-01-01

    Atrial fibrillation occurs in 5-40% patients after coronary artery bypass graft surgery. Atrial fibrillation increases mortality and morbidity in the post-operative period. We sought to conduct a comprehensive review of literature focusing on pathophysiology, risk factors, prevention and treatment of post coronary artery bypass graft atrial fibrillation.

  9. Post-Colonialism Perspectives on Educational Competition

    Science.gov (United States)

    Yeh, Chuan-Rong

    2016-01-01

    Educational competition has always been the puzzle issue of educational researches. In this article, I analyze several aspects of educational competition within the perspective of post-colonialism discourse. In the political aspect, Taiwanese education is linked with political power, to present the post-colonial spirit by continuing dynastic…

  10. Post-emergence herbicides useful in calendula

    Science.gov (United States)

    Easy and effective weed control is required by growers who are considering new industrial crops. Post-emergence herbicides typically are the products of choice by today’s growers. Unfortunately, post-emergence herbicides with proven safety margins are not known for calendula (Calendula officinalis),...

  11. 46 CFR 91.05-15 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 91.05-15 Section 91.05-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS INSPECTION AND CERTIFICATION Permit To Proceed to Another Port for Repair § 91.05-15 Posting. (a) The permit shall be carried in...

  12. 46 CFR 189.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Posting. 189.01-5 Section 189.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 189.01-5 Posting. (a) The original certificate of inspection shall, in general,...

  13. 46 CFR 169.217 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Posting. 169.217 Section 169.217 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Inspection and Certification Certificate of Inspection § 169.217 Posting. The certificate of inspection must be framed...

  14. 46 CFR 196.12-1 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Posting. 196.12-1 Section 196.12-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Stability Letter § 196.12-1 Posting. If a stability letter is issued in accordance with the requirements in § 170.120...

  15. 46 CFR 91.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 91.01-5 Section 91.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 91.01-5 Posting. (a) On vessels of over 25 gross tons, the original certificate...

  16. 10 CFR 34.53 - Posting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Posting. 34.53 Section 34.53 Energy NUCLEAR REGULATORY COMMISSION LICENSES FOR INDUSTRIAL RADIOGRAPHY AND RADIATION SAFETY REQUIREMENTS FOR INDUSTRIAL RADIOGRAPHIC OPERATIONS Radiation Safety Requirements § 34.53 Posting. All areas in which industrial radiography is...

  17. 46 CFR 71.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Posting. 71.01-5 Section 71.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 71.01-5 Posting. The certificate of inspection shall be displayed under glass in a...

  18. 10 CFR 1048.6 - Posting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Posting. 1048.6 Section 1048.6 Energy DEPARTMENT OF ENERGY (GENERAL PROVISIONS) TRESPASSING ON STRATEGIC PETROLEUM RESERVE FACILITIES AND OTHER PROPERTY § 1048.6 Posting. Notices stating the pertinent prohibitions of §§ 1048.3 and 1048.4 and the penalties of §...

  19. 46 CFR 126.240 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 126.240 Section 126.240 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 126.240 Posting. The Certificate of Inspection must be framed under glass or...

  20. 46 CFR 71.05-15 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Posting. 71.05-15 Section 71.05-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND CERTIFICATION Permit To Proceed to Another Port for Repair § 71.05-15 Posting. (a) The permit shall be carried in a manner similar...

  1. 46 CFR 71.10-15 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Posting. 71.10-15 Section 71.10-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND CERTIFICATION Permit To Engage in Excursions § 71.10-15 Posting. (a) The permit when used, shall be carried in addition to...

  2. Posting of workers : Enforcement problems and challenges

    NARCIS (Netherlands)

    Cremers, Jan

    2013-01-01

    Expert contribution to a final conference. According to the author, monitoring the process of posting and controlling the regular character of the cross-border provision of services with posted workers has proven to be a problematic area. Recent joint activities of the labour inspectorate have confi

  3. 46 CFR 97.11-1 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 97.11-1 Section 97.11-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS OPERATIONS Stability Letter § 97.11-1 Posting. If a stability letter is issued under § 170.120 of this chapter, it must be...

  4. 46 CFR 189.05-15 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Posting. 189.05-15 Section 189.05-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS INSPECTION AND CERTIFICATION Permit To Proceed to Another Port for Repair § 189.05-15 Posting. (a) The permit shall be...

  5. The Review of China Post's Informationizing Constructing

    Institute of Scientific and Technical Information of China (English)

    WANG Wei-min; DU Yu-wei; SUN Hao

    2005-01-01

    The article briefly introduces the three stages that China Post experienced and the circumstances of the fundamental network construction, focusing on introducing the three sorts of services based on postal comprehensive computer network's applicable software system: postal financial service; traditional service electrified; electronic postal service. Finally the thinking for future China Post's informationizing constructing is put forward.

  6. Patients' quality of life post thyroidectomy.

    LENUS (Irish Health Repository)

    Cashman, E C

    2011-01-01

    This study was designed to evaluate health related quality of life post thyroidectomy for hyperthyroidism with respect to clinical benefit and patient satisfaction. This is one of the first such studies in the literature evaluating quality of life post thyroidectomy for hyperthyroidism.

  7. 77 FR 58592 - Modified Norway Post Agreement

    Science.gov (United States)

    2012-09-21

    ... Modified Norway Post Agreement AGENCY: Postal Regulatory Commission. ACTION: Notice. SUMMARY: The Commission is noticing a recently-filed Postal Service request to include a modified Norway Post Agreement... existing bilateral agreement for inbound competitive services with Posten Norge AS (Modified Norway...

  8. Post-Retrofit Residential Assessments

    Energy Technology Data Exchange (ETDEWEB)

    Lancaster, Ross; lutzenhiser, Loren; Moezzi, Mithra; Widder, Sarah H.; Chandra, Subrato; Baechler, Michael C.

    2012-04-30

    This study examined a range of factors influencing energy consumption in households that had participated in residential energy-efficiency upgrades. The study was funded by a grant from the U.S. Department of Energy’s Pacific Northwest National Laboratory and was conducted by faculty and staff of Portland State University Center for Urban Studies and Department of Economics. This work was made possible through the assistance and support of the Energy Trust of Oregon (ETO), whose residential energy-efficiency programs provided the population from which the sample cases were drawn. All households in the study had participated in the ETO Home Performance with Energy Star (HPwES) program. A number of these had concurrently pursued measures through other ETO programs. Post-retrofit energy outcomes are rarely investigated on a house-by-house basis. Rather, aggregate changes are ordinarily the focus of program impact evaluations, with deviation from aggregate expectations chalked up to measurement error, the vagaries of weather and idiosyncrasies of occupants. However, understanding how homes perform post-retrofit on an individual basis can give important insights to increase energy savings at the participant and the programmatic level. Taking a more disaggregated approach, this study analyzed energy consumption data from before and after the retrofit activity and made comparisons with engineering estimates for the upgrades, to identify households that performed differently from what may have been expected based on the estimates. A statistical analysis using hierarchal linear models, which accounted for weather variations, was performed looking separately at gas and electrical use during the periods before and after upgrades took place. A more straightforward comparison of billing data for 12-month periods before and after the intervention was also performed, yielding the majority of the cases examined. The later approach allowed total energy use and costs to be

  9. Retention of Root Canal Posts: Effect of Cement Film Thickness, Luting Cement, and Post Pretreatment.

    Science.gov (United States)

    Sahafi, A; Benetti, A R; Flury, S; Peutzfeldt, A

    2015-01-01

    The aim of this study was to investigate the effect of the cement film thickness of a zinc phosphate or a resin cement on retention of untreated and pretreated root canal posts. Prefabricated zirconia posts (CosmoPost: 1.4 mm) and two types of luting cements (a zinc phosphate cement [DeTrey Zinc] and a self-etch adhesive resin cement [Panavia F2.0]) were used. After removal of the crowns of 360 extracted premolars, canines, or incisors, the root canals were prepared with a parallel-sided drill system to three different final diameters. Half the posts did not receive any pretreatment. The other half received tribochemical silicate coating according to the manufacturer's instructions. Posts were then luted in the prepared root canals (n=30 per group). Following water storage at 37°C for seven days, retention of the posts was determined by the pull-out method. Irrespective of the luting cement, pretreatment with tribochemical silicate coating significantly increased retention of the posts. Increased cement film thickness resulted in decreased retention of untreated posts and of pretreated posts luted with zinc phosphate cement. Increased cement film thickness had no influence on retention of pretreated posts luted with resin cement. Thus, retention of the posts was influenced by the type of luting cement, by the cement film thickness, and by the post pretreatment. PMID:25764045

  10. Precarious posted worlds : Posted migrant workers in the Dutch construction and meat processing industries

    NARCIS (Netherlands)

    Berntsen, Lisa

    2015-01-01

    The posting of migrant workers has become an important employment channel for cross-border employment within the European Union (EU). Although posted workers are not formally excluded from labour rights, regulations are enacted in such a way that de facto they often are, as posted workers face many

  11. Explosive signatures: Pre & post blast

    Science.gov (United States)

    Bernier, Evan Thomas

    Manuscripts 1 and 2 of this dissertation both involve the pre-blast detection of trace explosive material. The first manuscript explores the analysis of human hair as an indicator of exposure to explosives. Field analysis of hair for trace explosives is quick and non-invasive, and could prove to be a powerful linkage to physical evidence in the form of bulk explosive material. Individuals tested were involved in studies which required handling or close proximity to bulk high explosives such as TNT, PETN, and RDX. The second manuscript reports the results of research in the design and application of canine training aids for non-traditional, peroxide-based explosives. Organic peroxides such as triacetonetriperoxide (TATP) and hexamethylenetriperoxidediamine (HMTD) can be synthesized relatively easily with store-bought ingredients and have become popular improvised explosives with many terrorist groups. Due to the hazards of handling such sensitive compounds, this research established methods for preparing training aids which contained safe quantities of TATP and HMTD for use in imprinting canines with their characteristic odor. Manuscripts 3 and 4 of this dissertation focus on research conducted to characterize pipe bombs during and after an explosion (post-blast). Pipe bombs represent a large percentage of domestic devices encountered by law enforcement. The current project has involved the preparation and controlled explosion of over 90 pipe bombs of different configurations in order to obtain data on fragmentation patterns, fragment velocity, blast overpressure, and fragmentation distance. Physical data recorded from the collected fragments, such as mass, size, and thickness, was correlated with the relative power of the initial device. Manuscript 4 explores the microstructural analysis of select pipe bomb fragments. Shock-loading of the pipe steel led to plastic deformation and work hardening in the steel grain structure as evidenced by optical microscopy and

  12. Post-harvest proteomics and food security.

    Science.gov (United States)

    Pedreschi, Romina; Lurie, Susan; Hertog, Maarten; Nicolaï, Bart; Mes, Jurriaan; Woltering, Ernst

    2013-06-01

    To guarantee sufficient food supply for a growing world population, efforts towards improving crop yield and plant resistance should be complemented with efforts to reduce post-harvest losses. Post-harvest losses are substantial and occur at different stages of the food chain in developed and developing countries. In recent years, a substantially increasing interest can be seen in the application of proteomics to understand post-harvest events. In the near future post-harvest proteomics will be poised to move from fundamental research to aiding the reduction of food losses. Proteomics research can help in reducing food losses through (i) identification and validation of gene products associated to specific quality traits supporting marker-assisted crop improvement programmes, (ii) delivering markers of initial quality that allow optimisation of distribution conditions and prediction of remaining shelf-life for decision support systems and (iii) delivering early detection tools of physiological or pathogen-related post-harvest problems. In this manuscript, recent proteomics studies on post-harvest and stress physiology are reviewed and discussed. Perspectives on future directions of post-harvest proteomics studies aiming to reduce food losses are presented.

  13. Development of new radiopaque glass fiber posts.

    Science.gov (United States)

    Furtos, Gabriel; Baldea, Bogdan; Silaghi-Dumitrescu, Laura

    2016-02-01

    The aim of this study was to analyze the radiopacity and filler content of three experimental glass fiber posts (EGFP) in comparison with other glass/carbon fibers and metal posts from the dental market. Three EGFP were obtained by pultrusion of glass fibers in a polymer matrix based on 2,2-bis[4-(2-hydroxy-3-methacryloyloxypropoxy)-phenyl]propane (bis-GMA) and triethyleneglycol dimethacrylate (TEGDMA) monomers. Using intraoral sensor disks 27 posts, as well as mesiodistal sections of human molar and aluminum step wedges were radiographed for evaluation of radiopacity. The percentage compositions of fillers by weight and volume were investigated by combustion analysis. Two EGFP showed radiopacity higher than enamel. The commercial endodontic posts showed radiopacity as follows: higher than enamel, between enamel and dentin, and lower than dentin. The results showed statistically significant differences (p b 0.05)when evaluatedwith one-way ANOVA statistical analysis. According to combustion analyses, the filler content of the tested posts ranges between 58.84wt.% and 86.02wt.%. The filler content of the tested EGFP ranged between 68.91 wt.% and 79.04 wt.%. EGFP could be an alternative to commercial glass fiber posts. Futureglass fiber posts are recommended to present higher radiopacity than dentin and perhaps ideally similar to or higher than that of enamel, for improved clinical detection. The posts with a lower radiopacity than dentin should be considered insufficiently radiopaque. The radiopacity of some glass fiber posts is not greatly influenced by the amount of filler.

  14. Development of new radiopaque glass fiber posts.

    Science.gov (United States)

    Furtos, Gabriel; Baldea, Bogdan; Silaghi-Dumitrescu, Laura

    2016-02-01

    The aim of this study was to analyze the radiopacity and filler content of three experimental glass fiber posts (EGFP) in comparison with other glass/carbon fibers and metal posts from the dental market. Three EGFP were obtained by pultrusion of glass fibers in a polymer matrix based on 2,2-bis[4-(2-hydroxy-3-methacryloyloxypropoxy)-phenyl]propane (bis-GMA) and triethyleneglycol dimethacrylate (TEGDMA) monomers. Using intraoral sensor disks 27 posts, as well as mesiodistal sections of human molar and aluminum step wedges were radiographed for evaluation of radiopacity. The percentage compositions of fillers by weight and volume were investigated by combustion analysis. Two EGFP showed radiopacity higher than enamel. The commercial endodontic posts showed radiopacity as follows: higher than enamel, between enamel and dentin, and lower than dentin. The results showed statistically significant differences (p b 0.05)when evaluatedwith one-way ANOVA statistical analysis. According to combustion analyses, the filler content of the tested posts ranges between 58.84wt.% and 86.02wt.%. The filler content of the tested EGFP ranged between 68.91 wt.% and 79.04 wt.%. EGFP could be an alternative to commercial glass fiber posts. Futureglass fiber posts are recommended to present higher radiopacity than dentin and perhaps ideally similar to or higher than that of enamel, for improved clinical detection. The posts with a lower radiopacity than dentin should be considered insufficiently radiopaque. The radiopacity of some glass fiber posts is not greatly influenced by the amount of filler. PMID:26652441

  15. Post-myelogram headache - physiological or psychological?

    International Nuclear Information System (INIS)

    Psychological aspects of post-lumbar puncture headache have hitherto received little attention. A hundred consecutive patients admitted for elective myelography were studied. Post-myelogram headache was assessed by an independent observer and found to be strongly associated with normality of the test (P<0.001). Psychological testing showed a trend between Hospital Anxiety Depression score and normality of myelogram as well as development of headache, although this did not achieve statistical significance. This study suggestet that there is a large psychological as well as organic component to post-myelogram headache. (orig.)

  16. Post-dengue encephalopathy and Parkinsonism.

    Science.gov (United States)

    Fong, Choong Yi; Hlaing, Chaw Su; Tay, Chee Geap; Ong, Lai Choo

    2014-10-01

    Parkinsonism as a neurologic manifestation of dengue infection is rare with only 1 reported case in an adult patient. We report a case of a 6-year-old child with self-limiting post-dengue encephalopathy and Parkinsonism. This is the first reported pediatric case of post-dengue Parkinsonism and expands the neurologic manifestations associated with dengue infection in children. Clinicians should consider the possibility of post-dengue Parkinsonism in children with a history of pyrexia from endemic areas of dengue. PMID:24776518

  17. Evaluation of pre-fabricated root canal posts.

    Science.gov (United States)

    Hew, Y S; Purton, D G; Love, R M

    2001-03-01

    In this in vitro study, properties of a titanium alloy post recently introduced to the market (IntegraPost), were compared with those of a clinically proven stainless steel post (ParaPost). The IntegraPost has a unique, perforated, spherical head and a microknurled shank surface. The posts were tested for rigidity, for retention within the root canals of extracted teeth and for ability to retain composite resin cores. The two post types exhibited similar properties in core and root canal retention, however, the IntegraPost was significantly less rigid than the ParaPost.

  18. Post-traumatic Stress Disorder

    Directory of Open Access Journals (Sweden)

    M Yadollahie

    2011-12-01

    Full Text Available Unexpected extreme sudden traumatic stressor may cause post-traumatic stress disorder (PTSD. Important traumatic events include war, violent personal assault (e.g., sexual assault, and physical attack, being taken hostage or kidnapped, confinement as a prisoner of war, torture, terrorist attack, severe car accidents, and natural disasters. In childhood age sexual abuse or witnessing serious injuries or unexpected death of a beloved one are among important traumatic events.PTSD can be categorized into two types of acute and chronic PTSD: if symptoms persist for less than three months, it is termed “acute PTSD,” otherwise, it is called “chronic PTSD.” 60.7% of men and 51.2% of women would experience at least one potentially traumatic event in their lifetime. The lifetime prevalence of PTSD is significantly higher in women than men. Lifetime prevalence of PTSD varies from 0.3% in China to 6.1% in New Zealand. The prevalence of PTSD in crime victims are between 19% and 75%; rates as high as 80% have been reported following rape. The prevalence of PTSD among direct victims of disasters was reported to be 30%–40%; the rate in rescue workers was 10%–20%. The prevalence of PTSD among police, fire, and emergency service workers ranged from 6%–32%. An overall prevalence rate of 4% for the general population, the rate in rescue/recovery occupations ranged from 5% to 32%, with the highest rate reported in search and rescue personnel (25%, firefighters (21%, and workers with no prior training for facing disaster. War is one of the most intense stressors known to man. Armed forces have a higher prevalence of depression, anxiety disorders, alcohol abuse and PTSD. High-risk children who have been abused or experienced natural disasters may have an even higher prevalence of PTSD than adults.Female gender, previous psychiatric problem, intensity and nature of exposure to the traumatic event, and lack of social support are known risk factors for work

  19. Fracture strength of endodontically treated teeth reconstructed with woven polyethylene fiber posts and biological posts

    Directory of Open Access Journals (Sweden)

    Kátia Rodrigues Reis

    2009-01-01

    Full Text Available Objective: To investigate the fracture strength and mode of endodontically treated teeth with structurally weakened roots reconstructed with woven polyethylene fiber posts and biological posts. Methods: After removing the crowns, 60 endodontically treated maxillary canines were distributed into 4 groups: 1 conventional root canal preparation and reconstruction with polyethylene fiber posts; 2 conventional root canal preparation and reconstruction with biological posts; 3 moderately flared root canals and reconstruction with biological posts; 4 widely flared root canals and reconstruction with biological posts. The posts were cemented with resin cement Enforce (Dentsply Ind. e Com., Petrópolis, Rio de Janeiro, Brasil and the core was constructed with Ti-Core (EssentialDental Systems, S. Hackensack, NJ, USA resin composite. The specimens were tested under compression in a universal testing machine. Results: The following fracture strength values were obtained: Group 1 – 45.46kgf; Group 2 – 53.30kgf; Group 3 – 58.67kgf; Group 4 – 47.91kgf, with statistically significant differences between Groups 1 and 3 (p<0.05. The following fracture modes were observed: Group 1 – predominance of fracture of the coronal portion of the post; Groups 2 and 3 – various fracture patterns; Group 4 – all roots fractured. Conclusion: Both posts were shown to be promising (adequate fracture strength and favorable pattern of fracture. Biological posts appear to be capable of reinforcing the root to some extent; however, fracture occured in all roots with widely flared root canals.

  20. Post-Release Success among Paroled Lifers

    NARCIS (Netherlands)

    Liem, M.C.A.; Garcin, J.

    2014-01-01

    Previous research suggests that social relations, in particular the forming of family ties and employment (social factors), self-efficacy (personal factors), and therapeutic interventions (institutional factors) constitute main contributors in post-release success. These studies, however, have large

  1. Proteomic analysis of post-translational modifications

    DEFF Research Database (Denmark)

    Mann, Matthias; Jensen, Ole N

    2003-01-01

    Post-translational modifications modulate the activity of most eukaryote proteins. Analysis of these modifications presents formidable challenges but their determination generates indispensable insight into biological function. Strategies developed to characterize individual proteins are now syst...

  2. Post-communism: postmodernity or modernity revisited?

    Science.gov (United States)

    Ray, L

    1997-12-01

    Coinciding with the popularity of postmodern theory, the fall of communism appeared to offer further evidence of the exhaustion of modernity. Such analysis is grounded in a view that the Soviet system was the epitome of modernity. An alternative approach regards post-communism as opening new terrains of struggle for modernity. Thus Habermas and others suggest that post-communist societies are rejoining the trajectory of western modernity whose problems they now recapitulate. This alternative view implies that Soviet systems were something other than 'modern', although their nature is not always clearly defined. However, even if post-communist societies do encounter problems of modernity, they do so in new circumstances where modernist notions of social development have become problematic. This article argues that, contrary to those who regard modernization or postmodernization as irresistible trends, core post-communist societies are likely to develop along an alternative path to that of western modernity. This is tentatively described as 'neo-mercantilist'.

  3. Post-traumatic stenosing flexor tenosynovitis

    OpenAIRE

    Best, Timothy J.

    2003-01-01

    Two cases of post-traumatic stenosing flexor tenosynovitis (flexor tendon entrapment or trigger digit) are presented. The medical literature contains few reports of this uncommon etiology for a problem that afflicts at least 2% of the adult population.

  4. PEP (Post-Exposure Prophylaxis) 101

    Science.gov (United States)

    ... AIDS PEP Language: English Español (Spanish) Recommend on Facebook Tweet Share Compartir PEP (post-exposure prophylaxis) means taking antiretroviral medicines (ART) after being potentially exposed to HIV to prevent ...

  5. Business Education in Post Soviet Countries

    OpenAIRE

    Doghonadze, Natela

    2009-01-01

    The presented article discusses the history of business education development in post Soviet countries. It is shown that, though much has been done in these countries to bring business education to international standards, still much has to be done

  6. Post-Treatment Lyme Disease Syndrome

    Science.gov (United States)

    ... FAQ Health care providers Educational materials Post-Treatment Lyme Disease Syndrome Recommend on Facebook Tweet Share Compartir ... ONE 7(1): e29914. HHS Special Webinar on Lyme Disease Persistence frame support disabled and/or not ...

  7. Congo: Evaluating the Post-Conflict state

    OpenAIRE

    De Boeck, Filip

    2009-01-01

    The objective of this seminar is to bring researchers, experts and policy-makers together and discuss the nature of the post-conflict Congolese state. Discussions will focus on a number of critical issues, including security governance, management of natural resources, local peace efforts and external interventions. Programme Day 1: The process of state building 9.15-9.30 Introduction 9.30-11.00 Panel 1: Evaluating the post-conflict state Speakers: Jean Omasombo – Royal Mus...

  8. Cyber-warfare: jus post bellum

    OpenAIRE

    Cisneros, Maribel

    2015-01-01

    Approved for public release; distribution is unlimited There is a lack of attention to the aftermath of a deployed cyber weapon: There is no mechanism for the assignment of accountability for the restoration of affected infrastructure and remediation of violation of established laws of war after cyberattacks occur. This study analyzes International Humanitarian Law and international treaties as they apply to the cyber post-conflict period and explores current jus post bellum frameworks, wh...

  9. Historical approaches to post-combat disorders

    OpenAIRE

    Jones, Edgar

    2006-01-01

    Almost every major war in the last century involving western nations has seen combatants diagnosed with a form of post-combat disorder. Some took a psychological form (exhaustion, combat fatigue, combat stress reaction and post-traumatic stress disorder), while others were characterized by medically unexplained symptoms (soldier's heart, effort syndrome, shell shock, non-ulcer dyspepsia, effects of Agent Orange and Gulf War Syndrome). Although many of these disorders have common symptoms, the...

  10. Fatigue in Older Adults Post Myocardial Infarction

    OpenAIRE

    Patricia Barton Crane; Jimmy eEfird; Willie Mae Abel

    2016-01-01

    Objective. The purpose of this study was to comprehensively examine putative factors that may independently contribute to fatigue and subsequent persistence of fatigue in elderly adults 6-8 months post myocardial infarction (MI). Studies suggest cardiac function, comorbidities, daytime sleepiness, depression, anemia, interleukins, and social support are correlates of fatigue; however, no studies have systematically examined these factors 6 months post MI in an aging population. Methods. Study...

  11. Post-processing speech recordings during MRI

    OpenAIRE

    Kuortti, Juha; Malinen, Jarmo; Ojalammi, Antti

    2015-01-01

    We discuss post-processing of speech that has been recorded during Magnetic Resonance Imaging (MRI) of the vocal tract. Such speech recordings are contaminated by high levels of acoustic noise from the MRI scanner. Also, the frequency response of the sound signal path is not flat as a result of severe restrictions on recording instrumentation due to MRI technology. The post-processing algorithm for noise reduction is based on adaptive spectral filtering. The speech material consists of sample...

  12. Cantilever steel post damaged by wind

    Directory of Open Access Journals (Sweden)

    Wei Sha

    2014-10-01

    Full Text Available An analysis for the cause of fracture failure of a cantilever steel sign post damaged by wind has been carried out. An unusual cause of failure has been identified, which is the subject of this paper. Microscopy and microanalysis of the fracture surface showed that the failure was due to pre-existing cracks, from the fabrication of the post. This conclusion was reached after detecting and analysing a galvanised layer on the fracture surfaces.

  13. Post-Keynesianism meets feminist economics

    OpenAIRE

    van Staveren, I.P.

    2010-01-01

    textabstractThis article explores the relationships between post-Keynesian economics and feminist economics. It distinguishes three key concepts in each tradition that recommend serious attention in the other tradition: gender, the household and unpaid work and caring as key concepts in feminist economics; uncertainty, market power and endogenous dynamics as core concepts in post-Keynesian economics. This article will show, with reference to the literature in which such cross-fertilisation ha...

  14. Post-Human Body and Beauty

    Directory of Open Access Journals (Sweden)

    Maria Teresa Russo

    2014-01-01

    Full Text Available El artículo pone en duda la posibilidad misma de una estética post-humana, a partir de la siguiente premisa: en lugar de post-humano, es más correcto hablar de post-natural, indicando con esta expresión una realidad producida a través de un nuevo tipo de evolución, que no cambia simplemente la naturaleza humana, sino que la des-naturaliza, transformándola radicalmente en artefacto. Esta post-naturaleza, que aspira a ser perfecta, inmortal, invulnerable, es totalmente carente de belleza. De hecho, si bien puede haber una estética de lo artificial y también del artefacto, en relación con los objetos, en cambio no puede darse una estética del cuerpo post-humano, debido a que éste se configura como un no-cuerpo y no tiene las características de lo que comúnmente se entiende por belleza (armonía entre materia y forma, reflejo de interioridad, unicidad. También en este caso, es más correcto hablar de post-belleza, que en sus propiedades parece una imagen especular de la belleza y, en última instancia, constituye su completa disolución.

  15. Abuse, Post-Traumatic Stress Disorder and Migraine

    Science.gov (United States)

    ... Post Traumatic Stress Disorder and Migraine Print Email Abuse, Post Traumatic Stress Disorder and Migraine ACHE Newsletter ... newsletter by entering your e-mail address below. Abuse, Post-Traumatic Stress Disorder and Migraine Gretchen E. ...

  16. Evaluation of post-surface conditioning to improve interfacial adhesion in post-core restorations

    Directory of Open Access Journals (Sweden)

    Mylswamy Sumitha

    2011-01-01

    Full Text Available Aim : To examine the influence of different post-surface treatments on the interfacial strength between epoxy resin-based fiber posts and methacrylate-based resin composites that are employed as core build-up materials. Materials and Methods : Forty clear posts were divided into four groups of 10 each. The different surface treatments used were etching with alkaline potassium permanganate, 10% hydrogen peroxide, 37% phosphoric acid, and silanization alone. After etching and thorough rinsing, a single layer of silane was applied to the post surface. Then the post was placed in a rectangular plastic matrix and core bulid-up was done using Multi Core, a dual cured composite resin. A slab of uniform thickness, with the post in the center and the core build-up composite on either side was created. The specimens were cut so as to obtain microtensile sticks that were loaded in tension at a cross-head speed of 1 mm/min until failure. The statistical analysis was performed using two-way ANOVA and the paired T test for post-hoc comparisons. Results : The results achieved with potassium permanganate had a significant influence on microtensile interfacial bond strength values with the tested material. Conclusion : Surface chemical treatments of the resin phase of fiber posts enhance the silanization efficiency of the quartz fiber phase, so that the adhesion in the post/core unit may be considered as a net sum of chemical and micromechanical retention.

  17. Post-insemination sexual selection in birds.

    Science.gov (United States)

    Pizzari, Tommaso

    2007-01-01

    In many avian species females obtain sperm from multiple males during a single reproductive event, setting the scene for post-insemination sexual selection through the competition of the ejaculates of different males over fertilisation (sperm competition) and female biased utilisation of sperm (cryptic female choice). The use of poultry techniques in combination with molecular tools is catalysing an interest in birds as vertebrate model systems to study the mechanisms of post-insemination sexual selection. This chapter: (i) outlines the main mechanisms of avian sperm competition, (ii) introduces methodological approaches to study post-insemination sexual selection in birds, (iii) reviews recent evidence of multiple mechanisms of strategic sperm allocation by males, and (iv) discusses mechanisms of cryptic female choice. Post-insemination variance in paternity in birds, appears to be determined by the interactions between complex male and female strategies of differential sperm utilisation. It is argued that a better understanding of the operation of post-insemination sexual selection in birds may be achieved through a two-pronged approach which, on the one hand, investigates behavioural and physiological mechanisms applying poultry techniques and molecular tools to domestic model species, and on the other, verifies these mechanisms and tests their adaptive significance in more natural populations.

  18. POST TRAUMATIC GROWTH PADA PENDERITA KANKER PAYUDARA

    Directory of Open Access Journals (Sweden)

    Erlina Listiyanti Widuri

    2012-03-01

    Full Text Available One of the deadly diseases for women is breast cancer. The wisdomdefined in this study was post traumatic growth. Post traumatic growth is apositive changes experience arising from the struggle of the great crises oflife. The purpose of this study was to determine the growth dynamics ofpost traumatic or post-traumatic growth toward positive life changes andwant to understand further the factors that influence the formation of posttraumatic growth in patients with breast cancer. The method used is basedon qualitative research using phenomenology method. The analysis showedthere were two factors that affecting the aspects of post traumatic growthin patients with breast cancer. External factors are the children andgrandchildren as life expectation and as encouragement or motivationsupport of both parents to perform the treatment, so it eventually leads tothe strengthening of internal factors. Internal factors include the factor offaith (spirituality, a strong desire to recover factors (optimism, resiliencefactors, and reframing factors. There are 4 (four post traumatic growtharising from the struggle with breast cancer in the face of illness: an increasein spirituality, positive improvement in life, and the higher prosocial andbetter social relations.

  19. Post-Colonial Theory and Action Research

    Directory of Open Access Journals (Sweden)

    Jim B. Parsons

    2011-04-01

    Full Text Available This essay explores connections between post-colonial theory and action research. Post-colonial theory is committed to addressing the plague of colonialism. Action research, at its core, promises to problematize uncontested ‘colonial’ hegemonies of any form. Both post-colonial theory and action research engage dialogic, critically reflective and collaborative values to offer a fuller range of human wisdom. The authors contend that post-colonialism theory calls for justice and seeks to speak to social and psychological suffering, exploitation, violence and enslavement done to the powerless victims of colonization around the world by challenging the superiority of dominant perspectives and seeking to re-position and empower the marginalized and subordinated. In similar ways, action research works to eradicate oppression, powerlessness and worthlessness by affirming solidarity with the oppressed, helping humans move from passive to active and by fundamentally reshaping power. Because both post-colonial theory and action research position the insider or oppressed in an ethic of efficacy, it values community, relationships, communication and equality, and is committed to reciprocity, reflexivity and reflection. Thus, both hold the potential to help reconstruct conditions for a more democratic and just society.

  20. Marijuana-Related Posts on Instagram.

    Science.gov (United States)

    Cavazos-Rehg, Patricia A; Krauss, Melissa J; Sowles, Shaina J; Bierut, Laura J

    2016-08-01

    Instagram is a highly visual social networking site whose audience continues to grow, especially among young adults. In the present study, we examine marijuana-related content on Instagram to better understand the varied types of marijuana-related social networking occurring on this popular social media platform. We collected 417,561 Instagram posts with marijuana-related hashtags from November 29 to December 12, 2014. We assessed content of a random sample (n = 5000) of these posts with marijuana-related hashtags. Approximately 2136 (43 %) were explicit about marijuana and further analyzed. Of the 2136 marijuana-related posts, images of marijuana were common (n = 1568). Among these 1568 marijuana images, traditional forms (i.e., buds/leaves) were the most common (63 %), followed by some novel forms of marijuana, including marijuana concentrates (20 %). Among the 568 posts that displayed marijuana being ingested, 20 % showed someone dabbing marijuana concentrates. Marijuana-related advertisements were also observed among the 2136 marijuana-related posts (9 %). Our findings signal the promotion of marijuana use in its traditional plant-based form; trendy and novel modes of marijuana ingestion were also endorsed. This content along with the explicit marketing of marijuana that we observed on Instagram have potential to influence social norms surrounding marijuana use. PMID:27262456

  1. 14 CFR 417.415 - Post-launch and post-flight-attempt hazard controls.

    Science.gov (United States)

    2010-01-01

    ... evidence; and (4) Ensuring public safety from hazardous debris, such as plans for recovery and salvage of... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Post-launch and post-flight-attempt hazard controls. 417.415 Section 417.415 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL...

  2. Bond strengths of five tapered root posts regarding the post surface

    NARCIS (Netherlands)

    Nergiz, [No Value; Schmage, P; Platzer, U; Ozcan, M

    2002-01-01

    The advantage of tapered passive root posts is their homogenous force transmission without creating stress peaks on the root surface because of their anatomical root form. However, their expected retentive strengths are low compared with the other post systems. The objective of this in vitro study w

  3. Effectiveness of strength training in post stroke

    International Nuclear Information System (INIS)

    The study was done to evaluate the effectiveness of strength training in post stroke. This was an experimental randomized study, conducted at various Physical Therapy OPD setting areas. Sample n = 30; 3 females and 12 males as experimental group and 3 females and 12 males as control group were selected through probability sampling. Mean age of 57 with middle recovery stage of post stroke were included. Different selected strength training exercises were applied on experimental group to assess spasticity, cadence and manual muscle testing. Result was taken by using Mann - Whiteny U test for outcome measures as in cadence, spasticity and manual muscle testing. The result of two outcome measure shows significant result which means the strength training is more effective than the conventional treatment for post stroke of middle recovery stage. (author)

  4. Translucency of Dental Ceramic, Post and Bracket

    Directory of Open Access Journals (Sweden)

    Yong-Keun Lee

    2015-10-01

    Full Text Available Translucency of dental ceramics, esthetic posts and orthodontic brackets was reviewed. Translucency parameter (TP and contrast ratio (CR are generally used for translucency evaluation. For the evaluation of translucency, two criteria such as the translucency of human teeth (TP = 15–19, 1 mm thick and the visual perceptibility threshold for the translucency difference (∆CR > 0.07 or ∆TP > 2 were used. In ceramics, translucency differences were in the perceptible range depending on the type of material and the thickness. However, variations caused by the difference in the required thickness for each layer by the material and also by the measurement protocols should be considered. As to the translucency of esthetic posts, a significant difference was found among the post systems. Translucency was influenced by the bracket composition and brand, and the differences by the brand were visually perceptible.

  5. Post-colonial identity in Greenland?

    DEFF Research Database (Denmark)

    Gad, Ulrik Pram

    2009-01-01

    In the gradual unravelling of Greenland’s colonial relationship to Denmark, an essentialist conceptualization of Greenlandic identity has played a significant role. However, both our scholarly understanding of post-colonial Greenlandic identity and the process towards independence for Greenland...... could be furthered by bringing politics back in. Based on a discourse analysis of the Greenlandic debate on language, this paper makes three claims: First, the identity projects promoted in Greenland are based on an essentialist conception of identity. Secondly, Greenlandic identity discourse combines...... elements of traditional Inuit culture and elements of colonial modernity. Thirdly, monolingual Greenlanders are those with the most to gain from abandoning the dichotomy of essentialist identities. Strategically, the paper suggests a post-post-colonial Greenlandic identity as a means of avoiding...

  6. Adolf Hitler had post-encephalitic Parkinsonism.

    Science.gov (United States)

    Lieberman, A

    1996-04-01

    Adolf Hitler had Parkinson symptoms in 1934, at age 45 years. He may have had transient symptoms in 1923, at age 34 years. Young-onset parkinsonism, during the 1920s, favored a diagnosis of post-encephalitic rather than idiopathic parkinsonism. Hitler had oculogyric crises, phenomena only associated with post-encephalitic parkinsonism. In addition, he had dystonic facial spasms, palilalia and a sleep disorder, phenomena more likely to be associated with post-encephalitic than idiopathic parkinsonism. In November 1918, at age 29 years, Hitler may have had von Economo's encephalitis, while he was a patient in a hospital, recovering from poison gas. This paper looks at the possible relationship of von Economo's encephalitis to Hitler's asocial behavior; his obsessions and compulsions, his cruelty and rages. The influence of Hitler's parkinsonism on his conduct during World War II is discussed.

  7. Equine post-breeding endometritis: A review

    Science.gov (United States)

    2008-01-01

    The deposition of semen, bacteria and debris in the uterus of the mare after breeding normally induces a self-limiting endometritis. The resultant fluid and inflammatory products are cleared by 48 hours post cover. Mares that are susceptible to persistent post-breeding endometritis (PPBEM) have impaired uterine defence and clearance mechanisms, making them unable to resolve this inflammation within the normal time. This persists beyond 48 hours post-breeding and causes persistent fluid accumulation within the uterus. Mares with PPBEM have an increased rate of embryonic loss and a lower overall pregnancy rate than those without the condition. To enhance conception rates, mares at high risk need optimal breeding management as well as early diagnosis, followed by the most appropriate treatment. This article reviews the pathogenesis, diagnosis and treatment of PPBEM and the management of affected mares. PMID:21851709

  8. Equine post-breeding endometritis: A review

    Directory of Open Access Journals (Sweden)

    Maischberger E

    2008-03-01

    Full Text Available Abstract The deposition of semen, bacteria and debris in the uterus of the mare after breeding normally induces a self-limiting endometritis. The resultant fluid and inflammatory products are cleared by 48 hours post cover. Mares that are susceptible to persistent post-breeding endometritis (PPBEM have impaired uterine defence and clearance mechanisms, making them unable to resolve this inflammation within the normal time. This persists beyond 48 hours post-breeding and causes persistent fluid accumulation within the uterus. Mares with PPBEM have an increased rate of embryonic loss and a lower overall pregnancy rate than those without the condition. To enhance conception rates, mares at high risk need optimal breeding management as well as early diagnosis, followed by the most appropriate treatment. This article reviews the pathogenesis, diagnosis and treatment of PPBEM and the management of affected mares.

  9. Insulin sensitivity in post-obese women

    DEFF Research Database (Denmark)

    Toubro, S; Western, P; Bülow, J;

    1994-01-01

    1. Both increased and decreased sensitivity to insulin has been proposed to precede the development of obesity. Therefore, insulin sensitivity was measured during a 2 h hyperinsulinaemia (100 m-units min-1 m-2) euglycaemic (4.5 mmol/l) glucose clamp combined with indirect calorimetry in nine weight......-1 kg-1, not significant). Basal plasma concentrations of free fatty acids were similar, but at the end of the clamp free fatty acids were lower in the post-obese women than in the control women (139 +/- 19 and 276 +/- 48 mumol/l, P = 0.02). 3. We conclude that the insulin sensitivity of glucose...... metabolism is unaltered in the post-obese state. The study, however, points to an increased antilipolytic insulin action in post-obese subjects, which may favour fat storage and lower lipid oxidation rate postprandially.(ABSTRACT TRUNCATED AT 250 WORDS)...

  10. Post-post-Newtonian deflection of light ray in multiple systems with PPN parameters

    Institute of Scientific and Technical Information of China (English)

    Gong Yan-Xiang; Wu Xiao-Mei

    2011-01-01

    The post-Newtonian scheme in multiple systems with post-Newtonian parameters presented by Klioner and Soffel is extended to the post-post-Newtonian (PPN) order for light propagation problem in the solar system. Under considering the solar system experiment requirement, a new parameter e is introduced. This extension does not change the virtue of the scheme on the linear partial differential equations of the potential and vector potential mentioned in previous work. Furthermore, this extension is based on the former work done by Richter and Matzner in one global system theory. As an application, we also consider the deflection of light ray in the global coordinates. And the deflection angle of light ray is obtained with post-Newtonian parameters.

  11. Post-Starburst Quasars: Bridging the Gap Between Post-Starburst Galaxies and Quasars

    CERN Document Server

    Cales, Sabrina L

    2015-01-01

    In order to better understand the nature of post-starburst quasars (PSQs) in the context of galaxy evolution, we compare their properties to those of post-starburst galaxies and quasars from appropriately selected samples possessing similar redshift ($z \\sim 0.3$), luminosity ($M_r \\sim -$23), and data quality. We consider morphologies, spectral features, and derived physical properties of the stellar populations and central supermassive black hole. PSQs themselves come in two types: the more luminous AGNs with more luminous post-starburst stellar populations hosted by elliptical galaxies, some which are clearly merger products, and the less luminous systems existing within relatively undisturbed spiral galaxies and possessing signs of a more extended period of star formation. Post-starburst galaxies (PSQs) have elliptical and disturbed/post-merger morphologies similar to those of the more luminous PSQs, display similar spectral properties, but also can have younger stellar populations for a given starburst m...

  12. Post contract / Project management in Nuclear Malaysia

    International Nuclear Information System (INIS)

    Full-text: Post contract is a period from issuance certificate of practical completion until final statement of account of the project. If this procedure not completed the whole project will at large, create customers un-satisfaction, contractual obligation not complied, record not completed and financial setback. With the usage terms of contract, standard JKR circulars, treasury circulars and JKR quality manual BKJ will produce new Standard operating procedure, SOP with regards to these matters. In doing so it shall increase customer satisfaction and reduce time to finalise project and provide good record system. Keywords: Post contract, certificate of practical completion, final account, customer satisfaction, Standard operating procedure. (author)

  13. Patient expectancy and post-chemotherapy nausea

    DEFF Research Database (Denmark)

    Colagiuri, Ben; Zachariae, Robert

    2010-01-01

    BACKGROUND: Post-chemotherapy nausea remains a significant burden to cancer patients. While some studies indicate that expecting nausea is predictive of experiencing nausea, there are a number of conflicting findings. PURPOSE: The purpose of this study was to conduct a meta-analytic review...... to determine the strength of the relationship between expectancy and post-chemotherapy nausea. METHODS: The findings from 17 relevant studies (n = 2,400) identified through systematic searches of Medline, PsycInfo, and Cinhal were analyzed using a combination of meta-analytic techniques. RESULTS: Overall...

  14. Hanford site post NPH building inspection plan

    Energy Technology Data Exchange (ETDEWEB)

    Wagenblast, G.R., Westinghouse Hanford

    1996-09-12

    This plan establishes consistent post-NPH building inspection procedures and defines a procedure for prioritization of buildings for inspection to ensure the safety of facilities prior to reentry. Qualification of systems for restart of operation is not included. This plan takes advantage, where possible, of existing national procedures for post-NPH inspection of buildings, of existing structural design and evaluation documentation of Hanford facilities, and current and proposed seismic instrumentation located throughout the Hanford site. A list of buildings, prioritized according to current building safety function and building vulnerability (without regard for or information about a damaging natural forces event) is provided.

  15. Post-digital Books and Disruptive Literary Machines

    DEFF Research Database (Denmark)

    Pold, Søren Bro; Andersen, Christian Ulrik

    2014-01-01

    of –and critical reflection on post- or semio-capitalism, and furthermore we will discuss how literature functions in a post-industrial software culture such as the one presented by Apple, Amazon and Google. Keywords: digital literature, Kindle, Apple, Ubermorgen, Korabiewski, post-digital, post...

  16. Split-resonator integrated-post MEMS gyroscope

    Science.gov (United States)

    Bae, Youngsam (Inventor); Hayworth, Ken J. (Inventor); Shcheglov, Kirill V. (Inventor)

    2004-01-01

    A split-resonator integrated-post vibratory microgyroscope may be fabricated using micro electrical mechanical systems (MEMS) fabrication techniques. The microgyroscope may include two gyroscope sections bonded together, each gyroscope section including resonator petals, electrodes, and an integrated half post. The half posts are aligned and bonded to act as a single post.

  17. Whiplash and post-traumatic stress disorder

    NARCIS (Netherlands)

    Jaspers, JPC

    1998-01-01

    Purpose : This study examined the comorbidity of whiplash and post-traumatic stress disorder (PTSD) following motor vehicle accidents. A treatment strategy in cases with both disorders is proposed. Method: A review of the literature on psychological consequences of motor vehicle accidents and on ris

  18. Adolescent Post-Traumatic Stress Disorder

    Science.gov (United States)

    Yule, William

    2003-01-01

    Based on over a decade of work in the area of PTSD, including a longitudinal study of PTSD among adolescents, Dr. Yule provides an introduction to post-traumatic stress disorder as it occurs in youth. This includes a look at the manifestations of stress reactions, the incidence and prevalence of PTSD, and the relationship between levels of…

  19. Multiple Myeloma in Post Nuclear Accident Crisis

    OpenAIRE

    Wiwanitkit, Somsri; Wiwanitkit, Viroj

    2012-01-01

    The problem of 2011 nuclear accident crisis draws attention of physicians and medical scientists around the world. The cancer induction is an important adverse effect of exposure to radionuclide. In this specific article, the multiple myeloma, an important hematological cancer, in the post nuclear accident crisis will be discussed.

  20. Post-Release Success among Paroled Lifers

    Directory of Open Access Journals (Sweden)

    Marieke Liem

    2014-12-01

    Full Text Available Previous research suggests that social relations, in particular the forming of family ties and employment (social factors, self-efficacy (personal factors, and therapeutic interventions (institutional factors constitute main contributors in post-release success. These studies, however, have largely been based on general delinquents serving relatively short prison terms. This study aims to shed light on the influence of social, personal, and institutional factors on post-release success versus failure among paroled lifers. We conducted in-depth life-history interviews with 64 individuals who had served a life sentence, who were either re-incarcerated for another crime or parole violation, or were currently out on parole. The role of social factors in desistance among long-term incarcerated offenders was minimal. Rather, self-efficacy appeared to be a key element in post-release success. These findings suggest that research based on short-term incarcerated offenders cannot be directly translated to long-term incarcerated offenders. This group does not experience the same traditional turning points, such as establishing family ties and employment. Accordingly, long-term prisoners may go through a different process post-release that determines their success versus failure compared to general delinquents who serve shorter sentences.