WorldWideScience

Sample records for bk channel localization

  1. The dystrophin complex controls bk channel localization and muscle activity in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Hongkyun Kim

    2009-12-01

    Full Text Available Genetic defects in the dystrophin-associated protein complex (DAPC are responsible for a variety of pathological conditions including muscular dystrophy, cardiomyopathy, and vasospasm. Conserved DAPC components from humans to Caenorhabditis elegans suggest a similar molecular function. C. elegans DAPC mutants exhibit a unique locomotory deficit resulting from prolonged muscle excitation and contraction. Here we show that the C. elegans DAPC is essential for proper localization of SLO-1, the large conductance, voltage-, and calcium-dependent potassium (BK channel, which conducts a major outward rectifying current in muscle under the normal physiological condition. Through analysis of mutants with the same phenotype as the DAPC mutants, we identified the novel islo-1 gene that encodes a protein with two predicted transmembrane domains. We demonstrate that ISLO-1 acts as a novel adapter molecule that links the DAPC to SLO-1 in muscle. We show that a defect in either the DAPC or ISLO-1 disrupts normal SLO-1 localization in muscle. Consistent with observations that SLO-1 requires a high calcium concentration for full activation, we find that SLO-1 is localized near L-type calcium channels in muscle, thereby providing a mechanism coupling calcium influx with the outward rectifying current. Our results indicate that the DAPC modulates muscle excitability by localizing the SLO-1 channel to calcium-rich regions of C. elegans muscle.

  2. BK Channels in the Vascular System.

    Science.gov (United States)

    Krishnamoorthy-Natarajan, G; Koide, M

    2016-01-01

    Autoregulation of blood flow is essential for the preservation of organ function to ensure continuous supply of oxygen and essential nutrients and removal of metabolic waste. This is achieved by controlling the diameter of muscular arteries and arterioles that exhibit a myogenic response to changes in arterial blood pressure, nerve activity and tissue metabolism. Large-conductance voltage and Ca(2+)-dependent K(+) channels (BK channels), expressed exclusively in smooth muscle cells (SMCs) in the vascular wall of healthy arteries, play a critical role in regulating the myogenic response. Activation of BK channels by intracellular, local, and transient ryanodine receptor-mediated "Ca(2+) sparks," provides a hyperpolarizing influence on the SMC membrane potential thereby decreasing the activity of voltage-dependent Ca(2+) channels and limiting Ca(2+) influx to promote SMC relaxation and vasodilation. The BK channel α subunit, a large tetrameric protein with each monomer consisting of seven-transmembrane domains, a long intracellular C-terminal tail and an extracellular N-terminus, associates with the β1 and γ subunits in vascular SMCs. The BK channel is regulated by factors originating within the SMC or from the endothelium, perivascular nerves and circulating blood, that significantly alter channel gating properties, Ca(2+) sensitivity and expression of the α and/or β1 subunit. The BK channel thus serves as a central receiving dock that relays the effects of the changes in several such concomitant autocrine and paracrine factors and influences cardiovascular health. This chapter describes the primary mechanism of regulation of myogenic response by BK channels and the alterations to this mechanism wrought by different vasoactive mediators. PMID:27238270

  3. BK channel modulators: a comprehensive overview

    DEFF Research Database (Denmark)

    Nardi, Antonio; Olesen, Søren-Peter

    2008-01-01

    and blockers 4) Marketed and/or investigational drugs with BK-modulating side properties and structural analogues 5) Naturally-occurring BK channel openers and structural analogues 6) Synthetic BK channel openers. This review is intended to provide readers with current opinion on the BK channel as a drug......The large Ca(2+)-activated K(+) channel (BK channel) reflects per excellence the dilemma of the molecular target driven drug discovery process. Significant experimental evidence suggests that the BK channels play a pivotal and specific role in many pathophysiological conditions supporting...... the notion that the channel represents an innovative and promising drug target. However, after more than ten years of intense research effort both in academia and industry, scientists have yet to witness the approval of a single BK channel modulator for clinical use. On the contrary, three BK openers...

  4. BK channel activators and their therapeutic perspectives

    DEFF Research Database (Denmark)

    Bentzen, Bo Hjorth; Olesen, Søren-Peter; Rønn, Lars C B;

    2014-01-01

    The large conductance calcium- and voltage-activated K(+) channel (KCa1.1, BK, MaxiK) is ubiquitously expressed in the body, and holds the ability to integrate changes in intracellular calcium and membrane potential. This makes the BK channel an important negative feedback system linking increase...... years. After a short introduction to the structure, function and regulation of BK channels, we review the small organic molecules activating BK channels and how these tool compounds have helped delineate the roles of BK channels in health and disease.......The large conductance calcium- and voltage-activated K(+) channel (KCa1.1, BK, MaxiK) is ubiquitously expressed in the body, and holds the ability to integrate changes in intracellular calcium and membrane potential. This makes the BK channel an important negative feedback system linking increases...... in intracellular calcium to outward hyperpolarizing potassium currents. Consequently, the channel has many important physiological roles including regulation of smooth muscle tone, neurotransmitter release and neuronal excitability. Additionally, cardioprotective roles have been revealed in recent...

  5. BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.

    Science.gov (United States)

    Lai, Michael H; Wu, Yuejin; Gao, Zhan; Anderson, Mark E; Dalziel, Julie E; Meredith, Andrea L

    2014-11-01

    Large-conductance Ca(2+)- and voltage-activated K(+) (BK) channels play prominent roles in shaping muscle and neuronal excitability. In the cardiovascular system, BK channels promote vascular relaxation and protect against ischemic injury. Recently, inhibition of BK channels has been shown to lower heart rate in intact rodents and isolated hearts, suggesting a novel role in heart function. However, the underlying mechanism is unclear. In the present study, we recorded ECGs from mice injected with paxilline (PAX), a membrane-permeable BK channel antagonist, and examined changes in cardiac conduction. ECGs revealed a 19 ± 4% PAX-induced reduction in heart rate in wild-type but not BK channel knockout (Kcnma1(-/-)) mice. The heart rate decrease was associated with slowed cardiac pacing due to elongation of the sinus interval. Action potential firing recorded from isolated sinoatrial node cells (SANCs) was reduced by 55 ± 15% and 28 ± 9% by application of PAX (3 μM) and iberiotoxin (230 nM), respectively. Furthermore, baseline firing rates from Kcnma1(-/-) SANCs were 33% lower than wild-type SANCs. The slowed firing upon BK current inhibition or genetic deletion was due to lengthening of the diastolic depolarization phase of the SANC action potential. Finally, BK channel immunoreactivity and PAX-sensitive currents were identified in SANCs with HCN4 expression and pacemaker current, respectively, and BK channels cloned from SANCs recapitulated similar activation as the PAX-sensitive current. Together, these data localize BK channels to SANCs and demonstrate that loss of BK current decreases SANC automaticity, consistent with slowed sinus pacing after PAX injection in vivo. Furthermore, these findings suggest BK channels are potential therapeutic targets for disorders of heart rate.

  6. Molecular studies of BKCa channels in intracranial arteries

    DEFF Research Database (Denmark)

    Wulf, Helle; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2008-01-01

    expression of the BK(Ca) channel in rat basilar, middle cerebral, and middle meningeal arteries by reverse transcription polymerase chain reaction (RT-PCR), quantitative real-time PCR, and Western blotting. Distribution patterns were investigated using in situ hybridization and immunofluorescence studies. RT-PCR...... and quantitative real-time PCR detected the expression of the BK(Ca) channel mRNA transcript in rat basilar, middle cerebral, and middle meningeal arteries, with the transcript being expressed more abundantly in rat basilar arteries than in middle cerebral and middle meningeal arteries. Western blotting detected...... the BK(Ca) channel protein in rat basilar and middle cerebral arteries. In situ hybridization and immunofluorescence studies confirmed that the BK(Ca) channel mRNA and protein expression was localized to smooth muscle cells in all three intracranial arteries. The data thus suggest the presence...

  7. Developmental expression of BK channels in chick cochlear hair cells

    Directory of Open Access Journals (Sweden)

    Tong Mingjie

    2009-12-01

    Full Text Available Abstract Background Cochlear hair cells are high-frequency sensory receptors. At the onset of hearing, hair cells acquire fast, calcium-activated potassium (BK currents, turning immature spiking cells into functional receptors. In non-mammalian vertebrates, the number and kinetics of BK channels are varied systematically along the frequency-axis of the cochlea giving rise to an intrinsic electrical tuning mechanism. The processes that control the appearance and heterogeneity of hair cell BK currents remain unclear. Results Quantitative PCR results showed a non-monotonic increase in BK α subunit expression throughout embryonic development of the chick auditory organ (i.e. basilar papilla. Expression peaked near embryonic day (E 19 with six times the transcript level of E11 sensory epithelia. The steady increase in gene expression from E11 to E19 could not explain the sudden acquisition of currents at E18-19, implicating post-transcriptional mechanisms. Protein expression also preceded function but progressed in a sequence from diffuse cytoplasmic staining at early ages to punctate membrane-bound clusters at E18. Electrophysiology data confirmed a continued refinement of BK trafficking from E18 to E20, indicating a translocation of BK clusters from supranuclear to subnuclear domains over this critical developmental age. Conclusions Gene products encoding BK α subunits are detected up to 8 days before the acquisition of anti-BK clusters and functional BK currents. Therefore, post-transcriptional mechanisms seem to play a key role in the delayed emergence of calcium-sensitive currents. We suggest that regulation of translation and trafficking of functional α subunits, near voltage-gated calcium channels, leads to functional BK currents at the onset of hearing.

  8. BK channels reveal novel phosphate sensitivity in SNr neurons.

    Directory of Open Access Journals (Sweden)

    Juan Juan Ji

    Full Text Available Whether large conductance Ca(2+-activated potassium (BK channels are present in the substantia nigra pars reticulata (SNr is a matter of debate. Using the patch-clamp technique, we examined the functional expression of BK channels in neurons of the SNr and showed that the channels were activated or inhibited by internal high-energy phosphates (IHEPs at positive and negative membrane potentials, respectively. SNr neurons showed membrane potential hyperpolarization under glucose-deprivation conditions which was attenuated by paxilline, a specific BK channel blocker. In addition, Fluo-3 fluorescence recording detected an increase in the level of internal free calcium ([Ca(2+](i during ischemic hyperpolarization. These results confirm that BK channels are present in SNr neurons and indicate that their unique IHEP sensitivity is requisite in neuronal ischemic responses. Bearing in mind that the K(ATP channel blocker tolbutamide also attenuated the hyperpolarization, we suggest that BK channels may play a protective role in the basal ganglia by modulating the excitability of SNr neurons along with K(ATP channels under ischemic stresses.

  9. Coronary arterial BK channel dysfunction exacerbates ischemia/reperfusion-induced myocardial injury in diabetic mice.

    Science.gov (United States)

    Lu, Tong; Jiang, Bin; Wang, Xiao-Li; Lee, Hon-Chi

    2016-09-01

    The large conductance Ca(2+)-activated K(+) (BK) channels, abundantly expressed in coronary artery smooth muscle cells (SMCs), play a pivotal role in regulating coronary circulation. A large body of evidence indicates that coronary arterial BK channel function is diminished in both type 1 and type 2 diabetes. However, the consequence of coronary BK channel dysfunction in diabetes is not clear. We hypothesized that impaired coronary BK channel function exacerbates myocardial ischemia/reperfusion (I/R) injury in streptozotocin-induced diabetic mice. Combining patch-clamp techniques and cellular biological approaches, we found that diabetes facilitated the colocalization of angiotensin II (Ang II) type 1 receptors and BK channel α-subunits (BK-α), but not BK channel β1-subunits (BK-β1), in the caveolae of coronary SMCs. This caveolar compartmentation in vascular SMCs not only enhanced Ang II-mediated inhibition of BK-α but also produced a physical disassociation between BK-α and BK-β1, leading to increased infarct size in diabetic hearts. Most importantly, genetic ablation of caveolae integrity or pharmacological activation of coronary BK channels protected the cardiac function of diabetic mice from experimental I/R injury in both in vivo and ex vivo preparations. Our results demonstrate a vascular ionic mechanism underlying the poor outcome of myocardial injury in diabetes. Hence, activation of coronary BK channels may serve as a therapeutic target for cardiovascular complications of diabetes. PMID:27574914

  10. Unique Inner Pore Properties of BK Channels Revealed by Quaternary Ammonium Block

    OpenAIRE

    Li, Weiyan; Aldrich, Richard W.

    2004-01-01

    Potassium channels have a very wide distribution of single-channel conductance, with BK type Ca2+-activated K+ channels having by far the largest. Even though crystallographic views of K+ channel pores have become available, the structural basis underlying BK channels' large conductance has not been completely understood. In this study we use intracellularly applied quaternary ammonium compounds to probe the pore of BK channels. We show that molecules as large as decyltriethylammonium (C10) a...

  11. SLO BK Potassium Channels Couple Gap Junctions to Inhibition of Calcium Signaling in Olfactory Neuron Diversification.

    Science.gov (United States)

    Alqadah, Amel; Hsieh, Yi-Wen; Schumacher, Jennifer A; Wang, Xiaohong; Merrill, Sean A; Millington, Grethel; Bayne, Brittany; Jorgensen, Erik M; Chuang, Chiou-Fen

    2016-01-01

    The C. elegans AWC olfactory neuron pair communicates to specify asymmetric subtypes AWCOFF and AWCON in a stochastic manner. Intercellular communication between AWC and other neurons in a transient NSY-5 gap junction network antagonizes voltage-activated calcium channels, UNC-2 (CaV2) and EGL-19 (CaV1), in the AWCON cell, but how calcium signaling is downregulated by NSY-5 is only partly understood. Here, we show that voltage- and calcium-activated SLO BK potassium channels mediate gap junction signaling to inhibit calcium pathways for asymmetric AWC differentiation. Activation of vertebrate SLO-1 channels causes transient membrane hyperpolarization, which makes it an important negative feedback system for calcium entry through voltage-activated calcium channels. Consistent with the physiological roles of SLO-1, our genetic results suggest that slo-1 BK channels act downstream of NSY-5 gap junctions to inhibit calcium channel-mediated signaling in the specification of AWCON. We also show for the first time that slo-2 BK channels are important for AWC asymmetry and act redundantly with slo-1 to inhibit calcium signaling. In addition, nsy-5-dependent asymmetric expression of slo-1 and slo-2 in the AWCON neuron is necessary and sufficient for AWC asymmetry. SLO-1 and SLO-2 localize close to UNC-2 and EGL-19 in AWC, suggesting a role of possible functional coupling between SLO BK channels and voltage-activated calcium channels in AWC asymmetry. Furthermore, slo-1 and slo-2 regulate the localization of synaptic markers, UNC-2 and RAB-3, in AWC neurons to control AWC asymmetry. We also identify the requirement of bkip-1, which encodes a previously identified auxiliary subunit of SLO-1, for slo-1 and slo-2 function in AWC asymmetry. Together, these results provide an unprecedented molecular link between gap junctions and calcium pathways for terminal differentiation of olfactory neurons.

  12. Oxidative Stress and Maxi Calcium-Activated Potassium (BK Channels

    Directory of Open Access Journals (Sweden)

    Anton Hermann

    2015-08-01

    Full Text Available All cells contain ion channels in their outer (plasma and inner (organelle membranes. Ion channels, similar to other proteins, are targets of oxidative impact, which modulates ion fluxes across membranes. Subsequently, these ion currents affect electrical excitability, such as action potential discharge (in neurons, muscle, and receptor cells, alteration of the membrane resting potential, synaptic transmission, hormone secretion, muscle contraction or coordination of the cell cycle. In this chapter we summarize effects of oxidative stress and redox mechanisms on some ion channels, in particular on maxi calcium-activated potassium (BK channels which play an outstanding role in a plethora of physiological and pathophysiological functions in almost all cells and tissues. We first elaborate on some general features of ion channel structure and function and then summarize effects of oxidative alterations of ion channels and their functional consequences.

  13. A role for BK channels in heart rate regulation in rodents.

    Directory of Open Access Journals (Sweden)

    Wendy L Imlach

    Full Text Available The heart generates and propagates action potentials through synchronized activation of ion channels allowing inward Na(+ and Ca(2+ and outward K(+ currents. There are a number of K(+ channel types expressed in the heart that play key roles in regulating the cardiac cycle. Large conductance calcium-activated potassium (BK ion channels are not thought to be directly involved in heart function. Here we present evidence that heart rate can be significantly reduced by inhibiting the activity of BK channels. Agents that specifically inhibit BK channel activity, including paxilline and lolitrem B, slowed heart rate in conscious wild-type mice by 30% and 42%, respectively. Heart rate of BK channel knock-out mice (Kcnma1(-/- was not affected by these BK channel inhibitors, suggesting that the changes to heart rate were specifically mediated through BK channels. The possibility that these effects were mediated through BK channels peripheral to the heart was ruled out with experiments using isolated, perfused rat hearts, which showed a significant reduction in heart rate when treated with the BK channel inhibitors paxilline (1 microM, lolitrem B (1 microM, and iberiotoxin (0.23 microM, of 34%, 60%, and 42%, respectively. Furthermore, paxilline was shown to decrease heart rate in a dose-dependent manner. These results implicate BK channels located in the heart to be directly involved in the regulation of heart rate.

  14. BK channel activation by NS11021 decreases excitability and contractility of urinary bladder smooth muscle

    DEFF Research Database (Denmark)

    Layne, Jeffrey J; Nausch, Bernhard; Olesen, Søren-Peter;

    2009-01-01

    activation of BK channels has the converse effect of reducing UBSM excitability and contractility. Here, we have sought to investigate this possibility by using the novel BK channel opener NS11021. NS11021 (3 microM) caused an approximately threefold increase in both single BK channel open probability (P......Large-conductance Ca(2+)-activated potassium (BK) channels play an important role in regulating the function and activity of urinary bladder smooth muscle (UBSM), and the loss of BK channel function has been shown to increase UBSM excitability and contractility. However, it is not known whether......(o)) and whole cell BK channel currents. The frequency of spontaneous action potentials in UBSM strips was reduced by NS11021 from a control value of 20.9 + or - 5.9 to 10.9 + or - 3.7 per minute. NS11021 also reduced the force of UBSM spontaneous phasic contractions by approximately 50%, and this force...

  15. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis.

    Science.gov (United States)

    Wen, Donghai; Cornelius, Ryan J; Sansom, Steven C

    2014-04-01

    Large conductance, Ca-activated K channels (BK) are abundantly located in cells of vasculature, glomerulus, and distal nephron, where they are involved in maintaining blood volume, blood pressure, and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertension, and compromised K handling. The BK-α/β4 resides in acid/base transporting intercalated cells (IC) of the distal nephron, where they mediate K secretion in mammals on a high K, alkaline diet. BK-α expression in IC is increased by a high K diet via aldosterone. The BK-β4 subunit and alkaline urine are necessary for the luminal expression and function of BK-α in mouse IC. In distal nephron cells, membrane BK-α expression is inhibited by WNK4 in in vitro expression systems, indicating a role in the hyperkalemic phenotype in patients with familial hyperkalemic hypertension type 2 (FHHt2). β1KO and BK-β4 knockout mice (β4KO) are hypertensive because of exaggerated epithelial Na channels (ENaC) mediated Na retention in an effort to secrete K via only renal outer medullary K channels (ROMK). BK hypertension is resistant to thiazides and furosemide, and would be more amenable to ENaC and aldosterone inhibiting drugs. Activators of BK-α/β1 or BK-α/β4 might be effective blood pressure lowering agents for a subset of hypertensive patients. Inhibitors of renal BK would effectively spare K in patients with Bartter Syndrome, a renal K wasting disease. PMID:24721651

  16. Cochlear function in mice lacking the BK channel alpha, beta1, or beta4 subunits

    NARCIS (Netherlands)

    Pyott, Sonja J; Meredith, Andrea L; Fodor, Anthony A; Vázquez, Ana E; Yamoah, Ebenezer N; Aldrich, Richard W

    2007-01-01

    Large conductance voltage- and calcium-activated potassium (BK) channels are important for regulating many essential cellular functions, from neuronal action potential shape and firing rate to smooth muscle contractility. In amphibians, reptiles, and birds, BK channels mediate the intrinsic frequenc

  17. BK channels regulate spontaneous action potential rhythmicity in the suprachiasmatic nucleus.

    Directory of Open Access Journals (Sweden)

    Jack Kent

    Full Text Available BACKGROUND: Circadian ( approximately 24 hr rhythms are generated by the central pacemaker localized to the suprachiasmatic nucleus (SCN of the hypothalamus. Although the basis for intrinsic rhythmicity is generally understood to rely on transcription factors encoded by "clock genes", less is known about the daily regulation of SCN neuronal activity patterns that communicate a circadian time signal to downstream behaviors and physiological systems. Action potentials in the SCN are necessary for the circadian timing of behavior, and individual SCN neurons modulate their spontaneous firing rate (SFR over the daily cycle, suggesting that the circadian patterning of neuronal activity is necessary for normal behavioral rhythm expression. The BK K(+ channel plays an important role in suppressing spontaneous firing at night in SCN neurons. Deletion of the Kcnma1 gene, encoding the BK channel, causes degradation of circadian behavioral and physiological rhythms. METHODOLOGY/PRINCIPAL FINDINGS: To test the hypothesis that loss of robust behavioral rhythmicity in Kcnma1(-/- mice is due to the disruption of SFR rhythms in the SCN, we used multi-electrode arrays to record extracellular action potentials from acute wild-type (WT and Kcnma1(-/- slices. Patterns of activity in the SCN were tracked simultaneously for up to 3 days, and the phase, period, and synchronization of SFR rhythms were examined. Loss of BK channels increased arrhythmicity but also altered the amplitude and period of rhythmic activity. Unexpectedly, Kcnma1(-/- SCNs showed increased variability in the timing of the daily SFR peak. CONCLUSIONS/SIGNIFICANCE: These results suggest that BK channels regulate multiple aspects of the circadian patterning of neuronal activity in the SCN. In addition, these data illustrate the characteristics of a disrupted SCN rhythm downstream of clock gene-mediated timekeeping and its relationship to behavioral rhythms.

  18. Closed state-coupled C-type inactivation in BK channels.

    Science.gov (United States)

    Yan, Jiusheng; Li, Qin; Aldrich, Richard W

    2016-06-21

    Ion channels regulate ion flow by opening and closing their pore gates. K(+) channels commonly possess two pore gates, one at the intracellular end for fast channel activation/deactivation and the other at the selectivity filter for slow C-type inactivation/recovery. The large-conductance calcium-activated potassium (BK) channel lacks a classic intracellular bundle-crossing activation gate and normally show no C-type inactivation. We hypothesized that the BK channel's activation gate may spatially overlap or coexist with the C-type inactivation gate at or near the selectivity filter. We induced C-type inactivation in BK channels and studied the relationship between activation/deactivation and C-type inactivation/recovery. We observed prominent slow C-type inactivation/recovery in BK channels by an extreme low concentration of extracellular K(+) together with a Y294E/K/Q/S or Y279F mutation whose equivalent in Shaker channels (T449E/K/D/Q/S or W434F) caused a greatly accelerated rate of C-type inactivation or constitutive C-inactivation. C-type inactivation in most K(+) channels occurs upon sustained membrane depolarization or channel opening and then recovers during hyperpolarized membrane potentials or channel closure. However, we found that the BK channel C-type inactivation occurred during hyperpolarized membrane potentials or with decreased intracellular calcium ([Ca(2+)]i) and recovered with depolarized membrane potentials or elevated [Ca(2+)]i Constitutively open mutation prevented BK channels from C-type inactivation. We concluded that BK channel C-type inactivation is closed state-dependent and that its extents and rates inversely correlate with channel-open probability. Because C-type inactivation can involve multiple conformational changes at the selectivity filter, we propose that the BK channel's normal closing may represent an early conformational stage of C-type inactivation.

  19. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis

    Science.gov (United States)

    Wen, Donghai; Cornelius, Ryan J.; Sansom, Steven C.

    2014-01-01

    Large conductance, Ca-activated K channels are abundantly located in cells of vasculature, glomerulus and distal nephron, where they are involved in maintaining blood volume, blood pressure and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertension, and compromised K handling. The BK-α/β4resides in acid/base transporting intercalated cells (IC) of the distal nephron, where they mediate K secretion in mammals on a high K, alkaline diet. BK-α expression in IC is increased by a high K diet via aldosterone. The BK-β4 subunit and alkaline urine are necessary for the luminal expression and function of BK-α in mouse IC. In distal nephron cells, membrane BK-α expression is inhibited by WNK4 in in vitro expression systems, indicating a role in the hyperkalemic phenotype in patients with familial hyperkalemic hypertension type 2 (FHHt2). β1KO and BK-β4 knockout mice (β4KO) are hypertensive because of exaggerated ENaC-mediated Na retention in an effort to secrete K via only ROMK. BK hypertension is resistant to thiazides and furosemide, and would be more amenable to ENaC and aldosterone inhibiting drugs. Activators of BK-α/β1 or BK-α/β4 might be effective blood pressure lowering agents for a subset of hypertensive patients. Inhibitors of renal BK would effectively spare K in patients with Bartter Syndrome, a renal K wasting disease. PMID:24721651

  20. The Impact of BK Channels on Cellular Excitability Depends on their Subcellular Location

    Science.gov (United States)

    Bock, Tobias; Stuart, Greg J.

    2016-01-01

    Large conductance calcium-activated potassium channels (or BK channels) fulfil a multitude of roles in the central nervous system. At the soma of many neuronal cell types they control the speed of action potential (AP) repolarization and therefore they can have an impact on neuronal excitability. Due to their presence in nerve terminals they also regulate transmitter release. BK channels have also been shown to be present in the dendrites of some neurons where they can regulate the magnitude and duration of dendritic spikes. Here, we investigate the impact of modulating the activation of BK channels at different locations on the cellular excitability of cortical layer 5 pyramidal neurons. We find that while somatic BK channels help to repolarize APs at the soma and mediate the fast after-hyperpolarization, dendritic BK channels are responsible for repolarization of dendritic calcium spikes and thereby regulate somatic AP burst firing. We found no evidence for a role of dendritic BK channels in the regulation of backpropagating AP amplitude or duration. These experiments highlight the diverse roles of BK channels in regulating neuronal excitability and indicate that their functional impact depends on their subcellular location.

  1. Interacting influence of diuretics and diet on BK channel-regulated K homeostasis

    OpenAIRE

    Wen, Donghai; Cornelius, Ryan J.; Sansom, Steven C.

    2013-01-01

    Large conductance, Ca-activated K channels are abundantly located in cells of vasculature, glomerulus and distal nephron, where they are involved in maintaining blood volume, blood pressure and K homeostasis. In mesangial cells and smooth muscle cells of vessels, the BK-α pore associates with BK-β1 subunits and regulates contraction in a Ca-mediated feedback manner. The BK-β1 also resides in connecting tubule cells of the nephron. BK-β1 knockout mice (β1KO) exhibit fluid retention, hypertensi...

  2. Neuronal fast activating and meningeal silent modulatory BK channel splice variants cloned from rat

    DEFF Research Database (Denmark)

    Poulsen, Asser Nyander; Jansen-Olesen, Inger; Olesen, Jes;

    2011-01-01

    The big conductance calcium-activated K(+) channel (BK) is involved in regulating neuron and smooth muscle cell excitability. Functional diversity of BK is generated by alpha-subunit splice variation and co-expression with beta subunits. Here, we present six different splice combinations cloned...... from rat brain or cerebral vascular/meningeal tissues, of which at least three variants were previously uncharacterized (X1, X2(92), and X2(188)). An additional variant was identified by polymerase chain reaction but not cloned. Expression in Xenopus oocytes showed that the brain-specific X1 variant...... for a subpopulation of BK channels in the brain, while the "silent" truncated variants X2(92) and X2(188) may play a role as modulators of other BK channel variants in a way similar to well known beta subunits....

  3. Adrenaline-induced colonic K+ secretion is mediated by KCa1.1 (BK) channels

    DEFF Research Database (Denmark)

    Sørensen, Mads Vaarby; Sausbier, Matthias; Ruth, Peter;

    2010-01-01

    secretory K(+) channel in the apical membrane of the murine distal colon. The BK channel is responsible for both resting and Ca(2+)-activated colonic K(+) secretion and is up-regulated by aldosterone. Agonists (e.g. adrenaline) that elevate cAMP are potent activators of distal colonic K(+) secretion....... However, the secretory K(+) channel responsible for cAMP-induced K(+) secretion remains to be defined. In this study we used the Ussing chamber to identify adrenaline-induced electrogenic K(+) secretion. We found that the adrenaline-induced electrogenic ion secretion is a compound effect dominated...... by anion secretion and a smaller electrically opposing K(+) secretion. Using tissue from (i) BK wildtype (BK(+/+)) and knockout (BK(/)) and (ii) cystic fibrosis transmembrane regulator (CFTR) wildtype (CFTR(+/+)) and knockout (CFTR(/)) mice we were able to isolate the adrenaline-induced K(+) secretion. We...

  4. Tuning the mechanosensitivity of a BK channel by changing the linker length

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Some large-conductance Ca2+ and voltage-activated K+ (BK) channels are activated by membrane stretch. However, the mechanism of mechano-gating of the BK channels is still not well understood. Previous studies have led to the proposal that the tinker-gating ring complex functions as a passive spring, transducing the force generated by intraceilular Ca2+ to the gate to open the channel. This raises the question as to whether membrane stretch is also transmitted to the gate of mechanosensitive (MS) BK channels via the tinker-gating complex. To study this, we changed the linker length in the stretch-activated BK channel (SAKCaC), and examined the effect of membrane stretch on the gating of the resultant mutant channels. Shortening the tinker increased, whereas extending the tinker reduced, the channel mechanosensitivity both in the presence and in the absence of intracellular Ca2+. However, the voltage and Ca2+ sensitivities were not significantly altered by membrane stretch. Furthermore, the SAKCaC became less sensitive to membrane stretch at relatively high intracellular Ca2+ concentrations or membrane depolarization. These observations suggest that once the channel is in the open-state conformation, tension on the spring is partially released and membrane stretch is less effective. Our results are consistent with the idea that membrane stretch is transferred to the gate via the tinker-gating ring complex of the MS BK channels.

  5. Ca(2+)-BK channel clusters in olfactory receptor neurons and their role in odour coding.

    Science.gov (United States)

    Bao, Guobin; de Jong, Daniëlle; Alevra, Mihai; Schild, Detlev

    2015-12-01

    Olfactory receptor neurons (ORNs) have high-voltage-gated Ca(2+) channels whose physiological impact has remained enigmatic since the voltage-gated conductances in this cell type were first described in the 1980s. Here we show that in ORN somata of Xenopus laevis tadpoles these channels are clustered and co-expressed with large-conductance potassium (BK) channels. We found approximately five clusters per ORN and twelve Ca(2+) channels per cluster. The action potential-triggered activation of BK channels accelerates the repolarization of action potentials and shortens interspike intervals during odour responses. This increases the sensitivity of individual ORNs to odorants. At the level of mitral cells of the olfactory bulb, odour qualities have been shown to be coded by first-spike-latency patterns. The system of Ca(2+) and BK channels in ORNs appears to be important for correct odour coding because the blockage of BK channels not only affects ORN spiking patterns but also changes the latency pattern representation of odours in the olfactory bulb.

  6. Airway Hydration, Apical K(+) Secretion, and the Large-Conductance, Ca(2+)-activated and Voltage-dependent Potassium (BK) Channel.

    Science.gov (United States)

    Kis, Adrian; Krick, Stefanie; Baumlin, Nathalie; Salathe, Matthias

    2016-04-01

    Large-conductance, calcium-activated, and voltage-gated K(+) (BK) channels are expressed in many tissues of the human body, where they play important roles in signaling not only in excitable but also in nonexcitable cells. Because BK channel properties are rendered in part by their association with four β and four γ subunits, their channel function can differ drastically, depending on in which cellular system they are expressed. Recent studies verify the importance of apically expressed BK channels for airway surface liquid homeostasis and therefore of their significant role in mucociliary clearance. Here, we review evidence that inflammatory cytokines, which contribute to airway diseases, can lead to reduced BK activity via a functional down-regulation of the γ regulatory subunit LRRC26. Therefore, manipulation of LRRC26 and pharmacological opening of BK channels represent two novel concepts of targeting epithelial dysfunction in inflammatory airway diseases. PMID:27115952

  7. Renovascular BK(Ca) channels are not activated in vivo under resting conditions and during agonist stimulation

    DEFF Research Database (Denmark)

    Magnusson, Linda; Sørensen, Charlotte Mehlin; Braunstein, Thomas Hartig;

    2006-01-01

    of renal vascular BK(Ca) channels by cAMP was investigated by infusing forskolin. Renal blood flow (RBF) was measured in vivo using electromagnetic flowmetry or ultrasonic Doppler. Renal preinfusion of tetraethylammonium (TEA; 3.0 mumol/min) caused a small reduction of baseline RBF, but iberiotoxin (IBT; 0......, but it attenuated the response to ANG II. Coadministration of NS-1619 with TEA or IBT abolished this effect. Forskolin caused renal vasodilation that was not inhibited by IBT. The presence of BK(Ca) channels in the preglomerular vessels was confirmed by immunohistochemistry. Despite their presence......, there is no indication for a major role for BK(Ca) channels in the control of basal renal tone in vivo. Furthermore, BK(Ca) channels do not have a buffering effect on the rat renal vascular responses to ANG II and NE. The fact that NS-1619 attenuates the ANG II response indicates that the renal vascular BK(Ca) channels...

  8. Localization of Ca2+ -activated big-conductance K+ channels in rabbit distal colon

    DEFF Research Database (Denmark)

    Hay-Schmidt, Anders; Grunnet, Morten; Abrahamse, Salomon L;

    2003-01-01

    Big-conductance Ca(2+)-activated K(+) channels (BK channels) may play an important role in the regulation of epithelial salt and water transport, but little is known about the expression level and the precise localization of BK channels in epithelia. The aim of the present study was to quantify...

  9. BK channel β1 and β4 auxiliary subunits exert opposite influences on escalated ethanol drinking in dependent mice.

    Science.gov (United States)

    Kreifeldt, Max; Le, David; Treistman, Steven N; Koob, George F; Contet, Candice

    2013-01-01

    Large conductance calcium-activated potassium (BK) channels play a key role in the control of neuronal activity. Ethanol is a potent activator of BK channel gating, but how this action may impact ethanol drinking still remains poorly understood. Auxiliary β subunits are known to modulate ethanol-induced potentiation of BK currents. In the present study, we investigated whether BK β1 and β4 subunits influence voluntary ethanol consumption using knockout (KO) mice. In a first experiment, mice were first subjected to continuous two-bottle choice (2BC) and were then switched to intermittent 2BC, which progressively increased ethanol intake as previously described in wildtype mice. BK β1 or β4 subunit deficiency did not affect ethanol self-administration under either schedule of access. In a second experiment, mice were first trained to drink ethanol in a limited-access 2BC paradigm. BK β1 or β4 deletion did not affect baseline consumption. Weeks of 2BC were then alternated with weeks of chronic intermittent ethanol (CIE) or air inhalation. As expected, a gradual escalation of ethanol drinking was observed in dependent wildtype mice, while intake remained stable in non-dependent wildtype mice. However, CIE exposure only produced a mild augmentation of ethanol consumption in BK β4 KO mice. Conversely, ethanol drinking increased after fewer CIE cycles in BK β1 KO mice than in wildtype mice. In conclusion, BK β1 or β4 did not influence voluntary ethanol drinking in non-dependent mice, regardless of the pattern of access to ethanol. However, deletion of BK β4 attenuated, while deletion of BK β1 accelerated, the escalation of ethanol drinking during withdrawal from CIE. Our data suggest that BK β1 and β4 subunits have an opposite influence on the negative reinforcing properties of ethanol withdrawal. Modulating the expression, distribution or interactions of BK channel auxiliary subunits may therefore represent a novel avenue for the treatment of alcoholism

  10. BK channel β1 and β4 auxiliary subunits exert opposite influences on escalated ethanol drinking in dependent mice

    Directory of Open Access Journals (Sweden)

    Max eKreifeldt

    2013-12-01

    Full Text Available Large conductance calcium-activated potassium (BK channels play a key role in the control of neuronal activity. Ethanol is a potent activator of BK channel gating, but how this action may impact ethanol drinking still remains poorly understood. Auxiliary β subunits are known to modulate ethanol-induced potentiation of BK currents. In the present study, we investigated whether BK β1 and β4 subunits influence voluntary ethanol consumption using knockout mice. In a first experiment, mice were first subjected to continuous two-bottle choice (2BC and were then switched to intermittent 2BC, which progressively increased ethanol intake as previously described in wildtype mice. BK β1 or β4 subunit deficiency did not affect ethanol self-administration under either schedule of access. In a second experiment, mice were first trained to drink ethanol in a limited-access 2BC paradigm. BK β1 or β4 deletion did not affect baseline consumption. Weeks of 2BC were then alternated with weeks of chronic intermittent ethanol (CIE or air inhalation. As expected, a gradual escalation of ethanol drinking was observed in dependent wildtype mice, while intake remained stable in non-dependent wildtype mice. However, CIE exposure only produced a mild augmentation of ethanol consumption in BK β4 knockout mice. Conversely, ethanol drinking increased after fewer CIE cycles in BK β1 knockout mice than in wildtype mice. In conclusion, BK β1 or β4 did not influence voluntary ethanol drinking in non-dependent mice, regardless of the pattern of access to ethanol. However, deletion of BK β4 attenuated, while deletion of BK β1 accelerated, the escalation of ethanol drinking during withdrawal from CIE. Our data suggest that BK β1 and β4 subunits have an opposite influence on the negative reinforcing properties of ethanol withdrawal. Modulating the expression, distribution or interactions of BK channel auxiliary subunits may therefore represent a novel avenue for the

  11. Putative calcium-binding domains of the Caenorhabditis elegans BK channel are dispensable for intoxication and ethanol activation.

    Science.gov (United States)

    Davis, S J; Scott, L L; Ordemann, G; Philpo, A; Cohn, J; Pierce-Shimomura, J T

    2015-07-01

    Alcohol modulates the highly conserved, voltage- and calcium-activated potassium (BK) channel, which contributes to alcohol-mediated behaviors in species from worms to humans. Previous studies have shown that the calcium-sensitive domains, RCK1 and the Ca(2+) bowl, are required for ethanol activation of the mammalian BK channel in vitro. In the nematode Caenorhabditis elegans, ethanol activates the BK channel in vivo, and deletion of the worm BK channel, SLO-1, confers strong resistance to intoxication. To determine if the conserved RCK1 and calcium bowl domains were also critical for intoxication and basal BK channel-dependent behaviors in C. elegans, we generated transgenic worms that express mutated SLO-1 channels predicted to have the RCK1, Ca(2+) bowl or both domains rendered insensitive to calcium. As expected, mutating these domains inhibited basal function of SLO-1 in vivo as neck and body curvature of these mutants mimicked that of the BK null mutant. Unexpectedly, however, mutating these domains singly or together in SLO-1 had no effect on intoxication in C. elegans. Consistent with these behavioral results, we found that ethanol activated the SLO-1 channel in vitro with or without these domains. By contrast, in agreement with previous in vitro findings, C. elegans harboring a human BK channel with mutated calcium-sensing domains displayed resistance to intoxication. Thus, for the worm SLO-1 channel, the putative calcium-sensitive domains are critical for basal in vivo function but unnecessary for in vivo ethanol action.

  12. Bimane fluorescence scanning suggests secondary structure near the S3-S4 linker of BK channels.

    Science.gov (United States)

    Semenova, Nina P; Abarca-Heidemann, Karin; Loranc, Eva; Rothberg, Brad S

    2009-04-17

    Gating of large conductance Ca(2+)-activated K(+) channels (BK or maxi-K channels) is controlled by a Ca(2+)-sensor, formed by the channel cytoplasmic C-terminal domain, and a voltage sensor, formed by its S0-S4 transmembrane helices. Here we analyze structural properties of a portion of the BK channel voltage sensing domain, the S3-S4 linker, using fluorescence lifetime spectroscopy. Single residues in the S3-S4 linker region were substituted with cysteine, and the cysteine-substituted mutants were expressed in CHO cells and covalently labeled with the sulfhydryl-reactive fluorophore monobromo-trimethylammonio-bimane (qBBr). qBBr fluorescence is quenched by tryptophan and, to a lesser extent, tyrosine side chains. We found that qBBr fluorescence in several of the labeled cysteine-substituted channels shows position-specific quenching, as indicated by increase of the brief lifetime component of the qBBr fluorescence decay. Quenching was reduced with the mutation W203F (in the S4 segment), suggesting that Trp-203 acts as a quenching group. Our results suggest a working hypothesis for the secondary structure of the BK channel S3-S4 region, and places residues Leu-204, Gly-205, and Leu-206 within the extracellular end of the S4 helix.

  13. A non-cardiomyocyte autonomous mechanism of cardioprotection involving the SLO1 BK channel

    Directory of Open Access Journals (Sweden)

    Andrew P. Wojtovich

    2013-03-01

    Full Text Available Opening of BK-type Ca2+ activated K+ channels protects the heart against ischemia-reperfusion (IR injury. However, the location of BK channels responsible for cardioprotection is debated. Herein we confirmed that openers of the SLO1 BK channel, NS1619 and NS11021, were protective in a mouse perfused heart model of IR injury. As anticipated, deletion of the Slo1 gene blocked this protection. However, in an isolated cardiomyocyte model of IR injury, protection by NS1619 and NS11021 was insensitive to Slo1 deletion. These data suggest that protection in intact hearts occurs by a non-cardiomyocyte autonomous, SLO1-dependent, mechanism. In this regard, an in-situ assay of intrinsic cardiac neuronal function (tachycardic response to nicotine revealed that NS1619 preserved cardiac neurons following IR injury. Furthermore, blockade of synaptic transmission by hexamethonium suppressed cardioprotection by NS1619 in intact hearts. These results suggest that opening SLO1 protects the heart during IR injury, via a mechanism that involves intrinsic cardiac neurons. Cardiac neuronal ion channels may be useful therapeutic targets for eliciting cardioprotection.

  14. NS19504: a novel BK channel activator with relaxing effect on bladder smooth muscle spontaneous phasic contractions.

    Science.gov (United States)

    Nausch, Bernhard; Rode, Frederik; Jørgensen, Susanne; Nardi, Antonio; Korsgaard, Mads P G; Hougaard, Charlotte; Bonev, Adrian D; Brown, William D; Dyhring, Tino; Strøbæk, Dorte; Olesen, Søren-Peter; Christophersen, Palle; Grunnet, Morten; Nelson, Mark T; Rønn, Lars C B

    2014-09-01

    Large-conductance Ca(2+)-activated K(+) channels (BK, KCa1.1, MaxiK) are important regulators of urinary bladder function and may be an attractive therapeutic target in bladder disorders. In this study, we established a high-throughput fluorometric imaging plate reader-based screening assay for BK channel activators and identified a small-molecule positive modulator, NS19504 (5-[(4-bromophenyl)methyl]-1,3-thiazol-2-amine), which activated the BK channel with an EC50 value of 11.0 ± 1.4 µM. Hit validation was performed using high-throughput electrophysiology (QPatch), and further characterization was achieved in manual whole-cell and inside-out patch-clamp studies in human embryonic kidney 293 cells expressing hBK channels: NS19504 caused distinct activation from a concentration of 0.3 and 10 µM NS19504 left-shifted the voltage activation curve by 60 mV. Furthermore, whole-cell recording showed that NS19504 activated BK channels in native smooth muscle cells from guinea pig urinary bladder. In guinea pig urinary bladder strips, NS19504 (1 µM) reduced spontaneous phasic contractions, an effect that was significantly inhibited by the specific BK channel blocker iberiotoxin. In contrast, NS19504 (1 µM) only modestly inhibited nerve-evoked contractions and had no effect on contractions induced by a high K(+) concentration consistent with a K(+) channel-mediated action. Collectively, these results show that NS19504 is a positive modulator of BK channels and provide support for the role of BK channels in urinary bladder function. The pharmacologic profile of NS19504 indicates that this compound may have the potential to reduce nonvoiding contractions associated with spontaneous bladder overactivity while having a minimal effect on normal voiding.

  15. Similar enhancement of BK(Ca) channel function despite different aerobic exercise frequency in aging cerebrovascular myocytes.

    Science.gov (United States)

    Li, N; Liu, B; Xiang, S; Shi, L

    2016-07-18

    Aerobic exercise showed beneficial influence on cardiovascular systems in aging, and mechanisms underlying vascular adaption remain unclear. Large-conductance Ca(2+)-activated K(+) (BK(Ca)) channels play critical roles in regulating cellular excitability and vascular tone. This study determined the effects of aerobic exercise on aging-associated functional changes in BK(Ca) channels in cerebrovascular myocytes, Male Wistar rats aged 20-22 months were randomly assigned to sedentary (O-SED), low training frequency (O-EXL), and high training frequency group (O-EXH). Young rats were used as control. Compared to young rats, whole-cell BK(Ca) current was decreased, and amplitude of spontaneous transient outward currents were reduced. The open probability and Ca(2+)/voltage sensitivity of single BK(Ca) channel were declined in O-SED, accompanied with a reduction of tamoxifen-induced BK(Ca) activation; the mean open time of BK(Ca) channels was shortened whereas close time was prolonged. Aerobic exercise training markedly alleviated the aging-associated decline independent of training frequency. Exercise three times rather than five times weekly may be a time and cost-saving training volume required to offer beneficial effects to offset the functional declines of BK(Ca) during aging. PMID:27070745

  16. Ca2+- and voltage-gated potassium (BK) channel activators in the 5β-cholanic acid-3α-ol analogue series with modifications in lateral chain

    OpenAIRE

    Bukiya, Anna N.; Patil, Shivaputra; Li, Wei; Miller, Duane; Dopico, Alex M.

    2012-01-01

    Large conductance, calcium- and voltage-gated potassium (BK) channels regulate various physiological processes and represent an attractive target for drug discovery. Numerous BK channel activators are available. However, these agents usually interact with the ubiquitously distributed channel-forming subunit and thus cannot selectively target a particular tissue. Here, we performed structure-activity relationship study of lithocholic acid (LCA), a cholane that activates BK channels via the acc...

  17. Expression of BK Ca channels and the modulatory beta-subunits in the rat and porcine trigeminal ganglion

    DEFF Research Database (Denmark)

    Johansson, Helle Wulf; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways and the c......Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways...... and the cerebral arteries. We hypothesize that BK(Ca) channel alpha- and beta-subunits are present in the rat and porcine trigeminal ganglion (TG) thus enabling a role in migraine. BK(Ca) channel mRNA was detected using reverse transcription polymerase chain reaction (RT-PCR) and in situ hybridization. BK(Ca...... revealed beta2- and beta 4-subunit proteins in rat and porcine TG. The present study showed BK(Ca) channel expression in rat and porcine TG. The main modulatory beta-subunits detected in TG of both species were beta2- and beta 4-subunits....

  18. Phosphorylation of BK channels modulates the sensitivity to hydrogen sulfide (H2S

    Directory of Open Access Journals (Sweden)

    Guzel F. Sitdikova

    2014-11-01

    Full Text Available Introduction: Gases, such as nitric oxide (NO, carbon monoxide (CO or hydrogen sulfide (H2S, termed gasotransmitters, play an increasingly important role in understanding of how electrical signaling of cells is modulated. H2S is well known to act on various ion channels and receptors. In a previous study we reported that H2S increased calcium-activated potassium (BK channel activity. Aims: The goal of the present study is to investigate the modulatory effect of BK channel phosphorylation on the action of H2S on the channel as well as to recalculate and determine the H2S concentrations in aqueous sodium hydrogen sulfide (NaHS solutions.Methods: Single channel recordings of GH3, GH4 and GH4 STREX cells were used to analyze channel open probability, amplitude and open dwell times. H2S was measured with ananion selective electrode. Results: The concentration of H2S produced from NaHS was recalculated taking pH, temperature salinity of the perfusate and evaporation of H2S into account. The results indicate that from a concentration of 300 µM NaHS, only11-13%, i.e. 34-41 µM is effective as H2S in solution. GH3, GH4 and GH4 STREX cells respond differently to phosphorylation. BK channel open probability (Po of all cells lines used was increased by H2S in ATP containing solutions. PKA prevented the action of H2S on channel Po in GH4 and GH4 STREX, but not in GH3 cells. H2S, high significantly increased Po of all PKG pretreated cells. In the presence of PKC, which lowers channel activity, H2S increased channel Po of GH4 and GH4 STREX, but not those of GH3 cells. H2S increased open dwell times of GH3 cells in the absence of ATP significantly. A significant increase of dwell times with H2S was also observed in the presence of okadaic acid.Conclusions: Our results suggest that phosphorylation by PKG primes the channels for H2S activation and indicate that channel phosphorylation plays an important role in the response to H2S.

  19. Functional coupling of TRPV4 channels and BK channels in regulating spontaneous contractions of the guinea pig urinary bladder.

    Science.gov (United States)

    Isogai, Ayu; Lee, Ken; Mitsui, Retsu; Hashitani, Hikaru

    2016-09-01

    We investigated the role of TRPV4 channels (TRPV4) in regulating the contractility of detrusor smooth muscle (DSM) and muscularis mucosae (MM) of the urinary bladder. Distribution of TRPV4 in DSM and MM of guinea-pig bladders was examined by fluorescence immunohistochemistry. Changes in the contractility of DSM and MM bundles were measured using isometric tension recording. Intracellular Ca(2+) dynamics were visualized by Cal-520 fluorescent Ca(2+) imaging, while membrane potential changes were recorded using intracellular microelectrode technique. DSM and MM expressed TRPV4 immunoreactivity. GSK1016790A (GSK, 1 nM), a TRPV4 agonist, evoked a sustained contraction in both DSM and MM associated with a cessation of spontaneous phasic contractions in a manner sensitive to HC-067047 (10 μM), a TRPV4 antagonist. Iberiotoxin (100 nM) and paxilline (1 μM), large conductance Ca(2+)-activated K(+) (BK) channel blockers restored the spontaneous contractions in GSK. The sustained contractions in DSM and MM were reduced by nifedipine (10 μM), a blocker of L-type voltage-dependent Ca(2+) channels (LVDCCs) by about 40 % and by nominally Ca(2+)-free solution by some 90 %. GSK (1 nM) abolished spontaneous Ca(2+) transients, increased basal Ca(2+) levels and also prevented spontaneous action potential discharge associated with DSM membrane hyperpolarization. In conclusion, Ca(2+) influx through TRPV4 appears to activate BK channels to suppress spontaneous contractions and thus a functional coupling of TRPV4 with BK channels may act as a self-limiting mechanism for bladder contractility during its storage phase. Despite the membrane hyperpolarization in GSK, Ca(2+) entry mainly through TRPV4 develops the tonic contraction. PMID:27497848

  20. Ethanol modulation of mammalian BK channels in excitable tissues: molecular targets and their possible contribution to alcohol-induced altered behavior

    Directory of Open Access Journals (Sweden)

    Alex M. Dopico

    2014-12-01

    Full Text Available In most tissues, the function of calcium- and voltage-gated potassium (BK channels is modified in response to ethanol concentrations reached in human blood during alcohol intoxication. In general, modification of BK current from ethanol-naïve preparations in response to brief ethanol exposure results from changes in channel open probability without modification of unitary conductance or change in BK protein levels in the membrane. Protracted and/or repeated ethanol exposure, however, may evoke changes in BK expression. The final ethanol effect on BK open probability leading to either BK current potentiation or BK current reduction is determined by an orchestration of molecular factors, including levels of activating ligand (cytosolic calcium, BK subunit composition and posttranslational modifications, and the channel’s lipid microenvironment. These factors seem to allosterically regulate a direct interaction between ethanol and a recognition pocket of discrete dimensions recently mapped to the channel-forming (slo1 subunit. Type of ethanol exposure also plays a role in the final BK response to the drug: in several central nervous system regions (e.g., striatum, primary sensory neurons, and supraoptic nucleus, acute exposure to ethanol reduces neuronal excitability by enhancing BK activity. In contrast, protracted or repetitive ethanol administration may alter BK subunit composition and membrane expression, rendering the BK complex insensitive to further ethanol exposure. In neurohypophysial axon terminals, ethanol potentiation of BK channel activity leads to a reduction in neuropeptide release. In vascular smooth muscle, however, ethanol inhibition of BK current leads to cell contraction and vascular constriction.

  1. Molecular investigations of BK(Ca) channels and the modulatory beta-subunits in porcine basilar and middle cerebral arteries

    DEFF Research Database (Denmark)

    Johansson, Helle Wulf; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    arteries using reverse transcription polymerase chain reaction (RT-PCR) and quantitative real-time PCR. Western blotting was used to detect immunoreactivity for the porcine BK(Ca) channel alpha-subunit and beta-subunit proteins. The BK(Ca) channel alpha-subunit RNA and protein distribution patterns were...... visualized using in situ hybridization and immunofluorescence studies, respectively. The study verified that the BK(Ca) channel alpha-subunit is located to smooth muscle cells of porcine basilar and middle cerebral arteries. The mRNA transcript for beta1-, beta2- and beta4-subunit were shown by RT-PCR...... in porcine basilar and middle cerebral arteries. However, at the protein level, only, the beta1-subunit protein was found by western blotting....

  2. Voltage-dependent Ca2+ channels, not ryanodine receptors, activate Ca2+-dependent BK potassium channels in human retinal pigment epithelial cells

    OpenAIRE

    Wimmers, Sönke; Halsband, Claire; Seyler, Sebastian; Milenkovic, Vladimir; Strauß, Olaf

    2008-01-01

    Purpose In different tissues the activation of large conductance Ca2+-activated (BK) potassium channels has been shown to be coupled to voltage-gated Ca2+ channels as well as ryanodine receptors. As activation of BK channels leads to hyperpolarization of the cell, these channels provide a negative feedback mechanism for Ca2+-induced functions. Many cellular functions of the retinal pigment epithelium (RPE) are coupled to changes in [Ca2+]i. The aim of this study was to identify which Ca2+-ent...

  3. Differential expression of BK channel isoforms and beta-subunits in rat neuro-vascular tissues

    DEFF Research Database (Denmark)

    Poulsen, Asser Nyander; Johansson, Helle Wulf; Hay-Schmidt, Anders;

    2009-01-01

    We investigated the expression of splice variants and beta-subunits of the BK channel (big conductance Ca(2+)-activated K(+) channel, Slo1, MaxiK, K(Ca)1.1) in rat cerebral blood vessels, meninges, trigeminal ganglion among other tissues. An alpha-subunit splice variant X1(+24) was found expressed...... (RT-PCR) in nervous tissue only where also the SS4(+81) variant was dominating with little expression of the short form SS4(0). SS4(+81) was present in some cerebral vessels too. The SS2(+174) variant (STREX) was found in both blood vessels and in nervous tissue. In situ hybridization data supported...

  4. Molecular studies of BKCa channels in intracranial arteries: presence and localization

    DEFF Research Database (Denmark)

    Johansson, Helle Wulf; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2008-01-01

    of the BK(Ca) channel in rat basilar, middle cerebral, and middle meningeal arteries by reverse transcription polymerase chain reaction (RT-PCR), quantitative real-time PCR, and Western blotting. Distribution patterns were investigated using in situ hybridization and immunofluorescence studies. RT-PCR...... and quantitative real-time PCR detected the expression of the BK(Ca) channel mRNA transcript in rat basilar, middle cerebral, and middle meningeal arteries, with the transcript being expressed more abundantly in rat basilar arteries than in middle cerebral and middle meningeal arteries. Western blotting detected...... the BK(Ca) channel protein in rat basilar and middle cerebral arteries. In situ hybridization and immunofluorescence studies confirmed that the BK(Ca) channel mRNA and protein expression was localized to smooth muscle cells in all three intracranial arteries. The data thus suggest the presence...

  5. Hydrogen Peroxide Stimulates the Ca2+-activated Big-Conductance K Channels (BK) Through cGMP Signaling Pathway in Cultured Human Endothelial Cells

    OpenAIRE

    Dong, De-Li; Yue, Peng; Yang, Bao-Feng; Wang, Wen-Hui

    2008-01-01

    We used the whole cell patch-clamp technique to examine the effect of hydrogen peroxide (H2O2) on the Ca2+-activated BK channels in human endothelial cells. We confirmed the previous finding that a 200 pS BK channel activity was detected when the cell membrane potential was clamped at 50 mV. Application of H2O2 or adding glucose oxidase (GO) stimulated BK channels. The stimulatory effect of H2O2 and GO was absent in cells treated with ebselen, a scavenger of reactive oxygen species (ROS). To ...

  6. Mice with deficient BK channel function show impaired prepulse inhibition and spatial learning, but normal working and spatial reference memory.

    Directory of Open Access Journals (Sweden)

    Marei Typlt

    Full Text Available Genetic variations in the large-conductance, voltage- and calcium activated potassium channels (BK channels have been recently implicated in mental retardation, autism and schizophrenia which all come along with severe cognitive impairments. In the present study we investigate the effects of functional BK channel deletion on cognition using a genetic mouse model with a knock-out of the gene for the pore forming α-subunit of the channel. We tested the F1 generation of a hybrid SV129/C57BL6 mouse line in which the slo1 gene was deleted in both parent strains. We first evaluated hearing and motor function to establish the suitability of this model for cognitive testing. Auditory brain stem responses to click stimuli showed no threshold differences between knockout mice and their wild-type littermates. Despite of muscular tremor, reduced grip force, and impaired gait, knockout mice exhibited normal locomotion. These findings allowed for testing of sensorimotor gating using the acoustic startle reflex, as well as of working memory, spatial learning and memory in the Y-maze and the Morris water maze, respectively. Prepulse inhibition on the first day of testing was normal, but the knockout mice did not improve over the days of testing as their wild-type littermates did. Spontaneous alternation in the y-maze was normal as well, suggesting that the BK channel knock-out does not impair working memory. In the Morris water maze knock-out mice showed significantly slower acquisition of the task, but normal memory once the task was learned. Thus, we propose a crucial role of the BK channels in learning, but not in memory storage or recollection.

  7. KCNMA1 encoded cardiac BK channels afford protection against ischemia-reperfusion injury

    DEFF Research Database (Denmark)

    Soltysinska, Ewa; Bentzen, Bo Hjorth; Barthmes, Maria;

    2014-01-01

    that mitoBK fine-tune the oxidative state at hypoxia and re-oxygenation. Because ROS and the capacity of the myocardium for oxidative metabolism are important determinants of cellular survival, we tested BK-/- hearts for their response in an ex-vivo model of ischemia/reperfusion (I/R) injury. Infarct areas...

  8. Role of BKCa channels in cephalic vasodilation induced by CGRP, NO and transcranial electrical stimulation in the rat

    DEFF Research Database (Denmark)

    Gozalov, A.; Jansen-Olesen, I.; Klærke, Dan Arne;

    2007-01-01

    by the NO donor glyceryltrinitrate (GTN) or by CGRP is partially mediated via large conductance calcium-activated potassium (BK(Ca)) channels. The effects of the BK(Ca) channel selective inhibitor iberiotoxin on dural and pial vasodilation induced by CGRP, GTN and endogenously released CGRP by transcranial...... electrical stimulation (TES) were examined. Iberiotoxin significantly attenuated GTN-induced dural and pial artery dilation in vivo and in vitro, but had no effect on vasodilation induced by CGRP and TES. Our results show that GTN- but not CGRP-induced dural and pial vasodilation involves opening of BK...

  9. Expression of BKCa channels and the modulatory ß-subunits in the rat and porcine trigeminal ganglion

    DEFF Research Database (Denmark)

    Wulf-Johansson, Helle; Hay-Schmidt, Anders; Poulsen, Asser Nyander;

    2009-01-01

    Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways and the c......Large conductance calcium-activated potassium (BK(Ca)) channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release. Migraine has been proposed to be a trigeminovascular disease involving the sensory trigeminal pathways...

  10. Calcium- and voltage-gated potassium (BK) channel activators in the 5β-cholanic acid-3α-ol analogue series with modifications in the lateral chain.

    Science.gov (United States)

    Bukiya, Anna N; Patil, Shivaputra A; Li, Wei; Miller, Duane D; Dopico, Alex M

    2012-10-01

    Large conductance, calcium- and voltage-gated potassium (BK) channels regulate various physiological processes and represent an attractive target for drug discovery. Numerous BK channel activators are available. However, these agents usually interact with the ubiquitously distributed channel-forming subunit and thus cannot selectively target a particular tissue. We performed a structure-activity relationship study of lithocholic acid (LCA), a cholane that activates BK channels via the accessory BK β1 subunit. The latter protein is highly abundant in smooth muscle but scarce in most other tissues. Modifications to the LCA lateral chain length and functional group yielded two novel smooth muscle BK channel activators in which the substituent at C24 has a small volume and a net negative charge. Our data provide detailed structural information that will be useful to advance a pharmacophore in search of β1 subunit-selective BK channel activators. These compounds are expected to evoke smooth muscle relaxation, which would be beneficial in the pharmacotherapy of prevalent human disorders associated with increased smooth muscle contraction, such as systemic hypertension, cerebral or coronary vasospasm, bronchial asthma, bladder hyperactivity, and erectile dysfunction. PMID:22945504

  11. Novel mechanism of hydrogen sulfide-induced guinea pig urinary bladder smooth muscle contraction: role of BK channels and cholinergic neurotransmission.

    Science.gov (United States)

    Fernandes, Vítor S; Xin, Wenkuan; Petkov, Georgi V

    2015-07-15

    Hydrogen sulfide (H2S) is a key signaling molecule regulating important physiological processes, including smooth muscle function. However, the mechanisms underlying H2S-induced detrusor smooth muscle (DSM) contractions are not well understood. This study investigates the cellular and tissue mechanisms by which H2S regulates DSM contractility, excitatory neurotransmission, and large-conductance voltage- and Ca(2+)-activated K(+) (BK) channels in freshly isolated guinea pig DSM. We used a multidisciplinary experimental approach including isometric DSM tension recordings, colorimetric ACh measurement, Ca(2+) imaging, and patch-clamp electrophysiology. In isolated DSM strips, the novel slow release H2S donor, P-(4-methoxyphenyl)-p-4-morpholinylphosphinodithioic acid morpholine salt (GYY4137), significantly increased the spontaneous phasic and nerve-evoked DSM contractions. The blockade of neuronal voltage-gated Na(+) channels or muscarinic ACh receptors with tetrodotoxin or atropine, respectively, reduced the stimulatory effect of GYY4137 on DSM contractility. GYY4137 increased ACh release from bladder nerves, which was inhibited upon blockade of L-type voltage-gated Ca(2+) channels with nifedipine. Furthermore, GYY4137 increased the amplitude of the Ca(2+) transients and basal Ca(2+) levels in isolated DSM strips. GYY4137 reduced the DSM relaxation induced by the BK channel opener, NS11021. In freshly isolated DSM cells, GYY4137 decreased the amplitude and frequency of transient BK currents recorded in a perforated whole cell configuration and reduced the single BK channel open probability measured in excised inside-out patches. GYY4137 inhibited spontaneous transient hyperpolarizations and depolarized the DSM cell membrane potential. Our results reveal the novel findings that H2S increases spontaneous phasic and nerve-evoked DSM contractions by activating ACh release from bladder nerves in combination with a direct inhibition of DSM BK channels.

  12. Gentamicin Blocks the ACh-Induced BK Current in Guinea Pig Type II Vestibular Hair Cells by Competing with Ca2+ at the l-Type Calcium Channel

    Directory of Open Access Journals (Sweden)

    Hong Yu

    2014-04-01

    Full Text Available Type II vestibular hair cells (VHCs II contain big-conductance Ca2+-dependent K+ channels (BK and L-type calcium channels. Our previous studies in guinea pig VHCs II indicated that acetylcholine (ACh evoked the BK current by triggering the influx of Ca2+ ions through l-type Ca2+ channels, which was mediated by M2 muscarinic ACh receptor (mAChRs. Aminoglycoside antibiotics, such as gentamicin (GM, are known to have vestibulotoxicity, including damaging effects on the efferent nerve endings on VHCs II. This study used the whole-cell patch clamp technique to determine whether GM affects the vestibular efferent system at postsynaptic M2-mAChRs or the membrane ion channels. We found that GM could block the ACh-induced BK current and that inhibition was reversible, voltage-independent, and dose-dependent with an IC50 value of 36.3 ± 7.8 µM. Increasing the ACh concentration had little influence on GM blocking effect, but increasing the extracellular Ca2+ concentration ([Ca2+]o could antagonize it. Moreover, 50 µM GM potently blocked Ca2+ currents activated by (--Bay-K8644, but did not block BK currents induced by NS1619. These observations indicate that GM most likely blocks the M2 mAChR-mediated response by competing with Ca2+ at the l-type calcium channel. These results provide insights into the vestibulotoxicity of aminoglycoside antibiotics on mammalian VHCs II.

  13. Molecular mechanisms underlying the effect of the novel BK channel opener GoSlo: involvement of the S4/S5 linker and the S6 segment.

    Science.gov (United States)

    Webb, Timothy I; Kshatri, Aravind Singh; Large, Roddy J; Akande, Adebola Morayo; Roy, Subhrangsu; Sergeant, Gerard P; McHale, Noel G; Thornbury, Keith D; Hollywood, Mark A

    2015-02-17

    GoSlo-SR-5-6 is a novel large-conductance Ca(2+)-activated K(+) (BK) channel agonist that shifts the activation V1/2 of these channels in excess of -100 mV when applied at a concentration of 10 μM. Although the structure-activity relationship of this family of molecules has been established, little is known about how they open BK channels. To help address this, we used a combination of electrophysiology, mutagenesis, and mathematical modeling to investigate the molecular mechanisms underlying the effect of GoSlo-SR-5-6. Our data demonstrate that the effects of this agonist are practically abolished when three point mutations are made: L227A in the S4/S5 linker in combination with S317R and I326A in the S6C region. Our data suggest that GoSlo-SR-5-6 interacts with the transmembrane domain of the channel to enhance pore opening. The Horrigan-Aldrich model suggests that GoSlo-SR-5-6 works by stabilizing the open conformation of the channel and the activated state of the voltage sensors, yet decouples the voltage sensors from the pore gate.

  14. Orientations and proximities of the extracellular ends of transmembrane helices S0 and S4 in open and closed BK potassium channels.

    Directory of Open Access Journals (Sweden)

    Xiaowei Niu

    Full Text Available The large-conductance potassium channel (BK α subunit contains a transmembrane (TM helix S0 preceding the canonical TM helices S1 through S6. S0 lies between S4 and the TM2 helix of the regulatory β1 subunit. Pairs of Cys were substituted in the first helical turns in the membrane of BK α S0 and S4 and in β1 TM2. One such pair, W22C in S0 and W203C in S4, was 95% crosslinked endogenously. Under voltage-clamp conditions in outside-out patches, this crosslink was reduced by DTT and reoxidized by a membrane-impermeant bis-quaternary ammonium derivative of diamide. The rate constants for this reoxidation were not significantly different in the open and closed states of the channel. Thus, these two residues are approximately equally close in the two states. In addition, 90% crosslinking of a second pair, R20C in S0 and W203C in S4, had no effect on the V50 for opening. Taken together, these findings indicate that separation between residues at the extracellular ends of S0 and S4 is not required for voltage-sensor activation. On the contrary, even though W22C and W203C were equally likely to form a disulfide in the activated and deactivated states, relative immobilization by crosslinking of these two residues favored the activated state. Furthermore, the efficiency of recrosslinking of W22C and W203C on the cell surface was greater in the presence of the β1 subunit than in its absence, consistent with β1 acting through S0 to stabilize its immobilization relative to α S4.

  15. Hydrophobic interaction between contiguous residues in the S6 transmembrane segment acts as a stimuli integration node in the BK channel

    Science.gov (United States)

    Carrasquel-Ursulaez, Willy; Contreras, Gustavo F.; Sepúlveda, Romina V.; Aguayo, Daniel; González-Nilo, Fernando

    2015-01-01

    Large-conductance Ca2+- and voltage-activated K+ channel (BK) open probability is enhanced by depolarization, increasing Ca2+ concentration, or both. These stimuli activate modular voltage and Ca2+ sensors that are allosterically coupled to channel gating. Here, we report a point mutation of a phenylalanine (F380A) in the S6 transmembrane helix that, in the absence of internal Ca2+, profoundly hinders channel opening while showing only minor effects on the voltage sensor active–resting equilibrium. Interpretation of these results using an allosteric model suggests that the F380A mutation greatly increases the free energy difference between open and closed states and uncouples Ca2+ binding from voltage sensor activation and voltage sensor activation from channel opening. However, the presence of a bulky and more hydrophobic amino acid in the F380 position (F380W) increases the intrinsic open–closed equilibrium, weakening the coupling between both sensors with the pore domain. Based on these functional experiments and molecular dynamics simulations, we propose that F380 interacts with another S6 hydrophobic residue (L377) in contiguous subunits. This pair forms a hydrophobic ring important in determining the open–closed equilibrium and, like an integration node, participates in the communication between sensors and between the sensors and pore. Moreover, because of its effects on open probabilities, the F380A mutant can be used for detailed voltage sensor experiments in the presence of permeant cations. PMID:25548136

  16. Cell volume and membrane stretch independently control K+ channel activity

    DEFF Research Database (Denmark)

    Bomholtz, Sofia Hammami; Willumsen, Niels J; Olsen, Hervør L;

    2009-01-01

    A number of potassium channels including members of the KCNQ family and the Ca(2+) activated IK and SK, but not BK, are strongly and reversibly regulated by small changes in cell volume. It has been argued that this general regulation is mediated through sensitivity to changes in membrane stretch....... To test this hypothesis we have studied the regulation of KCNQ1 and BK channels after expression in Xenopus oocytes. Results from cell-attached patch clamp studies (approximately 50 microm(2) macropatches) in oocytes expressing BK channels demonstrate that the macroscopic volume-insensitive BK current...... was not affected by membrane stretch. The results indicate that (1) activation of BK channels by local membrane stretch is not mimicked by membrane stress induced by cell swelling, and (2) activation of KCNQ1 channels by cell volume increase is not mediated by local tension in the cell membrane. We conclude...

  17. Application of a real-time PCR assay to detect BK potassium channel expression in samples from Atlantic salmon (Salmo salar and Rainbow trout (Oncorhynchus mykiss acclimated to freshwater#

    Directory of Open Access Journals (Sweden)

    CA Loncoman

    2015-01-01

    Full Text Available Atlantic salmon (Salmo salar and Rainbow trout (Oncorhynchus mykiss are two fish species that spawn in fresh water (FW and, during development, acclimate to seawater (SW by secreting excess NaCl to the environment. The salmon industry measures Na+/K+ ATPase (NKA activity as a molecular marker to determine the timing of smolt transfer from FW to SW. However, the lack of other accurate molecular markers of smoltification remains a major issue for the fish farming industry. The molecular mechanism of NaCl secretion in gills from SW-acclimated fish has a thermodynamic requirement to recycle K+ out of the cell via potassium channels therefore we hypothesised that potassium channel expression in gills may be a suitable candidate to monitor the smoltification process. In support of this hypothesis, we observed increased expression of BK potassium channel mRNA in gills from S. salar under conditions of high salinity (1.2% compared to animals in FW. In this work, we designed a real-time PCR analysis in order to quantify mRNA levels of BK potassium channels in S. salar organ samples. We found differences in mRNA expression among gills, kidney and intestine. We also found a unique real-time PCR product in S. salar gills through melting curve analysis, agarose gel electrophoresis and cDNA sequencing. This PCR product showed a 98% of identity with the BK channel portion recorded by the NCBI Database and was differentially expressed in gills, kidney and intestine. This real-time PCR assay may become an important tool to study BK potassium channels expressed in the gills of S. salar and its changes during smoltification as putative new candidate to monitor this process.

  18. Contribution of SK and BK channels in the control of catecholamine release by electrical stimulation of the cat adrenal gland.

    Science.gov (United States)

    Montiel, C; López, M G; Sánchez-García, P; Maroto, R; Zapater, P; García, A G

    1995-01-01

    on catecholamine release induced by electrical stimulation was observed at low but not at high [Ca2+]o. 6. Simultaneous release of acetylcholine and catecholamines upon electrical stimulation was achieved in glands in which the endogenous acetylcholine stores in the splanchnic nerve terminals had been prelabelled by perfusion with [3H]choline. While apamin enhanced more than 2-fold the postsynaptic release of catecholamines, the presynaptic release of acetylcholine remained unaffected. 7. The results are compatible with the hypothesis that, under physiological conditions, Ca(2+)-activated SK channels present in chromaffin cells control the firing patterns of action potentials induced by the acetylcholine released from splanchnic nerves during stress.(ABSTRACT TRUNCATED AT 400 WORDS) Images Figure 3 Figure 4 Figure 6 PMID:7473208

  19. Contribution of SK and BK channels in the control of catecholamine release by electrical stimulation of the cat adrenal gland.

    Science.gov (United States)

    Montiel, C; López, M G; Sánchez-García, P; Maroto, R; Zapater, P; García, A G

    1995-07-15

    on catecholamine release induced by electrical stimulation was observed at low but not at high [Ca2+]o. 6. Simultaneous release of acetylcholine and catecholamines upon electrical stimulation was achieved in glands in which the endogenous acetylcholine stores in the splanchnic nerve terminals had been prelabelled by perfusion with [3H]choline. While apamin enhanced more than 2-fold the postsynaptic release of catecholamines, the presynaptic release of acetylcholine remained unaffected. 7. The results are compatible with the hypothesis that, under physiological conditions, Ca(2+)-activated SK channels present in chromaffin cells control the firing patterns of action potentials induced by the acetylcholine released from splanchnic nerves during stress.(ABSTRACT TRUNCATED AT 400 WORDS)

  20. Localization of large conductance calcium-activated potassium channels and their effect on calcitonin gene-related peptide release in the rat trigemino-neuronal pathway

    DEFF Research Database (Denmark)

    Wulf-Johansson, H.; Amrutkar, D.V.; Hay-Schmidt, Anders;

    2010-01-01

    Large conductance calcium-activated potassium (BK(Ca)) channels are membrane proteins contributing to electrical propagation through neurons. Calcitonin gene-related peptide (CGRP) is a neuropeptide found in the trigeminovascular system (TGVS). Both BK(Ca) channels and CGRP are involved in migraine...

  1. Genetic activation of BK currents in vivo generates bidirectional effects on neuronal excitability.

    Science.gov (United States)

    Montgomery, Jenna R; Meredith, Andrea L

    2012-11-13

    Large-conductance calcium-activated potassium channels (BK) are potent negative regulators of excitability in neurons and muscle, and increasing BK current is a novel therapeutic strategy for neuro- and cardioprotection, disorders of smooth muscle hyperactivity, and several psychiatric diseases. However, in some neurons, enhanced BK current is linked with seizures and paradoxical increases in excitability, potentially complicating the clinical use of agonists. The mechanisms that switch BK influence from inhibitory to excitatory are not well defined. Here we investigate this dichotomy using a gain-of-function subunit (BK(R207Q)) to enhance BK currents. Heterologous expression of BK(R207Q) generated currents that activated at physiologically relevant voltages in lower intracellular Ca(2+), activated faster, and deactivated slower than wild-type currents. We then used BK(R207Q) expression to broadly augment endogenous BK currents in vivo, generating a transgenic mouse from a circadian clock-controlled Period1 gene fragment (Tg-BK(R207Q)). The specific impact on excitability was assessed in neurons of the suprachiasmatic nucleus (SCN) in the hypothalamus, a cell type where BK currents regulate spontaneous firing under distinct day and night conditions that are defined by different complements of ionic currents. In the SCN, Tg-BK(R207Q) expression converted the endogenous BK current to fast-activating, while maintaining similar current-voltage properties between day and night. Alteration of BK currents in Tg-BK(R207Q) SCN neurons increased firing at night but decreased firing during the day, demonstrating that BK currents generate bidirectional effects on neuronal firing under distinct conditions.

  2. Molecular and functional expression of high conductance Ca 2+ activated K+ channels in the eel intestinal epithelium

    DEFF Research Database (Denmark)

    Lionetto, Maria G; Rizzello, Antonia; Giordano, Maria E;

    2008-01-01

    Several types of K(+) channels have been identified in epithelial cells. Among them high conductance Ca(2+)-activated K(+) channels (BK channels) are of relevant importance for their involvement in regulatory volume decrease (RVD) response following hypotonic stress. The aim of the present work...... and morphometric analysis on the intact tissue. BK(Ca) channels appeared to be localized along all the plasma membrane of the enterocytes; the apical part of the villi showed the most intense immunostaining. These channels were silent in basal condition, but were activated on both membranes (apical and basolateral......) by increasing intracellular Ca(2+) concentration with the Ca(2+) ionophore ionomycin (1 microM). BK(Ca) channels were also activated on both membranes by hypotonic swelling of the epithelium and their inhibition by 100 nM iberiotoxin (specific BK(Ca) inhibitor) abolished the Regulatory Volume Decrease (RVD...

  3. Localized Algorithm for Channel Assignment in Cognitive Radio Networks

    Directory of Open Access Journals (Sweden)

    Harpreet Kaur

    2015-12-01

    Full Text Available Cognitive Radio has been emerged as a revolutionary solution to migrate the current shortage of spectrum allocation in wireless networks. In this paper, an improved localized channel allocation algorithm based on channel weight is proposed. A factor of channel stability is introduced based on link environment, which efficiently assigns the best channels to the links. Based on the framework, a conflict resolution strategy is used to make the scheme adaptable to different network conditions. Calculations indicate that this algorithm can reduce the conflicts, increase the delivery rate and link assignment rate compared with the basic channel assignment algorithm.

  4. Series BK contactless DC motors

    Energy Technology Data Exchange (ETDEWEB)

    Buss, V.A.; Vevyurko, I.A.; Ivanov, G.V.; Kuzmin, V.N.; Mikhaylov, E.M.; Stoma, A.S.

    1985-05-01

    Implementation of principles described in a previous work has allowed development and introduction to series production of a motor series including 36 standard types and sizes. The series is designed to operate at a nominal voltage of 27 V and includes two main versions: the BK-1 for fans and BK-2 for pumps. The BK-2 motor differs from the BK-1 in that it has a thin sealed sleeve of high impedance nonmagnetic metal separating the rotor and stator cavities, allowing the rotor of the BK-2 to operate in the fluids or other media being pumped. Characteristics of the motors are presented. The BK-1316 has an operating life of about 50,000 hours at nominal speed of 6000 rpm. The experience of series production of the BK motors has shown the need for further improvement of the design and technology in order to decrease the number of metal cutting, winding and assembly operations required. The use of plastic structures is suggested to this end.

  5. Effects of sodium metabisulfite on the expression of BK(Ca), K(ATP), and L-Ca(2+) channels in rat aortas in vivo and in vitro.

    Science.gov (United States)

    Zhang, Quanxi; Bai, Yunlong; Tian, Jingjing; Lei, Xiaodong; Li, Mei; Yang, Zhenhua; Meng, Ziqiang

    2015-03-01

    Sodium metabisulfite (SMB) is most commonly used as the preservative in many food preparations and drugs. So far, few studies about its negative effects were reported. The purpose of this study was to investigate the effect of SMB on the expression of big-conductance Ca(2+)-activated K(+) (BKCa), ATP-sensitive K(+) (KATP), and L-type calcium (L-Ca(2+)) channels in rat aorta in vivo and in vitro. The results showed that the mRNA and protein levels of the BKCa channel subunits α and β1 of aorta in rats were increased by SMB in vivo and in vitro. Similarly, the expression of the KATP channel subunits Kir6.1, Kir6.2, and SUR2B were increased by SMB. However, SMB at the highest concentration significantly decreased the expression of the L-Ca(2+) channel subunits Cav1.2 and Cav1.3. These results suggest that SMB can activate BKCa and KATP channels by increasing the expression of α, β1, and Kir6.1, Kir6.2, SUR2B respectively, while also inhibit L-Ca(2+) channels by decreasing the expression of Cav1.2 and Cav1.3 of aorta in rats. The molecular mechanism of SMB-induced vasorelaxant effect might be related to the expression changes of BKCa, KATP, and L-Ca(2+) channels subunits. Further work is needed to determine the relative contribution of each channel in SMB-mediated vasorelaxant effect.

  6. Robust Source Localization in a Random Shallow Water Channel

    CERN Document Server

    Sazontov, Alexander; Matveyev, Alexander

    2014-01-01

    This paper addresses source localization problem in a random shallow water channel. We present an extension of the generalized MUSIC method to the case, %in which when the signal correlation matrix is imprecisely known. The algorithm is validated by %simulations and its application to the experimental data observed in the Barents Sea. It has been found that the approach proposed demonstrates its excellent performance.

  7. The sodium channel as a target for local anesthetic drugs

    Directory of Open Access Journals (Sweden)

    Harry A Fozzard

    2011-11-01

    Full Text Available Na channels are the source of excitatory currents for the nervous system and muscle. They are the target for a class of drugs called local anesthetics (LA, which have been used for local and regional anesthesia and for excitatory dysfunction problems such as epilepsy and cardiac arrhythmia. LA drugs are prototypes for new analgesic drugs. The LA drug binding site has been localized to the inner pore of the channel, where drugs interact mainly with a phenylalanine in domain IV S6. Drug affinity is both voltage- and use-dependent. Voltage-dependency is the result of changes in the conformation of the inner pore during channel activation and opening, allowing high energy interaction of drugs with the phenylalanine. LA drugs also reduce the gating current of Na channels, which represents the movement of charged residues in the voltage sensors. Specifically, drug binding to phenylalanine locks the domain III S4 in its outward (activated position, and slows recovery of the domain IV S4. Although strongly affecting gating, LA drugs almost certainly also block by steric occlusion of the pore. Molecular definition of the binding and blocking interactions may help in new drug development.

  8. Functional characterization of three ethylene response factor genes from Bupleurum kaoi indicates that BkERFs mediate resistance to Botrytis cinerea.

    Science.gov (United States)

    Liu, Wen-Yu; Chiou, Shu-Jiau; Ko, Chia-Yun; Lin, Tsai-Yun

    2011-03-01

    Three novel ethylene response factor (ERF) genes, BkERF1, BkERF2.1 and BkERF2.2, were isolated from a medicinal plant, Bupleurum kaoi. The deduced BkERFs contain a canonical nuclear localization signal and an ERF/AP2 DNA binding domain. RNA gel blot analysis revealed that BkERF1 and BkERF2.1 were ubiquitously expressed at low levels in all parts of mature plants, and that BkERF2.2 was expressed at moderate levels in vegetative tissues. Exogenous application of methyl jasmonate induced BkERF1/2.1/2.2 transcripts. BkERF2.2 transcript levels were slightly increased by addition of ethephon and salicylic acid. BkERFs were localized in the plant nucleus and functioned as transcriptional activators. In B. kaoi cells overexpressing BKERFs, inoculation with Botrytis cinerea increased expression of some defense genes which are associated with enhanced disease resistance. Similarly, overexpression of BkERFs in transgenic Arabidopsis thaliana resulted in elevated mRNA levels of the defense gene PDF1.2, and in enhanced resistance to B. cinerea. Collectively, these results provide evidence that BkERFs mediate the expression of defense-related genes in plants.

  9. Streamwise decay of localized states in channel flow

    CERN Document Server

    Zammert, Stefan

    2016-01-01

    Channel flow, the pressure driven flow between parallel plates, has exact coherent structures that show various degrees of localization. For states which are localized in streamwise direction but extended in spanwise direction, we show that they are exponentially localized, with decay constants that are different on the upstream and downstream side. We extend the analysis of Brand and Gibson, J. Fluid Mech. 750, R1 (2014), for stationary states to the case of advected structures that is needed here, and derive expressions for the decay in terms of eigenvalues and eigenfunctions of certain second order differential equations. The results are in very good agreement with observations on exact coherent structures of different transversal wave length.

  10. Optimal Beamforming in Interference Networks with Perfect Local Channel Information

    CERN Document Server

    Mochaourab, Rami

    2010-01-01

    We consider multiuser settings in which systems simultaneously utilize the available communication resources. Since the performance of the systems is usually limited by mutual interference, efficient resource allocation in such scenarios is important. In general, the systems' joint operation is desired to be Pareto optimal. However, designing Pareto optimal resource allocation schemes is known to be difficult. In this work, we assume all transmitters apply multiple antennas and have perfect local channel state information of their own channels to all single-antenna receivers. Each transmitter is associated with a power gain-region which is composed of all jointly achievable power gains at the receivers. We prove that the boundary of the power gain-region is convex and always achieved with single-stream beamforming. Thus, the efficient beamforming vectors that achieve its boundary part in a specific direction are characterized by real-valued parameters between zero and one. According to the network setting and...

  11. Numerical computation of pulsatile flow through a locally constricted channel

    Science.gov (United States)

    Bandyopadhyay, S.; Layek, G. C.

    2011-01-01

    This paper deals with the numerical solution of a pulsatile laminar flow through a locally constricted channel. A finite difference technique has been employed to solve the governing equations. The effects of the flow parameters such as Reynolds number, flow pulsation in terms of Strouhal number, constriction height and length on the flow behaviour have been studied. It is found that the peak value of the wall shear stress has significantly changed with the variation of Reynolds numbers and constriction heights. It is also noted that the Strouhal number and constriction length have little effect on the peak value of the wall shear stress. The flow computation reveals that the peak value of the wall shear stress at maximum flow rate time in pulsatile flow situation is much larger than that due to steady flow. The constriction and the flow pulsation produce flow disturbances at the vicinity of the constriction of the channel in the downstream direction.

  12. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  13. B_K from improved staggered quarks

    OpenAIRE

    Gamiz, E.; Collins, S.; Davies, C. T. H.; Shigemitsu, J.; Wingate, M

    2004-01-01

    We compare calculations of B_K with improved staggered quarks (HYP, Asqtad) and demonstrate the improved scaling behaviour that this gives rise to over previous calculations with unimproved staggered quarks. This enables us to perform the calculation of B_K on the MILC dynamical configurations (n_f=2+1), for which we give preliminary results.

  14. The Distribution in International Marketing - Correlation between International and Local Channels in Kosovo

    OpenAIRE

    Hidajet Karaxha; Halit Karaxha

    2015-01-01

    Nowadays, with all these turbulent markets, the international channels are becoming more and more important. The motivation of channel members is an important characteristic in building the relations between international and local channels. The distribution channels in countries in transition can be spread and not effective. Therefore an adequate design of the firm's strategies about marketing should be responsible for the changes between distribution channels in different countries. Sometim...

  15. Up-Regulatory Effects of Curcumin on Large Conductance Ca2+-Activated K+ Channels.

    Directory of Open Access Journals (Sweden)

    Qijing Chen

    Full Text Available Large conductance Ca2+-activated potassium channels (BK are targets for research that explores therapeutic means to various diseases, owing to the roles of the channels in mediating multiple physiological processes in various cells and tissues. We investigated the pharmacological effects of curcumin, a compound isolated from the herb Curcuma longa, on BK channels. As recorded by whole-cell patch-clamp, curcumin increased BK (α and BK (α+β1 currents in transfected HEK293 cells as well as the current density of BK in A7r5 smooth muscle cells in a dose-dependent manner. By incubating with curcumin for 24 hours, the current density of exogenous BK (α in HEK293 cells and the endogenous BK in A7r5 cells were both enhanced notably, though the steady-state activation of the channels did not shift significantly, except for BK (α+β1. Curcumin up-regulated the BK protein expression without changing its mRNA level in A7r5 cells. The surface expression and the half-life of BK channels were also increased by curcumin in HEK293 cells. These effects of curcumin were abolished by MG-132, a proteasome inhibitor. Curcumin also increased ERK 1/2 phosphorylation, while inhibiting ERK by U0126 attenuated the curcumin-induced up-regulation of BK protein expression. We also observed that the curcumin-induced relaxation in the isolated rat aortic rings was significantly attenuated by paxilline, a BK channel specific blocker. These results show that curcumin enhances the activity of the BK channels by interacting with BK directly as well as enhancing BK protein expression through inhibiting proteasomal degradation and activating ERK signaling pathway. The findings suggest that curcumin is a potential BK channel activator and provide novel insight into its complicated pharmacological effects and the underlying mechanisms.

  16. Reconstruction of lightning channel geometry by localizing thunder sources

    Science.gov (United States)

    Bodhika, J. A. P.; Dharmarathna, W. G. D.; Fernando, Mahendra; Cooray, Vernon

    2013-09-01

    Thunder is generated as a result of a shock wave created by sudden expansion of air in the lightning channel due to high temperature variations. Even though the highest amplitudes of thunder signatures are generated at the return stroke stage, thunder signals generated at other events such as preliminary breakdown pulses also can be of amplitudes which are large enough to record using a sensitive system. In this study, it was attempted to reconstruct the lightning channel geometry of cloud and ground flashes by locating the temporal and spatial variations of thunder sources. Six lightning flashes were reconstructed using the recorded thunder signatures. Possible effects due to atmospheric conditions were neglected. Numerical calculations suggest that the time resolution of the recorded signal and 10 ms-1error in speed of sound leads to 2% and 3% errors, respectively, in the calculated coordinates. Reconstructed channel geometries for cloud and ground flashes agreed with the visual observations. Results suggest that the lightning channel can be successfully reconstructed using this technique.

  17. Implementation of Non-local Operations for High-Dimensional Systems Through Qubit Quantum Channels

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    We propose a method to implement a kind of non-local operation between spatially separated two systems with high dimensions by using only a low-dimensional qubit quantum channel and 2-bit classical communication. For qutrit systems, we further show the creation of non-local maximally entangled state and the construction of the non-local quantum XOR gate in terms of the obtained non-local operations as well as some single qutrit local gates.

  18. BK nephropathy in the native kidneys of patients with organ transplants: Clinical spectrum of BK infection.

    Science.gov (United States)

    Vigil, Darlene; Konstantinov, Nikifor K; Barry, Marc; Harford, Antonia M; Servilla, Karen S; Kim, Young Ho; Sun, Yijuan; Ganta, Kavitha; Tzamaloukas, Antonios H

    2016-09-24

    Nephropathy secondary to BK virus, a member of the Papoviridae family of viruses, has been recognized for some time as an important cause of allograft dysfunction in renal transplant recipients. In recent times, BK nephropathy (BKN) of the native kidneys has being increasingly recognized as a cause of chronic kidney disease in patients with solid organ transplants, bone marrow transplants and in patients with other clinical entities associated with immunosuppression. In such patients renal dysfunction is often attributed to other factors including nephrotoxicity of medications used to prevent rejection of the transplanted organs. Renal biopsy is required for the diagnosis of BKN. Quantitation of the BK viral load in blood and urine are surrogate diagnostic methods. The treatment of BKN is based on reduction of the immunosuppressive medications. Several compounds have shown antiviral activity, but have not consistently shown to have beneficial effects in BKN. In addition to BKN, BK viral infection can cause severe urinary bladder cystitis, ureteritis and urinary tract obstruction as well as manifestations in other organ systems including the central nervous system, the respiratory system, the gastrointestinal system and the hematopoietic system. BK viral infection has also been implicated in tumorigenesis. The spectrum of clinical manifestations from BK infection and infection from other members of the Papoviridae family is widening. Prevention and treatment of BK infection and infections from other Papovaviruses are subjects of intense research.

  19. BK nephropathy in the native kidneys of patients with organ transplants: Clinical spectrum of BK infection

    Science.gov (United States)

    Vigil, Darlene; Konstantinov, Nikifor K; Barry, Marc; Harford, Antonia M; Servilla, Karen S; Kim, Young Ho; Sun, Yijuan; Ganta, Kavitha; Tzamaloukas, Antonios H

    2016-01-01

    Nephropathy secondary to BK virus, a member of the Papoviridae family of viruses, has been recognized for some time as an important cause of allograft dysfunction in renal transplant recipients. In recent times, BK nephropathy (BKN) of the native kidneys has being increasingly recognized as a cause of chronic kidney disease in patients with solid organ transplants, bone marrow transplants and in patients with other clinical entities associated with immunosuppression. In such patients renal dysfunction is often attributed to other factors including nephrotoxicity of medications used to prevent rejection of the transplanted organs. Renal biopsy is required for the diagnosis of BKN. Quantitation of the BK viral load in blood and urine are surrogate diagnostic methods. The treatment of BKN is based on reduction of the immunosuppressive medications. Several compounds have shown antiviral activity, but have not consistently shown to have beneficial effects in BKN. In addition to BKN, BK viral infection can cause severe urinary bladder cystitis, ureteritis and urinary tract obstruction as well as manifestations in other organ systems including the central nervous system, the respiratory system, the gastrointestinal system and the hematopoietic system. BK viral infection has also been implicated in tumorigenesis. The spectrum of clinical manifestations from BK infection and infection from other members of the Papoviridae family is widening. Prevention and treatment of BK infection and infections from other Papovaviruses are subjects of intense research. PMID:27683628

  20. The minimum entropy output of a quantum channel is locally additive

    CERN Document Server

    Gour, Gilad

    2011-01-01

    We show that the minimum von-Neumann entropy output of a quantum channel is locally additive. Hasting's counterexample for the additivity conjecture, makes this result quite surprising. In particular, it indicates that the non-additivity of the minimum entropy output is a global effect of quantum channels.

  1. Localization and function of ATP-sensitive potassium channels in human skeletal muscle

    DEFF Research Database (Denmark)

    Nielsen, Jens Jung; Kristensen, Michael; Hellsten, Ylva;

    2003-01-01

    The present study investigated the localization of ATP-sensitive K+ (KATP) channels in human skeletal muscle and the functional importance of these channels for human muscle K+ distribution at rest and during muscle activity. Membrane fractionation based on the giant vesicle technique...

  2. BK equation and traveling wave solutions

    Energy Technology Data Exchange (ETDEWEB)

    De Santana Amaral, J.T.; Betemps, M.A.; Gay Ducati, M.B. [Univ Fed Rio Grande do Sul, Inst Fis, BR-91501 Porto Alegre, RS, (Brazil); Soyez, G. [CEA Saclay, DSM, SPhT, Serv Phys Theor Saclay, F-91191 Gif Sur Yvette, (France)

    2007-07-01

    It has been shown that the transition to the saturation regime of high energy QCD is similar to the formation of the front of a traveling wave. In particular, it can be verified that Balitsky-Kovchegov (BK) evolution equation reduces, after some approximations, to the nonlinear Fisher and Kolmogorov-Petrovsky-Piscounov (FKPP) equation, well-known from statistical physics. In these proceedings, based on the current knowledge of the asymptotic solutions of the BK equation, we propose a parametrization for the forward scattering amplitude which interpolates between the traveling wave solution and the saturation region. (authors)

  3. BK equation and traveling wave solutions

    Energy Technology Data Exchange (ETDEWEB)

    Santana Amaral, J.T. de; Betemps, M.A.; Ducati, M.B. Gay [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Inst. de Fisica; Soyez, G. [CEA Saclay, Gif-sur-Yvette (France). Direction des Sciences de la Matiere. Service de Physique Theorique

    2007-06-15

    It has been shown that the transition to the saturation regime of high energy QCD is similar to the formation of the front of a traveling wave. In particular, it can be verified that Balitsky-Kovchegov (BK) evolution equation reduces, after some approximations, to the nonlinear Fisher and Kolmogorov-Petrovsky-Piscounov (FKPP) equation, well-known from statistical physics. In these proceedings, based on the current knowledge of the asymptotic solutions of the BK equation, we propose a parametrization for the forward scattering amplitude which interpolates between the traveling wave solution and the saturation region. (author)

  4. Comparison between Two Local Thermal Non Equilibrium Criteria in Forced Convection through a Porous Channel

    OpenAIRE

    azzedine ABDEDOU; Khedidja Bouhadef

    2015-01-01

    Two criteria are used and compared to investigate the local thermal equilibrium assumption in a forced convection through a porous channel. The first criterion is based on the maximum local temperature difference between the solid and fluid phases, while the second is based on the average of the local differences between the temperature of the solid phase and the fluid phase. For this purpose, the momentum and energy equations based on the Darcy-Brinkman-Forchheimer and the local thermal non ...

  5. Potassium channels in prostate and colonic cancer

    OpenAIRE

    Ousingsawat, Jiraporn

    2007-01-01

    Large conductance Ca2+-activated K+ channels in human prostate cancer The KCNMA1 gene encoding the alpha-subunit of BK channels is amplified and BK channel expression is enhanced in late-stage, metastatic and hormone-refractory human prostate cancer tissues, whereas benign prostate tissues show only a weak expression of BK channels. PC-3 hormone-insensitive prostate cancer cells, but not hormone-sensitive prostate cancer cells (LNCaP) and benign prostate hyperplasia cells (BPH-1), show an ...

  6. Local Sequence Information-based Support Vector Machine to Classify Voltage-gated Potassium Channels

    Institute of Scientific and Technical Information of China (English)

    Li-Xia LIU; Meng-Long LI; Fu-Yuan TAN; Min-Chun LU; Ke-Long WANG; Yan-Zhi GUO; Zhi-Ning WEN; Lin JIANG

    2006-01-01

    In our previous work, we developed a computational tool, PreK-ClassK-ClassKv, to predict and classify potassium (K+) channels. For K+ channel prediction (PreK) and classification at family level (ClassK), this method performs well. However, it does not perform so well in classifying voltage-gated potassium (Kv) channels (ClassKv). In this paper, a new method based on the local sequence information of Kv channels is introduced to classify Kv channels. Six transmembrane domains of a Kv channel protein are used to define a protein, and the dipeptide composition technique is used to transform an amino acid sequence to a numerical sequence. A Kv channel protein is represented by a vector with 2000 elements, and a support vector machine algorithm is applied to classify Kv channels. This method shows good performance with averages of total accuracy (Acc), sensitivity (SE), specificity (SP); reliability (R) and Matthews correlation coefficient (MCC) of 98.0%, 89.9%, 100%, 0.95 and 0.94 respectively. The results indicate that the local sequence information-based method is better than the global sequence information-based method to classify Kv channels.

  7. Apical Ca2+-activated potassium channels in mouse parotid acinar cells.

    Science.gov (United States)

    Almassy, Janos; Won, Jong Hak; Begenisich, Ted B; Yule, David I

    2012-02-01

    Ca(2+) activation of Cl and K channels is a key event underlying stimulated fluid secretion from parotid salivary glands. Cl channels are exclusively present on the apical plasma membrane (PM), whereas the localization of K channels has not been established. Mathematical models have suggested that localization of some K channels to the apical PM is optimum for fluid secretion. A combination of whole cell electrophysiology and temporally resolved digital imaging with local manipulation of intracellular [Ca(2+)] was used to investigate if Ca(2+)-activated K channels are present in the apical PM of parotid acinar cells. Initial experiments established Ca(2+)-buffering conditions that produced brief, localized increases in [Ca(2+)] after focal laser photolysis of caged Ca(2+). Conditions were used to isolate K(+) and Cl(-) conductances. Photolysis at the apical PM resulted in a robust increase in K(+) and Cl(-) currents. A localized reduction in [Ca(2+)] at the apical PM after photolysis of Diazo-2, a caged Ca(2+) chelator, resulted in a decrease in both K(+) and Cl(-) currents. The K(+) currents evoked by apical photolysis were partially blocked by both paxilline and TRAM-34, specific blockers of large-conductance "maxi-K" (BK) and intermediate K (IK), respectively, and almost abolished by incubation with both antagonists. Apical TRAM-34-sensitive K(+) currents were also observed in BK-null parotid acini. In contrast, when the [Ca(2+)] was increased at the basal or lateral PM, no increase in either K(+) or Cl(-) currents was evoked. These data provide strong evidence that K and Cl channels are similarly distributed in the apical PM. Furthermore, both IK and BK channels are present in this domain, and the density of these channels appears higher in the apical versus basolateral PM. Collectively, this study provides support for a model in which fluid secretion is optimized after expression of K channels specifically in the apical PM.

  8. Localization and pharmacological characterization of voltage dependent calcium channels in cultured neocortical neurons

    DEFF Research Database (Denmark)

    Timmermann, D B; Lund, T M; Belhage, B;

    2001-01-01

    in cytosolic calcium concentration. The results of this investigation demonstrate that pharmacologically distinct types of voltage dependent calcium channels are differentially localized in cell bodies, neurites and nerve terminals of mouse cortical neurons but that the Q-type calcium channel appears......The physiological significance and subcellular distribution of voltage dependent calcium channels was defined using calcium channel blockers to inhibit potassium induced rises in cytosolic calcium concentration in cultured mouse neocortical neurons. The cytosolic calcium concentration was measured...... using the fluorescent calcium chelator fura-2. The types of calcium channels present at the synaptic terminal were determined by the inhibitory action of calcium channel blockers on potassium-induced [3H]GABA release in the same cell preparation. L-, N-, P-, Q- and R-/T-type voltage dependent calcium...

  9. Polyoma BK Virus: An Oncogenic Virus?

    Directory of Open Access Journals (Sweden)

    Syed Hassan

    2013-01-01

    Full Text Available We report a case of a 65-year-old gentleman with a history of end stage renal disease who underwent a successful cadaveric donor kidney transplant four years ago. He subsequently developed BK virus nephropathy related to chronic immunosuppressant therapy. Three years later, misfortune struck again, and he developed adenocarcinoma of the bladder.

  10. Evaluating the BK 21 Program. Research Brief

    Science.gov (United States)

    Seong, Somi; Popper, Steven W.; Goldman, Charles A.; Evans, David K.; Grammich, Clifford A.

    2008-01-01

    The Brain Korea 21 program (BK21), an effort to improve Korean universities and research, has attracted a great deal of attention in Korea, producing the need to understand how well the program is meeting its goals. RAND developed a logic model for identifying program goals and dynamics, suggested quantitative and qualitative evaluation methods,…

  11. Enhancement dark channel algorithm of color fog image based on the local segmentation

    Science.gov (United States)

    Yun, Lijun; Gao, Yin; Shi, Jun-sheng; Xu, Ling-zhang

    2015-04-01

    The classical dark channel theory algorithm has yielded good results in the processing of single fog image, but in some larger contrast regions, it appears image hue, brightness and saturation distortion problems to a certain degree, and also produces halo phenomenon. In the view of the above situation, through a lot of experiments, this paper has found some factors causing the halo phenomenon. The enhancement dark channel algorithm of color fog image based on the local segmentation is proposed. On the basis of the dark channel theory, first of all, the classic dark channel theory of mathematical model is modified, which is mainly to correct the brightness and saturation of image. Then, according to the local adaptive segmentation theory, it process the block of image, and overlap the local image. On the basis of the statistical rules, it obtains each pixel value from the segmentation processing, so as to obtain the local image. At last, using the dark channel theory, it achieves the enhanced fog image. Through the subjective observation and objective evaluation, the algorithm is better than the classic dark channel algorithm in the overall and details.

  12. Deformation localization and dislocation channel dynamics in neutron-irradiated austenitic stainless steels

    Energy Technology Data Exchange (ETDEWEB)

    Gussev, Maxim N., E-mail: gussevmn@ornl.gov; Field, Kevin G.; Busby, Jeremy T.

    2015-05-15

    The dynamics of deformation localization and dislocation channel formation were investigated in situ in a neutron-irradiated AISI 304 austenitic stainless steel and a model 304-based austenitic alloy by combining several analytical techniques including optic microscopy and laser confocal microscopy, scanning electron microscopy, electron backscatter diffraction, and transmission electron microscopy (TEM). Channel formation was observed at ∼70% of the polycrystalline yield stress of the irradiated materials (σ{sub 0.2}). It was shown that triple junction points do not always serve as a source of dislocation channels; at stress levels below the σ{sub 0.2}, channels often formed near the middle of the grain boundary. For a single grain, the role of elastic stiffness value (Young’s modulus) in channel formation was analyzed; it was shown that in the irradiated 304 steels the initial channels appeared in “soft” grains with a high Schmid factor located near “stiff” grains with high elastic stiffness. The spatial organization of channels in a single grain was analyzed; it was shown that secondary channels operating in the same slip plane as primary channels often appeared at the middle or at one-third of the way between primary channels. The twinning nature of dislocation channels was analyzed for grains of different orientation using TEM. In the AISI 304 steel, channels in grains oriented close to 〈0 0 1〉||TA (tensile axis) and 〈1 0 1〉||TA were twin free and grain with 〈1 1 1〉||TA and grains oriented close to a Schmid factor maximum contained deformation twins.

  13. State-Dependent Inhibition of Sodium Channels by Local Anesthetics: A 40-Year Evolution.

    Science.gov (United States)

    Wang, G-K; Strichartz, G R

    2012-04-01

    Knowledge about the mechanism of impulse blockade by local anesthetics has evolved over the past four decades, from the realization that Na(+) channels were inhibited to affect the impulse blockade to an identification of the amino acid residues within the Na(+) channel that bind the local anesthetic molecule. Within this period appreciation has grown of the state-dependent nature of channel inhibition, with rapid binding and unbinding at relatively high affinity to the open state, and weaker binding to the closed resting state. Slow binding of high affinity for the inactivated state accounts for the salutary therapeutic as well as the toxic actions of diverse class I anti-arrhythmic agents, but may have little importance for impulse blockade, which requires concentrations high enough to block the resting state. At the molecular level, residues on the S6 transmembrane segments in three of the homologous domains of the channel appear to contribute to the binding of local anesthetics, with some contribution also from parts of the selectivity filter. Binding to the inactivated state, and perhaps the open state, involves some residues that are not identical to those that bind these drugs in the resting state, suggesting spatial flexibility in the "binding site". Questions remaining include the mechanism that links local anesthetic binding with the inhibition of gating charge movements, and the molecular nature of the theoretical "hydrophobic pathway" that may be critical for determining the recovery rates from blockade of closed channels, and thus account for both therapeutic and cardiotoxic actions. PMID:23710324

  14. Exposing the Molecular Machinery of BK Polyomavirus.

    Science.gov (United States)

    Buck, Christopher B

    2016-04-01

    BK polyomavirus (BKV) is an opportunistic pathogen that poses a serious threat to organ transplant recipients. In this issue of Structure, Hurdiss and colleagues' (Hurdiss et al., 2016) beautiful new high-resolution cryo-EM reconstruction of BKV provides a structural roadmap for the ongoing development of therapeutic antibodies and vaccines targeting this potentially deadly virus. The study also serves as a platform for exploring the basic biology of virion assembly and infectious entry. PMID:27050683

  15. The H2BK123Rgument

    OpenAIRE

    Latham, John A.; Dent, Sharon Y. R.

    2009-01-01

    The discovery of trans-regulation of histone H3K4 methylation by ubiquitination of histone H2BK123 generated much excitement in the field of chromatin biology. Recently, the veracity of this example of cross talk between histone modifications in yeast was challenged (Foster and Downs, 2009. J. Cell Biol. doi:10.1083/jcb.200812088) but ultimately reconfirmed in a study in this issue (Nakanishi et al., 2009. J. Cell Biol. doi:10.1083/jcb.200906005).

  16. Influence of Global and Local Membrane Curvature on Mechanosensitive Ion Channels: A Finite Element Approach

    Directory of Open Access Journals (Sweden)

    Omid Bavi

    2016-02-01

    Full Text Available Mechanosensitive (MS channels are ubiquitous molecular force sensors that respond to a number of different mechanical stimuli including tensile, compressive and shear stress. MS channels are also proposed to be molecular curvature sensors gating in response to bending in their local environment. One of the main mechanisms to functionally study these channels is the patch clamp technique. However, the patch of membrane surveyed using this methodology is far from physiological. Here we use continuum mechanics to probe the question of how curvature, in a standard patch clamp experiment, at different length scales (global and local affects a model MS channel. Firstly, to increase the accuracy of the Laplace’s equation in tension estimation in a patch membrane and to be able to more precisely describe the transient phenomena happening during patch clamping, we propose a modified Laplace’s equation. Most importantly, we unambiguously show that the global curvature of a patch, which is visible under the microscope during patch clamp experiments, is of negligible energetic consequence for activation of an MS channel in a model membrane. However, the local curvature (RL < 50 and the direction of bending are able to cause considerable changes in the stress distribution through the thickness of the membrane. Not only does local bending, in the order of physiologically relevant curvatures, cause a substantial change in the pressure profile but it also significantly modifies the stress distribution in response to force application. Understanding these stress variations in regions of high local bending is essential for a complete understanding of the effects of curvature on MS channels.

  17. Association of renal adenocarcinoma and BK virus nephropathy post transplantation.

    Science.gov (United States)

    Kausman, Joshua Yehuda; Somers, Gino Rene; Francis, David Michael; Jones, Colin Lindsay

    2004-04-01

    While most BK virus infections are asymptomatic, immunosuppression has been associated with BK virus reactivation and impaired graft function or ureteric ulceration in renal transplant patients and hemorrhagic cystitis in bone marrow transplant patients. Oncogenicity is also postulated and this is the first report of a child with a carcinoma of the donor renal pelvis following BK virus allograft nephropathy. Removal of the primary tumor and cessation of immunosuppression led to regression of secondary tumors and a return to health. PMID:14986088

  18. Linear Universal Decoding for Compound Channels: a Local to Global Geometric Approach

    CERN Document Server

    Abbe, Emmanuel

    2008-01-01

    Over discrete memoryless channels (DMC), linear decoders (maximizing additive metrics) afford several nice properties. In particular, if suitable encoders are employed, the use of decoding algorithm with manageable complexities is permitted. Maximum likelihood is an example of linear decoder. For a compound DMC, decoders that perform well without the channel's knowledge are required in order to achieve capacity. Several such decoders have been studied in the literature. However, there is no such known decoder which is linear. Hence, the problem of finding linear decoders achieving capacity for compound DMC is addressed, and it is shown that under minor concessions, such decoders exist and can be constructed. This paper also develops a "local geometric analysis", which allows in particular, to solve the above problem. By considering very noisy channels, the original problem is reduced, in the limit, to an inner product space problem, for which insightful solutions can be found. The local setting can then provi...

  19. 78 FR 33219 - Special Local Regulations; Swim Across the Potomac, Potomac River; National Harbor Access Channel...

    Science.gov (United States)

    2013-06-04

    ... INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... Access Channel, MD'' in the Federal Register (78 FR 67). We received no comments on the proposed rule. No... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulations; Swim Across the...

  20. 78 FR 34881 - Special Local Regulations; Marine Events, Wrightsville Channel; Wrightsville Beach, NC

    Science.gov (United States)

    2013-06-11

    ... INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... Rulemaking for this event in the Federal Register (78 FR 19155). We received no comments on the proposed rule... Guard is establishing a Special Local Regulation for the ``Swim the Loop/Motts Channel Sprint''...

  1. Fusion and quasifission dynamics in the reactions 48Ca+249Bk and 50Ti+249Bk using a time-dependent Hartree-Fock approach

    Science.gov (United States)

    Umar, A. S.; Oberacker, V. E.; Simenel, C.

    2016-08-01

    Background: Synthesis of superheavy elements (SHEs) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHEs have been recently produced with doubly-magic 48Ca beams. However, SHE synthesis experiments with single-magic 50Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for Z =117 ,119 superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in 48Ca,50Ti+249Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleus-nucleus potentials, nuclear contact times, masses and charges of the fragments, as well as their kinetic and excitation energies strongly depend on the orientation of the prolate 249Bk nucleus. Long contact times associated with fusion are observed in collisions of both projectiles with the side of the 249Bk nucleus, but not on collisions with its tip. The energy and impact parameter dependencies of the fragment properties, as well as their mass-angle and mass-total kinetic energy correlations are investigated. Conclusions: Entrance channel reaction dynamics are similar with both 48Ca and 50Ti projectiles. Both are expected to lead to the formation of a compound nucleus by fusion if they have enough energy to get in contact with the side of the 249Bk target.

  2. Local Void Fraction Distribution and Flow Visualization in Core Catcher Coolant Channel

    Energy Technology Data Exchange (ETDEWEB)

    Song, K. W.; Hung, N. T.; Park, H. S.; Revankara, S. T. [POSTECH, Pohang (Korea, Republic of); Ha, K. S.; Song, J. H. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    Due to thermal induced density differences of working fluids, natural circulation two-phase flow passively removes heat from the captured corium. To have a better knowledge of cooling performance inside of the channel, it is important to know two-phase structure inside of the cooling channel. The prediction of the two-phase flow behavior has a limitation in such a complex geometry with large hydraulic diameter. Therefore, in this study, testing of two-phase natural circulation using air-water in a full height facility is conducted specifically to visualize and study the two-phase flow structure near the channel surface. By using conductivity probe, time-averaged local void fraction distribution along the channel is obtained. At the same time, mixing and bubble breakup process at the elbow-bend is observed using high speed camera videos. The impact of the two phase flow behavior near the core plate on the cooling performance is analyzed based on the results. Time-averaged local void fraction is measured and analyzed especially near the top surface of channel to predict cooling performance of core catcher system. Bubble breakup due to water ingression and the mixing phenomena are observed by high speed camera view.

  3. The use of kernel local Fisher discriminant analysis for the channelization of the Hotelling model observer

    Science.gov (United States)

    Wen, Gezheng; Markey, Mia K.

    2015-03-01

    It is resource-intensive to conduct human studies for task-based assessment of medical image quality and system optimization. Thus, numerical model observers have been developed as a surrogate for human observers. The Hotelling observer (HO) is the optimal linear observer for signal-detection tasks, but the high dimensionality of imaging data results in a heavy computational burden. Channelization is often used to approximate the HO through a dimensionality reduction step, but how to produce channelized images without losing significant image information remains a key challenge. Kernel local Fisher discriminant analysis (KLFDA) uses kernel techniques to perform supervised dimensionality reduction, which finds an embedding transformation that maximizes betweenclass separability and preserves within-class local structure in the low-dimensional manifold. It is powerful for classification tasks, especially when the distribution of a class is multimodal. Such multimodality could be observed in many practical clinical tasks. For example, primary and metastatic lesions may both appear in medical imaging studies, but the distributions of their typical characteristics (e.g., size) may be very different. In this study, we propose to use KLFDA as a novel channelization method. The dimension of the embedded manifold (i.e., the result of KLFDA) is a counterpart to the number of channels in the state-of-art linear channelization. We present a simulation study to demonstrate the potential usefulness of KLFDA for building the channelized HOs (CHOs) and generating reliable decision statistics for clinical tasks. We show that the performance of the CHO with KLFDA channels is comparable to that of the benchmark CHOs.

  4. Local anesthetic and antiepileptic drug access and binding to a bacterial voltage-gated sodium channel.

    Science.gov (United States)

    Boiteux, Céline; Vorobyov, Igor; French, Robert J; French, Christopher; Yarov-Yarovoy, Vladimir; Allen, Toby W

    2014-09-01

    Voltage-gated sodium (Nav) channels are important targets in the treatment of a range of pathologies. Bacterial channels, for which crystal structures have been solved, exhibit modulation by local anesthetic and anti-epileptic agents, allowing molecular-level investigations into sodium channel-drug interactions. These structures reveal no basis for the "hinged lid"-based fast inactivation, seen in eukaryotic Nav channels. Thus, they enable examination of potential mechanisms of use- or state-dependent drug action based on activation gating, or slower pore-based inactivation processes. Multimicrosecond simulations of NavAb reveal high-affinity binding of benzocaine to F203 that is a surrogate for FS6, conserved in helix S6 of Domain IV of mammalian sodium channels, as well as low-affinity sites suggested to stabilize different states of the channel. Phenytoin exhibits a different binding distribution owing to preferential interactions at the membrane and water-protein interfaces. Two drug-access pathways into the pore are observed: via lateral fenestrations connecting to the membrane lipid phase, as well as via an aqueous pathway through the intracellular activation gate, despite being closed. These observations provide insight into drug modulation that will guide further developments of Nav inhibitors. PMID:25136136

  5. Channel-aware distributed classification in wireless sensor networks using binary local decisions

    Science.gov (United States)

    Fanaei, Mohammad; Valenti, Matthew C.; Schmid, Natalia A.; Kulathumani, Vinodkrishnan

    2011-06-01

    This paper considers the problem of distributed multi-hypothesis classification in the context of wireless sensor networks. The goal is to reliably classify an underlying hypothesis at a fusion center using simple localized decisions at individual sensors. The fusion-center classification must be performed despite the presence of faults in both local sensor decisions and transmission channels between the sensors and fusion center. Local sensor nodes make binary classifications based on their noisy observations and send their decisions to the fusion center through parallel additive white Gaussian noise channels. The fusion center then uses these noisy versions of local decisions to perform a global classification. In contrast with other similar approaches for multi-hypothesis classification based on combined binary decisions, our approach exploits the relationship between the influence fields of different hypotheses and the accumulated noisy versions of local binary decisions as received by the fusion center, where the influence field of a hypothesis is defined to be the spatial region in its surrounding in which it can be sensed using some specific modality. The main contribution of this paper is the formulation of local and fusion decision rules that maximize the probability of correct global classification at the fusion center, along with an algorithm for channel-aware global optimization of the local and fusion center decision thresholds. The performance of the proposed classification system is investigated through practical scenarios. Performance analysis results show that the proposed approach could simplify decision making at local sensors while achieving acceptable performance in terms of the global probability of correct classification at the fusion center.

  6. Dual channel rank-based intensity weighting for quantitative co-localization of microscopy images

    LENUS (Irish Health Repository)

    Singan, Vasanth R

    2011-10-21

    Abstract Background Accurate quantitative co-localization is a key parameter in the context of understanding the spatial co-ordination of molecules and therefore their function in cells. Existing co-localization algorithms consider either the presence of co-occurring pixels or correlations of intensity in regions of interest. Depending on the image source, and the algorithm selected, the co-localization coefficients determined can be highly variable, and often inaccurate. Furthermore, this choice of whether co-occurrence or correlation is the best approach for quantifying co-localization remains controversial. Results We have developed a novel algorithm to quantify co-localization that improves on and addresses the major shortcomings of existing co-localization measures. This algorithm uses a non-parametric ranking of pixel intensities in each channel, and the difference in ranks of co-localizing pixel positions in the two channels is used to weight the coefficient. This weighting is applied to co-occurring pixels thereby efficiently combining both co-occurrence and correlation. Tests with synthetic data sets show that the algorithm is sensitive to both co-occurrence and correlation at varying levels of intensity. Analysis of biological data sets demonstrate that this new algorithm offers high sensitivity, and that it is capable of detecting subtle changes in co-localization, exemplified by studies on a well characterized cargo protein that moves through the secretory pathway of cells. Conclusions This algorithm provides a novel way to efficiently combine co-occurrence and correlation components in biological images, thereby generating an accurate measure of co-localization. This approach of rank weighting of intensities also eliminates the need for manual thresholding of the image, which is often a cause of error in co-localization quantification. We envisage that this tool will facilitate the quantitative analysis of a wide range of biological data sets

  7. Three-dimensional Sound Source Localization Using Inter-channel Time Difference Trajectory

    Directory of Open Access Journals (Sweden)

    Sangmoon Lee

    2015-12-01

    Full Text Available Sound source localization is one of the basic and essential techniques for intelligent robots in terms of human-robot interaction and has been utilized in various engineering fields. This paper suggests a new localization method using an inter-channel time difference trajectory, which is a new localization cue for efficient 3-D localization. As one of the ways to realize the proposed cue, a two-channel rotating array is employed. Two microphones are attached on the left and right sides of the spherical head. One microphone is in a circular motion on the right side, while the other is fixed on the left side. According to the rotating motion of the array, the (source direction-dependent characteristics of the trajectories are analysed using the Ray-Tracing formula extended for 3-D models. In simulation, the synthesized signals generated by the fixed and rotating microphone signal models were used as the output signals of the two microphones. The simulation showed that the localization performance is strongly dependent on the azimuthal position of a source, which is caused by the asymmetry of the trajectory amplitude. Additionally, the experimental results of the two experiments carried out in the room environment demonstrated that the proposed system can localize a Gaussian noise source and a voice source in 3-D space.

  8. Robust topological surface transport with weak localization bulk channels in polycrystalline Bi2Te3 films

    International Nuclear Information System (INIS)

    Bi2Te3 polycrystalline topological insulator films have provided an attractive material platform to investigate topological insulator properties and created new opportunities for novel magneto-electronic device applications. In order to confirm that Bi2Te3 polycrystalline film has a robust topological surface state, and whether such surface Dirac fermions can be protected from localization in transport, we performed a systematic transport measurement and analysis based on a Sn-doped Bi2Te3 polycrystalline film with Hall configuration electrodes. We demonstrated that the electron–electron interaction effect is very strong, which can help realize an insulating ground state. The surface state of the film always exhibits stable weak anti-localization features despite the presence of many structural defects and non-magnetic doping, and the Hall resistance can present a significant nonlinear dependence on magnetic fields. These two characteristics provide significant experimental evidence that the polycrystalline film has a robust topological surface state, and that such surface electrons cannot be localized. Owing to the lack of topological protection, the weak anti-localization transport of bulk electrons cannot be guaranteed, and weak localization behavior may appear in the bulk channels. These results verify that robust topological surface transport in topological insulator polycrystalline films can be accompanied by weak localization bulk channels. (paper)

  9. Bedform migration in steep channels: from local avalanches to large scale changes

    Science.gov (United States)

    Mettra, F.; Heyman, J.; Ancey, C.

    2013-12-01

    flume angles and produced intense solid discharge pulses. Moreover, small avalanches occurred on the steep lee sides of antidunes. From these results, we infer a mechanism of steep channel evolution. The time- and space-averaged profile of the bed in the streamwise direction depends on the experimental parameters. Variations in the profile result mainly from bedform migration. The instantaneous global state of the bed (which can be characterized by the global channel slope) controls the growth of bedforms, which can be seen as local instabilities. When the global channel slope approaches its critical value, local instabilities of higher amplitude can develop and create intense bedload transport pulses, leading to a less steep, but more stable bed profile.

  10. Effect of Local Junction Losses in the Optimization of T-shaped Flow Channels

    Science.gov (United States)

    Kosaraju, Srinivas

    2015-11-01

    T-shaped channels are extensively used in flow distribution applications such as irrigation, chemical dispersion, gas pipelines and space heating and cooling. The geometry of T-shaped channels can be optimized to reduce the overall pressure drop in stem and branch sections. Results of such optimizations are in the form of geometric parameters such as the length and diameter ratios of the stem and branch sections. The traditional approach of this optimization accounts for the pressure drop across the stem and branch sections, however, ignores the pressure drop in the T-junction. In this paper, we conduct geometry optimization while including the effect of local junction losses in laminar flows. From the results, we are able to identify a non-dimensional parameter that can be used to predict the optimal geometric configurations. This parameter can also be used to identify the conditions in which the local junction losses can be ignored during the optimization.

  11. Direct numerical simulation analysis of local flow topology in a particle-laden turbulent channel flow

    OpenAIRE

    Bijlard, M.J.; Oliemans, R.V.A.; Portela, L.M.; Ooms, G.

    2010-01-01

    The results of point-particle Eulerian–Lagrangian direct numerical simulation (DNS) calculations of dilute particle-laden turbulent channel flow are used to study the effect of the particles on the local flow topology. It is found that in the viscous sublayer, the flow becomes increasingly more two-dimensional as the two-way coupling effect (due to interaction between particles and fluid flow) increases with increasing particle load. Beyond the viscous sublayer the modifications in flow topol...

  12. Gluon density and $F_{2}$ functions from BK equation with impact parameter dependence in DIS on nuclei

    CERN Document Server

    Sergey, Bondarenko

    2008-01-01

    The DIS process on nuclei is considered in the framework of LO BK equation with local impact parameter dependence. Solving BK equation parameters for initial conditions of GBW type found in \\cite{Serg1} were used. Integrated gluon density function and $F_2$ nucleus structure function for different nuclei are calculated. Obtained results are compared with the different parameterizations of integrated gluon density function from \\cite{Flor,Eskola1,Eskola2,Tywon}. The anomalous dimensions and saturation scales for different nuclei are calculated at different energies. Fitting obtained results, expressions for the form of saturation scale are obtained for the proton and different nuclei as functions of impact parameter and energy.

  13. Single Channel Recordings Reveal Differential β2 Subunit Modulations Between Mammalian and Drosophila BKCa(β2) Channels

    Science.gov (United States)

    Zhong, Ling; Guo, Xiying; Weng, Anxi; Xiao, Feng; Zeng, Wenping; Zhang, Yan; Ding, Jiuping; Hou, Panpan

    2016-01-01

    Large-conductance Ca2+- and voltage-activated potassium (BK) channels are widely expressed in tissues. As a voltage and calcium sensor, BK channels play significant roles in regulating the action potential frequency, neurotransmitter release, and smooth muscle contraction. After associating with the auxiliary β2 subunit, mammalian BK(β2) channels (mouse or human Slo1/β2) exhibit enhanced activation and complete inactivation. However, how the β2 subunit modulates the Drosophila Slo1 channel remains elusive. In this study, by comparing the different functional effects on heterogeneous BK(β2) channel, we found that Drosophila Slo1/β2 channel exhibits “paralyzed”-like and incomplete inactivation as well as slow activation. Further, we determined three different modulations between mammalian and Drosophila BK(β2) channels: 1) dSlo1/β2 doesn’t have complete inactivation. 2) β2(K33,R34,K35) delays the dSlo1/Δ3-β2 channel activation. 3) dSlo1/β2 channel has enhanced pre-inactivation than mSlo1/β2 channel. The results in our study provide insights into the different modulations of β2 subunit between mammalian and Drosophila Slo1/β2 channels and structural basis underlie the activation and pre-inactivation of other BK(β) complexes. PMID:27755549

  14. Comparison between Two Local Thermal Non Equilibrium Criteria in Forced Convection through a Porous Channel

    Directory of Open Access Journals (Sweden)

    azzedine ABDEDOU

    2015-01-01

    Full Text Available Two criteria are used and compared to investigate the local thermal equilibrium assumption in a forced convection through a porous channel. The first criterion is based on the maximum local temperature difference between the solid and fluid phases, while the second is based on the average of the local differences between the temperature of the solid phase and the fluid phase. For this purpose, the momentum and energy equations based on the Darcy-Brinkman-Forchheimer and the local thermal non equilibrium models are solved numerically using the finite volume method. The analysis focused on searching thermophysical parameters ranges which validate local thermal equilibrium hypothesis. Thus, by using the two criteria, the obtained results mainly revealed that this local thermal equilibrium assumption is verified for low thermal conductivity ratio and Reynolds number values and for high interstitial Biot number and porosity, while it is unfavorably affected by the high values of Prandtl number. However, it is also found that the parameters ranges corresponding to the local equilibrium validity depends on the selected local thermal non equilibrium criterion.

  15. Systematic study of spatiotemporal dynamics of intense femtosecond laser pulses in BK-7 glass

    Indian Academy of Sciences (India)

    Ram Gopal; V Deepak; S Sivaramakrishnan

    2007-04-01

    In this paper we present a systematic study of the spatial and temporal effects of intense femtosecond laser pulses in BK-7 over a broad range of input powers, 1–1000 times the critical power for self-focusing (cr) by numerically solving the nonlinear Schrödinger equation (NLS). Most numerical studies have not been extended to such high powers. A clear-cut classification of spatio-temporal dynamics up to very high powers into three regimes – the group-velocity dispersion (GVD) regime, the ionization regime and the dominant plasma regime – as done here, is a significant step towards a better understanding. Further, we examine in detail the role of GVD in channel formation by comparing BK-7 to an `artificial' medium. Our investigations bring forth the important observation that diffraction plays a minimal role in the formation of multiple cones and that plasma plays a diffraction-like role at very high powers. A detailed study of the spatio-temporal dynamics in any condensed medium over this range of powers has not been reported hitherto, to the best of our knowledge. We also suggest appropriate operational powers for various applications employing BK-7 on the basis of our results.

  16. Single-thread channels resulting from a localization process driven by vegetation

    Science.gov (United States)

    Narteau, C.; Tal, M.

    2009-12-01

    The unpredictable manner in which braided rivers evolve is in stark contrast to the orderly migration pattern of meandering rivers driven by erosion along outer bends and deposition along inner banks. Braided channels are the default pattern that develops when an unbounded water flow interacts with noncohesive sediment. A series of laboratory experiments demonstrated that plants alone are able to achieve the two key mechanisms to developing meandering: slowing the rate of widening and discouraging channel cutoffs. Plants initially colonized braid-bars that were emergent during low flow. By adding cohesion to the sediment and increasing roughness, vegetation deterred the flow from reoccupying areas which were colonized. By decreasing erosion rates, plants made it possible for deposition along the inner bank to match the rate of erosion along the outer bank. This enabled the channel to develop sinuosity and migrate laterally while suppressing channel splitting and the creation of new channel width. Areas with established vegetation provided stable conditions which promoted new seedling establishment and expansion of the vegetated area. A generic mechanism of width production in the braided state is the opportunistic creation of new channels. As existing flow paths become slightly less favorable, for example by bar deposition or an increase in sinuosity, new ones are readily created in areas that are not currently occupied by flow. By making it more difficult for flow to occupy vegetated areas, plants in effect decouple the transition between wet and dry areas, making it harder for areas that are dry (vegetated) to turn wet (reoccupied by flow) and less likely for areas that are wet to become dry. The net effect is localization of the flow into a single-thread channel with transitions between wet and dry occurring predominantly along the channel margin and driving lateral migration while a single-thread channel remains intact. We are using a 1D cellular automata model

  17. Sum-capacity of Interference Channels with a Local View: Impact of Distributed Decisions

    CERN Document Server

    Aggarwal, Vaneet; Sabharwal, Ashutosh

    2009-01-01

    Due to the large size of wireless networks, it is often impractical for nodes to track changes in the complete network state. As a result, nodes have to make distributed decisions about their transmission and reception parameters based on their local view of the network. In this paper, we characterize the impact of distributed decisions on the global network performance in terms of achievable sum-rates. We first formalize the concept of local view by proposing a protocol abstraction using the concept of local message passing. In the proposed protocol, nodes forward information about the network state to other neighboring nodes, thereby allowing network state information to trickle to all the nodes. The protocol proceeds in rounds, where all transmitters send a message followed by a message by all receivers. The number of rounds then provides a natural metric to quantify the extent of local information at each node. We next study three network connectivities, Z-channel, a three-user double Z-channel and a redu...

  18. Molecular networks involved in the immune control of BK polyomavirus.

    Science.gov (United States)

    Girmanova, Eva; Brabcova, Irena; Klema, Jiri; Hribova, Petra; Wohlfartova, Mariana; Skibova, Jelena; Viklicky, Ondrej

    2012-01-01

    BK polyomavirus infection is the important cause of virus-related nephropathy following kidney transplantation. BK virus reactivates in 30%-80% of kidney transplant recipients resulting in BK virus-related nephropathy in 1%-10% of cases. Currently, the molecular processes associated with asymptomatic infections in transplant patients infected with BK virus remain unclear. In this study we evaluate intrarenal molecular processes during different stages of BKV infection. The gene expression profiles of 90 target genes known to be associated with immune response were evaluated in kidney graft biopsy material using TaqMan low density array. Three patient groups were examined: control patients with no evidence of BK virus reactivation (n = 11), infected asymptomatic patients (n = 9), and patients with BK virus nephropathy (n = 10). Analysis of biopsies from asymptomatic viruria patients resulted in the identification of 5 differentially expressed genes (CD3E, CD68, CCR2, ICAM-1, and SKI) (P < 0.05), and functional analysis showed a significantly heightened presence of costimulatory signals (e.g., CD40/CD40L; P < 0.05). Gene ontology analysis revealed several biological networks associated with BKV immune control in comparison to the control group. This study demonstrated that asymptomatic BK viruria is associated with a different intrarenal regulation of several genes implicating in antiviral immune response.

  19. Molecular Networks Involved in the Immune Control of BK Polyomavirus

    Directory of Open Access Journals (Sweden)

    Eva Girmanova

    2012-01-01

    Full Text Available BK polyomavirus infection is the important cause of virus-related nephropathy following kidney transplantation. BK virus reactivates in 30%–80% of kidney transplant recipients resulting in BK virus-related nephropathy in 1%–10% of cases. Currently, the molecular processes associated with asymptomatic infections in transplant patients infected with BK virus remain unclear. In this study we evaluate intrarenal molecular processes during different stages of BKV infection. The gene expression profiles of 90 target genes known to be associated with immune response were evaluated in kidney graft biopsy material using TaqMan low density array. Three patient groups were examined: control patients with no evidence of BK virus reactivation (n=11, infected asymptomatic patients (n=9, and patients with BK virus nephropathy (n=10. Analysis of biopsies from asymptomatic viruria patients resulted in the identification of 5 differentially expressed genes (CD3E, CD68, CCR2, ICAM-1, and SKI (P<0.05, and functional analysis showed a significantly heightened presence of costimulatory signals (e.g., CD40/CD40L; P<0.05. Gene ontology analysis revealed several biological networks associated with BKV immune control in comparison to the control group. This study demonstrated that asymptomatic BK viruria is associated with a different intrarenal regulation of several genes implicating in antiviral immune response.

  20. Molecular mechanisms of diabetic coronary dysfunction due to large conductance Ca2+-activated K+ channel impairment

    Institute of Scientific and Technical Information of China (English)

    WANG Ru-xing; ZHENG Jie; GUO Su-xia; LI Xiao-rong; LU Tong; SHI Hai-feng; CHAI Qiang; WU Ying; SUN Wei; JI Yuan; YAO Yong; LI Ku-lin; ZHANG Chang-ying

    2012-01-01

    Background Diabetes mellitus is associated with coronary dysfunction,contributing to a 2- to 4-fold increase in the risk of coronary heart diseases.The mechanisms by which diabetes induces vasculopathy involve endothelial-dependent and -independent vascular dysfunction in both type 1 and type 2 diabetes mellitus.The purpose of this study is to determine the role of vascular large conductance Ca2+-activated K+ (BK) channel activities in coronary dysfunction in streptozotocin-induced diabetic rats.Methods Using videomicroscopy,immunoblotting,fluorescent assay and patch clamp techniques,we investigated the coronary BK channel activities and BK channel-mediated coronary vasoreactivity in streptozotocin-induced diabetic rats.Results BK currents (defined as the iberiotoxin-sensitive K+ component) contribute (65±4)% of the total K+ currents in freshly isolated coronary smooth muscle cells and >50% of the contraction of the inner diameter of coronary arteries from normal rats.However,BK current density is remarkably reduced in coronary smooth muscle cells of streptozotocin-induced diabetic rats,leading to an increase in coronary artery tension.BK channel activity in response to free Ca2+ is impaired in diabetic rats.Moreover,cytoplasmic application of DHS-1 (a specific BK channel β1 subunit activator) robustly enhanced the open probability of BK channels in coronary smooth muscle cells of normal rats.In diabetic rats,the DHS-1 effect was diminished in the presence of 200 nmol/L Ca2+ and was significantly attenuated in the presence of high free calcium concentration,i.e.,1 μmol/L Ca2+.Immunoblotting experiments confirmed that there was a 2-fold decrease in BK-β1 protein expression in diabetic vessels,without altering the BK channel α-subunit expression.Although the cytosolic Ca2+ concentration of coronary arterial smooth muscle cells was increased from (103±23)nmol/L (n=5) of control rats to (193±22) nmol/L (n=6,P<0.05) of STZ-induced diabetic rats,reduced BK

  1. Multi-Channel Three-Dimensional SOLA Inversion for Local Helioseismology

    CERN Document Server

    Jackiewicz, J; Gizon, L; Hanasoge, S M; Hohage, T; Ruffio, J -B; Svanda, M

    2011-01-01

    Inversions for local helioseismology are an important and necessary step for obtaining three-dimensional maps of various physical quantities in the solar interior. Frequently, the full inverse problems that one would like to solve prove intractable because of computational constraints. Due to the enormous seismic data sets that already exist and those forthcoming, this is a problem that needs to be addressed. To this end, we present a very efficient linear inversion algorithm for local helioseismology. It is based on a subtractive optimally localized averaging (SOLA) scheme in the Fourier domain, utilizing the horizontal-translation invariance of the sensitivity kernels. In Fourier space the problem decouples into many small problems, one for each horizontal wave vector. This multi-channel SOLA method is demonstrated for an example problem in time-distance helioseismology that is small enough to be solved both in real and Fourier space. We find that both approaches are successful in solving the inverse proble...

  2. Trypsin-Sensitive, Rapid Inactivation of a Calcium-Activated Potassium Channel

    Science.gov (United States)

    Solaro, Christopher R.; Lingle, Christopher J.

    1992-09-01

    Most calcium-activated potassium channels couple changes in intracellular calcium to membrane excitability by conducting a current with a probability that depends directly on submembrane calcium concentration. In rat adrenal chromaffin cells, however, a large conductance, voltage- and calcium-activated potassium channel (BK) undergoes rapid inactivation, suggesting that this channel has a physiological role different than that of other BK channels. The inactivation of the BK channel, like that of the voltage-gated Shaker B potassium channel, is removed by trypsin digestion and channels are blocked by the Shaker B amino-terminal inactivating domain. Thus, this BK channel shares functional and possibly structural homologies with other inactivating voltage-gated potassium channels.

  3. Bisphenol A binds to the local anesthetic receptor site to block the human cardiac sodium channel.

    Directory of Open Access Journals (Sweden)

    Andrias O O'Reilly

    Full Text Available Bisphenol A (BPA has attracted considerable public attention as it leaches from plastic used in food containers, is detectable in human fluids and recent epidemiologic studies link BPA exposure with diseases including cardiovascular disorders. As heart-toxicity may derive from modified cardiac electrophysiology, we investigated the interaction between BPA and hNav1.5, the predominant voltage-gated sodium channel subtype expressed in the human heart. Electrophysiology studies of heterologously-expressed hNav1.5 determined that BPA blocks the channel with a K(d of 25.4±1.3 µM. By comparing the effects of BPA and the local anesthetic mexiletine on wild type hNav1.5 and the F1760A mutant, we demonstrate that both compounds share an overlapping binding site. With a key binding determinant thus identified, an homology model of hNav1.5 was generated based on the recently-reported crystal structure of the bacterial voltage-gated sodium channel NavAb. Docking predictions position both ligands in a cavity delimited by F1760 and contiguous with the DIII-IV pore fenestration. Steered molecular dynamics simulations used to assess routes of ligand ingress indicate that the DIII-IV pore fenestration is a viable access pathway. Therefore BPA block of the human heart sodium channel involves the local anesthetic receptor and both BPA and mexiletine may enter the closed-state pore via membrane-located side fenestrations.

  4. Immunohistochemical Localization of the Water Channels AQP4 and AQP5 in the Rat Pituitary Gland

    International Nuclear Information System (INIS)

    The pituitary gland is composed of the adenohypophysis and neurohypophysis. The adenohypophysis contains endocrine cells, folliculo-stellate (FS) cells, and marginal layer cells, whereas the neurohypophysis mainly comprises axons and pituicytes. To understand the molecular nature of water transfer in the pituitary gland, we examined the immunohistochemical localization of the membrane water channels aquaporin-4 (AQP4) and AQP5 in rat tissue. Double immunofluorescence analysis of AQP4 and S100 protein, a known marker for FS cells, marginal layer cells, and pituicytes, clearly revealed that FS cells and marginal layer cells in the adenohypophysis and the pituicytes in pars nervosa are positive for AQP4. AQP5 was found to be localized at the apical membrane in some marginal layer cells surrounding the Rathke’s residual pouch, in which AQP4 was observed to be localized on the basolateral membranes. These results suggest the following possibilities: 1) FS cells especially require water for their functions and 2) transepithelial water transfer could occur between the lumen of Rathke’s residual pouch and the interstitial fluid in the adenohypophysis through the AQP4 and AQP5 channels in the marginal layer cells

  5. The Combined Effect of Hydrophobic Mismatch and Bilayer Local Bending on the Regulation of Mechanosensitive Ion Channels.

    Science.gov (United States)

    Bavi, Omid; Vossoughi, Manouchehr; Naghdabadi, Reza; Jamali, Yousef

    2016-01-01

    The hydrophobic mismatch between the lipid bilayer and integral membrane proteins has well-defined effect on mechanosensitive (MS) ion channels. Also, membrane local bending is suggested to modulate MS channel activity. Although a number of studies have already shown the significance of each individual factor, the combined effect of these physical factors on MS channel activity have not been investigated. Here using finite element simulation, we study the combined effect of hydrophobic mismatch and local bending on the archetypal mechanosensitive channel MscL. First we show how the local curvature direction impacts on MS channel modulation. In the case of MscL, we show inward (cytoplasmic) bending can more effectively gate the channel compared to outward bending. Then we indicate that in response to a specific local curvature, MscL inserted in a bilayer with the same hydrophobic length is more expanded in the constriction pore region compared to when there is a protein-lipid hydrophobic mismatch. Interestingly in the presence of a negative mismatch (thicker lipids), MscL constriction pore is more expanded than in the presence of positive mismatch (thinner lipids) in response to an identical membrane curvature. These results were confirmed by a parametric energetic calculation provided for MscL gating. These findings have several biophysical consequences for understanding the function of MS channels in response to two major physical stimuli in mechanobiology, namely hydrophobic mismatch and local membrane curvature. PMID:26958847

  6. Local indigenous knowledge about some medicinal plants in and around Kakamega forest in western Kenya [v2; ref status: indexed, http://f1000r.es/UDNyBK

    Directory of Open Access Journals (Sweden)

    Nickson Erick Otieno

    2012-12-01

    Full Text Available Kakamega forest is Kenya’s only rainforest and is distinguishably rich in biodiversity but threatened by agricultural encroachment and other forms of human activity. It is also one of Kenya’s Important Bird Areas and a significant source of natural products to neighboring rural communities, such as medicinal plants, food, wood and other fibers. By using structured questionnaires for direct interviews, local indigenous knowledge was tapped through involvement of a focal group of elderly key informants in three blocks of the forest. Forty key species of medicinal plants used by local people were identified and recorded. Fifty-five percent of these were shrubs, thirty-two percent trees, seven-and-a-half percent lower plants such as herbs or forbs while five percent were climbers. About seventy percent of the medicinal plants occurred inside the forest itself and thirty percent around the edge and the immediate surroundings outside the forest. Thirty-eight (95% of the plants were indigenous to Kenya and two (5% exotic. Such extensive indigenous knowledge of the medicinal uses of the plants, including their distribution trends in the forest, may be tapped for decision support in rural health service planning, policy formulation for conserving the forest, tracking and mitigation of climate change impacts.

  7. Polyomavirus BK infection in blood and marrow transplant recipients

    OpenAIRE

    Dropulic, LK; Jones, RJ

    2007-01-01

    The association of BK virus infection with hemorrhagic cystitis in blood and marrow transplant (BMT) recipients was first demonstrated two decades ago. During this time, therapeutic interventions focused on supportive measures such as hyperhydration, continuous bladder irrigation and topical administration of agents that alter the mucosal surface of the bladder wall. In recent years, PCR amplification of viral DNA in the urine and plasma has solidified the association of BK virus infection wi...

  8. Flow of a Casson fluid through a locally-constricted porous channel: a numerical study

    Science.gov (United States)

    Amlimohamadi, Haleh; Akram, Maryammosadat; Sadeghy, Kayvan

    2016-05-01

    Flow of a Casson fluid through a two-dimensional porous channel containing a local constriction is numerically investigated assuming that the resistance offered by the porous medium obeys the Darcy's law. Treating the constriction as another porous medium which obeys the Darcy-Forcheimer model, the equations governing fluid flow in the main channel and the constriction itself are numerically solved using the finite-volume method (FVM) based on the pseudo-transient SIMPLE algorithm. It is shown that an increase in the porosity of the channel decreases the shear stress exerted on the constriction. On the other hand, an increase in the fluid's yield stress is predicted to increase the maximum shear stress experienced by the constriction near its crest. The porosity of the constriction itself is predicted to have a negligible effect on the plaque's shear stress. But, the momentum of the weak flow passing through the constriction is argued to lower the bulk fluid from separating downstream of the constriction.

  9. Using a Modified Lane’s Relation in Local Bed Scouring Studies in the Laboratory Channel

    Directory of Open Access Journals (Sweden)

    Marta Kiraga

    2016-01-01

    Full Text Available Numerous approaches to local scour forming studies have been developed. This paper presents different scientific approaches to the scour phenomenon using Lane’s relation [1] in its modified form during laboratory studies. The original Lane’s relation is applicable in dynamic balance conditions in alluvial rivers context, and it is not an equation, but a qualitative expression which cannot be directly used to estimate the influence of a change in one parameter on the magnitude of others. Lane's relation, despite its qualitative and simplified character, serves well to describe the nature of the process of forming alluvial stream channels, while modified relation allows transforming it into an equation for laboratory studies of local scour forming in prearranged clear-water equilibrium conditions and gives a new opportunity for this principle application.

  10. Polyomavirus specific cellular immunity: from BK-virus-specific cellular immunity to BK-virus-associated nephropathy ?

    Directory of Open Access Journals (Sweden)

    manon edekeyser

    2015-06-01

    Full Text Available In renal transplantation, BK-virus-associated nephropathy has emerged as a major complication, with a prevalence of 5–10% and graft loss in >50% of cases. BK-virus is a member of the Polyomavirus family and rarely induces apparent clinical disease in the general population. However, replication of polyomaviruses, associated with significant organ disease, is observed in patients with acquired immunosuppression, which suggests a critical role for virus-specific cellular immunity to control virus replication and prevent chronic disease. Monitoring of specific immunity combined with viral load could be used to individually assess the risk of viral reactivation and virus control. We review the current knowledge on BK-virus specific cellular immunity and, more specifically, in immunocompromised patients. In the future, immune-based therapies could allow us to treat and prevent BK-virus-associated nephropathy.

  11. BK polyomavirus association with colorectal cancer development.

    Science.gov (United States)

    Khabaz, M N; Nedjadi, T; Gari, M A; Al-Maghrabi, J A; Atta, H M; Basuni, A A; Elderwi, D A

    2016-01-01

    The development of human neoplasms can be provoked by exposure to one of several viruses. Burkitt lymphoma, cervical carcinoma, and hepatocellular carcinoma are associated with Epstein-Barr, human papilloma, and hepatitis B virus infections, respectively. Over the past three decades, many studies have attempted to establish an association between colorectal cancer and viruses, with debatable results. The aim of the present research was to assess the presence of BK polyomavirus (BKV) DNA and protein in colorectal cancer samples from patients in the Western Province of Saudi Arabia. DNA extracted from archival samples of colorectal cancer tissues was analyzed for BKV sequences using polymerase chain reaction (PCR)-based techniques. In addition, expression of a BKV protein was assessed using immunohistochemical staining. None of the tumor and control samples examined tested positive for BKV DNA in PCR assays. Furthermore, immunohistochemical staining failed to detect viral proteins in both cancer and control specimens. These results may indicate that BKV is not associated with the development of colorectal adenocarcinoma in patients in the Western Province of Saudi Arabia. PMID:27173319

  12. Ultimate strength and design of lipped channel columns experiencing local/distortional mode interaction - Part I: Experimental investigation

    OpenAIRE

    Camotim, D.; Silvestre, N.; Young, B

    2009-01-01

    This paper reports the results of an experimental investigation aimed at assessing the post-buckling behaviour and ultimate strength of fixed-ended cold-formed steel lipped channel columns experiencing local/distortional mode interaction. A total of 26 columns were tested and the specimens were carefully selected to ensure various levels of local/distortional interaction effects (more or less close local and distortional critical stresses). The experimental results presented consist of the sp...

  13. dTULP, the Drosophila melanogaster homolog of tubby, regulates transient receptor potential channel localization in cilia.

    Directory of Open Access Journals (Sweden)

    Jina Park

    Full Text Available Mechanically gated ion channels convert sound into an electrical signal for the sense of hearing. In Drosophila melanogaster, several transient receptor potential (TRP channels have been implicated to be involved in this process. TRPN (NompC and TRPV (Inactive channels are localized in the distal and proximal ciliary zones of auditory receptor neurons, respectively. This segregated ciliary localization suggests distinct roles in auditory transduction. However, the regulation of this localization is not fully understood. Here we show that the Drosophila Tubby homolog, King tubby (hereafter called dTULP regulates ciliary localization of TRPs. dTULP-deficient flies show uncoordinated movement and complete loss of sound-evoked action potentials. Inactive and NompC are mislocalized in the cilia of auditory receptor neurons in the dTulp mutants, indicating that dTULP is required for proper cilia membrane protein localization. This is the first demonstration that dTULP regulates TRP channel localization in cilia, and suggests that dTULP is a protein that regulates ciliary neurosensory functions.

  14. Large-conductance voltage- and Ca2+-activated K+ channel regulation by protein kinase C in guinea pig urinary bladder smooth muscle.

    Science.gov (United States)

    Hristov, Kiril L; Smith, Amy C; Parajuli, Shankar P; Malysz, John; Petkov, Georgi V

    2014-03-01

    Large-conductance voltage- and Ca(2+)-activated K(+) (BK) channels are critical regulators of detrusor smooth muscle (DSM) excitability and contractility. PKC modulates the contraction of DSM and BK channel activity in non-DSM cells; however, the cellular mechanism regulating the PKC-BK channel interaction in DSM remains unknown. We provide a novel mechanistic insight into BK channel regulation by PKC in DSM. We used patch-clamp electrophysiology, live-cell Ca(2+) imaging, and functional studies of DSM contractility to elucidate BK channel regulation by PKC at cellular and tissue levels. Voltage-clamp experiments showed that pharmacological activation of PKC with PMA inhibited the spontaneous transient BK currents in native freshly isolated guinea pig DSM cells. Current-clamp recordings revealed that PMA significantly depolarized DSM membrane potential and inhibited the spontaneous transient hyperpolarizations in DSM cells. The PMA inhibitory effects on DSM membrane potential were completely abolished by the selective BK channel inhibitor paxilline. Activation of PKC with PMA did not affect the amplitude of the voltage-step-induced whole cell steady-state BK current or the single BK channel open probability (recorded in cell-attached mode) upon inhibition of all major Ca(2+) sources for BK channel activation with thapsigargin, ryanodine, and nifedipine. PKC activation with PMA elevated intracellular Ca(2+) levels in DSM cells and increased spontaneous phasic and nerve-evoked contractions of DSM isolated strips. Our results support the concept that PKC activation leads to a reduction of BK channel activity in DSM via a Ca(2+)-dependent mechanism, thus increasing DSM contractility.

  15. Data of evolutionary structure change: 1BK9A-2QOGD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BK9A-2QOGD 1BK9 2QOG A D SLIQFETLIMKVAKKSGMFWYSNYGCYCGWGGQGRPQDA...TDRCCFVHDCCYGKVTGCDPKMDVYSFSEENGDIVCGGDDPCKKEICECDRAAAICFRDNLTLYNDKKYWAFGAKNCPQEESEPC SLLQFNKMI.../pdbChain> 2QOGD LSTYK-NEYMF

  16. Urinary BK virus excretion in children newly diagnosed with acute lymphoblastic leukemia

    Directory of Open Access Journals (Sweden)

    Nahid Raeesi

    2012-01-01

    Conclusion: To demonstrate the role of BK virus in inducing ALL or increasing the number of relapses, prospective studies on larger scale of population and evaluating both serum and urine for BK virus are recommended.

  17. Localization of transient receptor potential ion channels in primary and motile cilia of the female murine reproductive organs

    DEFF Research Database (Denmark)

    Teilmann, Stefan C.; Byskov, Anne Grete; Pedersen, Per Amstrup;

    2005-01-01

    We have examined the subcellular localization of transient receptor potential (TRP) ion channels and the potential sensory role of cilia in murine female reproductive organs using confocal laser scanning microscopy analysis on ovary and oviduct tissue sections as well as on primary cultures...... intensity in proximal invaginations of the epithelial folds. These observations are the first to demonstrate ciliary localization of TRP ion channels and their possible receptor function in the female reproductive organs. We suggest that polycystins 1 and 2 play an important role in granulosa cell...

  18. [BK virus infection in a pediatric renal transplant recipient].

    Science.gov (United States)

    Bonaventura, R; Vázquez, A; Exeni, A; Rivero, K; Freire, M C

    2005-01-01

    BK Human Polyomavirus causes an asymptomatic primary infection in children, then establishing latency mainly in the urinary tratt. Viral reactivation can lead to renal pathology in individuals with impaired cellular immune response. This is particularly important in pediatric transplant recipients, who can suffer a primary infection when immunosupressed. We followed up the case of a 5 years old patient who received a renal transplant in October 2003, and presented damaged graft 45 days after the intervention. The patient suffered 3 episodes of renal function failure between October 2003 and June 2004. Blood, urine, renal biopsy and lymphocele liquid samples were analyzed. A differential diagnosis between acute rejection and infectious causes was established by testing for BK, CMV and ADV viruses, and the cytological study of renal tissue. Laboratory findings together with clinical signs suggest the patient was infected by BK virus. As a final consideration, the great importance of differentiating between acute rejection and BK infection is emphasized, since immunosuppressant management is opposite in each case.

  19. Molecular insights into the local anesthetic receptor within voltage-gated sodium channels using hydroxylated analogues of mexiletine

    Directory of Open Access Journals (Sweden)

    Jean-François eDesaphy

    2012-02-01

    Full Text Available We previously showed that the β-adrenoceptor modulators, clenbuterol and propranolol, directly blocked voltage-gated sodium channels, whereas salbutamol and nadolol did not (Desaphy et al., 2003, suggesting the presence of two hydroxyl groups on the aromatic moiety of the drugs as a molecular requisite for impeding sodium channel block. To verify such an hypothesis, we synthesized five new mexiletine analogues by adding one or two hydroxyl groups to the aryl moiety of the sodium channel blocker and tested these compounds on hNav1.4 channels expressed in HEK293 cells. Concentration-response relationships were constructed using an holding potential of -120 mV at 0.1 Hz (tonic block and 10 Hz (use-dependent block stimulation frequencies. The half-maximum inhibitory concentrations (IC50 were linearly correlated to drug lipophilicity: the less lipophilic the drug, minor was the block. The same compounds were also tested on F1586C and Y1593C hNav1.4 channel mutants, to gain further information on the molecular interactions of mexiletine with its receptor within the sodium channel pore. Alteration of tonic block suggests that the aryl moiety of mexiletine may interact either directly or indirectly with Phe1586 in the closed sodium channel to produce low-affinity binding block, and that this interaction depends on the electrostatic potential of the drug aromatic tail. Alteration of use-dependent block suggests that addition of hydroxyl groups to the aryl moiety may modify high-affinity binding of the drug ammine terminal to Phe1586 through cooperativity between the two pharmacophores, this effect being mainly related to drug lipophilicity. Mutation of Tyr1593 further impaired such cooperativity. In conclusion, these results confirm our former hypothesis showing that the presence of hydroxyl groups to the aryl moiety of mexiletine greatly reduced sodium channel block, and provide molecular insights into the intimate interaction of local anesthetics with

  20. Localization and pharmacological characterization of voltage dependent calcium channels in cultured neocortical neurons

    DEFF Research Database (Denmark)

    Timmermann, D B; Lund, Trine Meldgaard; Belhage, B;

    2001-01-01

    The physiological significance and subcellular distribution of voltage dependent calcium channels was defined using calcium channel blockers to inhibit potassium induced rises in cytosolic calcium concentration in cultured mouse neocortical neurons. The cytosolic calcium concentration was measured...... using the fluorescent calcium chelator fura-2. The types of calcium channels present at the synaptic terminal were determined by the inhibitory action of calcium channel blockers on potassium-induced [3H]GABA release in the same cell preparation. L-, N-, P-, Q- and R-/T-type voltage dependent calcium...... most important voltage dependent calcium channel in all parts of the neuron. After treatment with thapsigargin the increase in cytosolic calcium was halved, indicating that calcium release from thapsigargin sensitive intracellular calcium stores is an important component of the potassium induced rise...

  1. Zero-error channel capacity and simulation assisted by non-local correlations

    CERN Document Server

    Cubitt, Toby S; Matthews, William; Winter, Andreas

    2010-01-01

    Shannon's theory of zero-error communication is re-examined in the broader setting of using one classical channel to simulate another exactly, and in the presence of various resources that are all classes of non-signalling correlations: Shared randomness, shared entanglement and arbitrary non-signalling correlations. Specifically, when the channel being simulated is noiseless, this reduces to the zero-error capacity of the channel, assisted by the various classes of non-signalling correlations. When the resource channel is noiseless, it results in the "reverse" problem of simulating a noisy channel exactly by a noiseless one, assisted by correlations. In both cases, 'one-shot' separations between the power of the different assisting correlations are exhibited. The most striking result of this kind is that entanglement can assist in zero-error communication, in stark contrast to the standard setting of communicaton with asymptotically vanishing error in which entanglement does not help at all. In the asymptoti...

  2. Mechanistic modeling of bearing pad to pressure tube contact under localized high temperature conditions in a CANDU fuel channel

    International Nuclear Information System (INIS)

    During a postulated critical break LOCA (loss of coolant accident) in a CANDU reactor the coolant flow rates in the fuel channels of the flow pass of the reactor core downstream of the pipe break can rapidly reduce to very low values and remain very low for a period of tens of seconds following the break. Under the sustained low flow conditions, the fuel sheath (cladding) temperature in the affected channels rapidly increases and the coolant in the channels becomes significantly voided. The pressure tubes in the affected pass heat up under a combination of convection heat transfer from the low flows of superheated seam and thermal radiation heat transfer from the hot fuel. Additionally, hot spots may develop on the inner surface of pressure tubes at locations where the fuel bearing pads are in direct contact with the pressure tube. Localized thermal creep strain deformation at the hot spots is a potential pressure tube failure mechanism which could challenge fuel channel integrity. This paper evaluates the local thermal-mechanical deformation of a pressure tube in a CANDU reactor under critical break LOCA conditions tube using a coupled thermal-mechanical finite element COMSOL multi-physics model and investigates the conditions resulting in fuel channel failure due to localized contact between bearing pad and pressure. The mechanistic models are validated against data obtained from COG funded experiments performed at WRL (Whiteshell Research Laboratory). Multiphysics calculations are performed in which the heat transfer, thermal-mechanical and creep strain equations are solved, simultaneously. Heat conduction from bearing pads to the inner surface of the pressure tube is modeled with appropriate convective and radiation heat transfer boundary conditions. Thermal creep strain deformation of the Zr-2.5%Nb pressure tube is modeled using correlations derived from separate uniaxial tests that are reported in the literature. Contact conductance models based on

  3. [The effect of charged local anesthetics on the inactivation of Ca2+-activated Cl-channels of characean algae].

    Science.gov (United States)

    Kataev, A A; Zherelova, O M; Berestovskiĭ, G N

    1988-01-01

    Effects of local anesthetics (LA) and a number of organic cations on Ca2+-activated Cl-channels in plasmalemma of intracellularly perfused giant algae Nitellopsis obtusa were studied using voltage-clamp technique. It was shown earlier that Ca2+ ions cause irreversible inactivation of Cl-channels with a characteristic time equal to a few minutes, but not only activate Cl-channels. It has been found that amphiphilic cations (AC), including LA+, introduced intracellularly together with Ca2+ produced delayed action on the beginning of the inactivation process (approximately ten minutes) producing no effect on activation during this period. The time of delayed action was linearly dependent on the concentrations ratio alpha = [AC]/[Ca2+]. Procaine is the most effective agent in this respect, the time of its delayed action on the inactivation process being 20 min at alpha = 1. LA in the neural form, hydrophilic AC of tetraethylammonium, as well as LA+ from the outside had no effect on Cl-channels. Cl-channels inactivated "irreversibly" by Ca2+ ions may be restored after addition of AC in Ca2+-containing perfusion medium. PMID:2470412

  4. BK-parameter from Nf=2 twisted mass lattice QCD

    International Nuclear Information System (INIS)

    We present an unquenched Nf = 2 lattice computation of the BK parameter which controls K0- anti K0 oscillations. A partially quenched setup is employed with two maximally twisted dynamical (sea) light Wilson quarks, and valence quarks of both the maximally twisted and the Osterwalder-Seiler variety. Suitable combinations of these two kinds of valence quarks lead to a lattice definition of the BK parameter which is both multiplicatively renormalizable and O(a) improved. Employing the non-perturbative RI-MOM scheme, in the continuum limit and at the physical value of the pion mass we get BRGIK=0.729±0.030, a number well in line with the existing quenched and unquenched determinations. (orig.)

  5. Quantification and distribution of big conductance Ca2+-activated K+ channels in kidney epithelia

    DEFF Research Database (Denmark)

    Grunnet, Morten; Hay-Schmidt, Anders; Klaerke, Dan A

    2005-01-01

    Big conductance Ca2+ activated K+ channels (BK channels) is an abundant channel present in almost all kind of tissue. The accurate quantity and especially the precise distribution of this channel in kidney epithelia are, however, still debated. The aim of the present study has therefore been...

  6. Local anesthetic interaction with human ether-a-go-go-related gene (HERG) channels: role of aromatic amino acids Y652 and F656

    DEFF Research Database (Denmark)

    Siebrands, Cornelia C; Schmitt, Nicole; Friederich, Patrick

    2005-01-01

    BACKGROUND: Human ether-a-go-go-related gene (HERG) potassium channels constitute a potential target involved in cardiotoxic side effects of amino-amide local anesthetics. The molecular interaction site of these low-affinity blockers with HERG channels is currently unknown. The aim of this study...... by bupivacaine, ropivacaine, and mepivacaine. Whole cell patch clamp recordings were performed at room temperature. RESULTS: Inhibition of HERG wild-type and mutant channels by the different local anesthetics was concentration dependent, stereoselective, and reversible. The sensitivity decreased in the order...... bupivacaine > ropivacaine > mepivacaine for wild-type and mutant channels. The mutant channels were approximately 4-30 times less sensitive to the inhibitory action of the different local anesthetics than the wild-type channel. The concentration-response data were described by Hill functions (bupivacaine...

  7. Reactivation of BK polyomavirus in patients with multiple sclerosis receiving natalizumab therapy.

    LENUS (Irish Health Repository)

    Lonergan, Roisin M

    2012-02-01

    Natalizumab therapy in multiple sclerosis has been associated with JC polyomavirus-induced progressive multifocal leucoencephalopathy. We hypothesized that natalizumab may also lead to reactivation of BK, a related human polyomavirus capable of causing morbidity in immunosuppressed groups. Patients with relapsing remitting multiple sclerosis treated with natalizumab were prospectively monitored for reactivation of BK virus in blood and urine samples, and for evidence of associated renal dysfunction. In this cohort, JC and BK DNA in blood and urine; cytomegalovirus (CMV) DNA in blood and urine; CD4 and CD8 T-lymphocyte counts and ratios in peripheral blood; and renal function were monitored at regular intervals. BK subtyping and noncoding control region sequencing was performed on samples demonstrating reactivation. Prior to commencement of natalizumab therapy, 3 of 36 patients with multiple sclerosis (8.3%) had BK viruria and BK reactivation occurred in 12 of 54 patients (22.2%). BK viruria was transient in 7, continuous in 2 patients, and persistent viruria was associated with transient viremia. Concomitant JC and CMV viral loads were undetectable. CD4:CD8 ratios fluctuated, but absolute CD4 counts did not fall below normal limits. In four of seven patients with BK virus reactivation, transient reductions in CD4 counts were observed at onset of BK viruria: these resolved in three of four patients on resuppression of BK replication. No renal dysfunction was observed in the cohort. BK virus reactivation can occur during natalizumab therapy; however, the significance in the absence of renal dysfunction is unclear. We propose regular monitoring for BK reactivation or at least for evidence of renal dysfunction in patients receiving natalizumab.

  8. Pengaruh Sumber Karbon dan Nitrogen Terhadap Pertumbuhan dan Pembentukan Spora Bacillus sp. Bk17

    OpenAIRE

    Rachmi

    2014-01-01

    Study of the effect of carbon and nitrogen sources on the growth and sporulation of Bacillus sp. BK17 has been conducted. Bacillus sp. BK17 was cultured in broth medium containing different carbon and nitrogen sources, and incubated for 6 days. The highest growth of Bacillus sp. BK17 was obtained on molasses-tryptone medium incubated during 3 days and the lowest growth obtained on whey-sodium nitrate. The highest spore formation was also obtained from molasses-tryptone mediu...

  9. Calpeptin, not calpain, directly inhibits an ion channel of the inner mitochondrial membrane.

    Science.gov (United States)

    Derksen, Maria; Vorwerk, Christian; Siemen, Detlef

    2016-05-01

    The permeability transition pore (PTP) of inner mitochondrial membranes is a large conductance pathway for ions up to 1500 Da which opening is responsible for ion equilibration and loss of membrane potential in apoptosis and thus in several neurodegenerative diseases. The PTP can be regulated by the Ca(2+)-activated mitochondrial K channel (BK). Calpains are Ca(2+)-activated cystein proteases; calpeptin is an inhibitor of calpains. We wondered whether calpain or calpeptin can modulate activity of PTP or BK. Patch clamp experiments were performed on mitoplasts of rat liver (PTP) and of an astrocytoma cell line (BK). Channel-independent open probability (P o) was determined (PTP) and, taking into account the number of open levels, NPo by single channel analysis (BK). We find that PTP in the presence of Ca(2+) (200 μM) is uninfluenced by calpain (13 nM) and shows insignificant decrease by the calpain inhibitor calpeptin (1 μM). The NPo of the BK is insensitive to calpain (54 nM), too. However, it is significantly and reversibly inhibited by the calpain inhibitor calpeptin (IC50 = 42 μM). The results agree with calpeptin-induced activation of the PTP via inhibition of the BK. Screening experiments with respirometry show calpeptin effects, fitting to inhibition of the BK by calpeptin, and strong inhibition of state 3 respiration. PMID:26108743

  10. TEMPERATURE PROFILES OF LOCAL THERMAL NONEQUILIBRIUM FOR THERMAL DEVELOPING FORCED CONVECTION IN POROUS MEDIUM PARALLEL PLATE CHANNEL

    Institute of Scientific and Technical Information of China (English)

    YANG Xiao; LIU Xue-mei

    2006-01-01

    Based on the two-energy equation model, taking into account viscous dissipation due to the interaction between solid skeleton and pore fluid flow, temperature expressions of the solid skeleton and pore fluid flow are obtained analytically for the thermally developing forced convection in a saturated porous medium parallel plate channel,with walls being at constant temperature. It is proved that the temperatures of the two phases for the local thermal nonequilibrium approach to the temperature derived from the one-energy equation model for the local thermal equilibrium when the heat exchange coefficient goes to infinite. The temperature profiles are shown in figures for different dimensionless parameters and the effects of the parameters on the local thermal nonequilibrium are revealed by parameter study.

  11. Molecular Insights into the Local Anesthetic Receptor within Voltage-Gated Sodium Channels Using Hydroxylated Analogs of Mexiletine.

    Science.gov (United States)

    Desaphy, Jean-François; Dipalma, Antonella; Costanza, Teresa; Carbonara, Roberta; Dinardo, Maria Maddalena; Catalano, Alessia; Carocci, Alessia; Lentini, Giovanni; Franchini, Carlo; Camerino, Diana Conte

    2012-01-01

    results confirm our former hypothesis by showing that the presence of hydroxyl groups to the aryloxy moiety of mexiletine greatly reduced sodium channel block, and provide molecular insights into the intimate interaction of local anesthetics with their receptor. PMID:22403541

  12. Intra- and Inter-Channel Competition in Local-Service Sectors

    NARCIS (Netherlands)

    K. Cleeren; M.G. Dekimpe (Marnik); F. Verboven

    2005-01-01

    textabstractAlthough economically very important, local-service sectors have received little attention in the extensive literature on competitive interactions. Detailed data gathering in these sectors is hard, not only because of the multitude of local players, but also because key service dimensio

  13. Pannexin2 oligomers localize into endosomal vesicles in mammalian cells while Pannexin1 channels traffic to the plasma membrane

    Directory of Open Access Journals (Sweden)

    Daniela eBoassa

    2015-02-01

    Full Text Available Pannexin2 (Panx2 is the largest of three members of the pannexin proteins. Pannexins are topologically related to connexins and innexins, but serve different functional roles than forming gap junctions. We previously showed that pannexins form oligomeric channels but unlike connexins and innexins, they form only single membrane channels. High levels of Panx2 mRNA and protein in the Central Nervous System (CNS have been documented. Whereas Pannexin1 (Panx1 is fairly ubiquitous and Pannexin3 (Panx3 is found in skin and connective tissue, both are fully glycosylated, traffic to the plasma membrane and have functions correlated with extracellular ATP release. Here, we describe trafficking and subcellular localizations of exogenous Panx2 and Panx1 protein expression in MDCK, HeLa and HEK293T cells as well as endogenous Panx1 and Panx2 patterns in the CNS. Panx2 was found in intracellular localizations, was partially N-glycosylated, and localizations were non-overlapping with Panx1. Confocal images of hippocampal sections immunolabeled for the astrocytic protein GFAP, Panx1 and Panx2 demonstrated that the two isoforms, Panx1 and Panx2, localized at different subcellular compartments in both astrocytes and neurons. Using recombinant fusions of Panx2 with appended genetic tags developed for correlated light and electron microscopy and then expressed in different cell lines, we determined that Panx2 is localized in the membrane of intracellular vesicles and not in the endoplasmic reticulum as initially indicated by calnexin colocalization experiments. Dual immunofluorescence imaging with protein markers for specific vesicle compartments showed that Panx2 vesicles are early endosomal in origin. In electron tomographic volumes, cross-sections of these vesicles displayed fine structural details and close proximity to actin filaments. Thus, pannexins expressed at different subcellular compartments likely exert distinct functional roles, particularly in the

  14. Inhalation of the BK(Ca-opener NS1619 attenuates right ventricular pressure and improves oxygenation in the rat monocrotaline model of pulmonary hypertension.

    Directory of Open Access Journals (Sweden)

    Marc Revermann

    Full Text Available BACKGROUND: Right heart failure is a fatal consequence of chronic pulmonary hypertension (PH. The development of PH is characterized by increased proliferation of vascular cells, in particular pulmonary artery smooth muscle cells (PASMCs and pulmonary artery endothelial cells. In the course of PH, an escalated right ventricular (RV afterload occurs, which leads to increased perioperative morbidity and mortality. BK(Ca channels are ubiquitously expressed in vascular smooth muscle cells and their opening induces cell membrane hyperpolarization followed by vasodilation. Moreover, BK activation induces anti-proliferative effects in a multitude of cell types. On this basis, we hypothesized that treatment with the nebulized BK channel opener NS1619 might be a therapy option for pulmonary hypertension and tested this in rats. METHODS: (1 Rats received monocrotaline injection for PH induction. Twenty-four days later, rats were anesthetized and NS1619 or the solvent was administered by inhalation. Systemic hemodynamic parameters, RV hemodynamic parameters, and blood gas analyses were measured before as well as 30 and 120 minutes after inhalation. (2 Rat PASMCs were stimulated with PDGF-BB in the presence and absence of NS1619. AKT, ERK1 and ERK2 activation were investigated by western blot analyses, and relative cell number was determined 48 hours after stimulation. RESULTS: Inhalation of a 12 µM and 100 µM NS1619 solution significantly reduced RV pressure without affecting systemic arterial pressure. Blood gas analyses demonstrated significantly reduced carbon dioxide and improved oxygenation in NS1619-treated animals pointing towards a considerable pulmonary shunt-reducing effect. In PASMC's, NS1619 (100 µM significantly attenuated PASMC proliferation by a pathway independent of AKT and ERK1/2 activation. CONCLUSION: NS1619 inhalation reduces RV pressure and improves oxygen supply and its application inhibits PASMC proliferation in vitro. Hence, BK

  15. A novel potassium channel in skeletal muscle mitochondria.

    Science.gov (United States)

    Skalska, Jolanta; Piwońska, Marta; Wyroba, Elzbieta; Surmacz, Liliana; Wieczorek, Rafal; Koszela-Piotrowska, Izabela; Zielińska, Joanna; Bednarczyk, Piotr; Dołowy, Krzysztof; Wilczynski, Grzegorz M; Szewczyk, Adam; Kunz, Wolfram S

    2008-01-01

    In this work we provide evidence for the potential presence of a potassium channel in skeletal muscle mitochondria. In isolated rat skeletal muscle mitochondria, Ca(2+) was able to depolarize the mitochondrial inner membrane and stimulate respiration in a strictly potassium-dependent manner. These potassium-specific effects of Ca(2+) were completely abolished by 200 nM charybdotoxin or 50 nM iberiotoxin, which are well-known inhibitors of large conductance, calcium-activated potassium channels (BK(Ca) channel). Furthermore, NS1619, a BK(Ca)-channel opener, mimicked the potassium-specific effects of calcium on respiration and mitochondrial membrane potential. In agreement with these functional data, light and electron microscopy, planar lipid bilayer reconstruction and immunological studies identified the BK(Ca) channel to be preferentially located in the inner mitochondrial membrane of rat skeletal muscle fibers. We propose that activation of mitochondrial K(+) transport by opening of the BK(Ca) channel may be important for myoprotection since the channel opener NS1619 protected the myoblast cell line C2C12 against oxidative injury.

  16. Measurement of subcooled boiling pressure drop and local heat transfer coefficient in a horizontal channel under LPLF conditions

    International Nuclear Information System (INIS)

    Horizontal flow is commonly encountered in boiler tubes, refrigerating equipments and nuclear reactor fuel channels of pressurized heavy water reactors (PHWR). Study of horizontal flow under low pressure and low flow (LPLF) conditions is important in understanding the nuclear core behavior during situations like LOCA (Loss of coolant accidents). In the present work, experimental measurements of local heat transfer coefficient and pressure drop are carried out in a horizontal channel under LPLF conditions of sub-cooled boiling. Infrared thermography is used for the measurement of local wall temperature to estimate the heat transfer coefficient in single phase and two phase flows with water as the working medium at atmospheric pressure. Correlation for single phase diabatic pressure drop ratio (diabatic to adiabatic) as a function of viscosity ratio (wall temperature to fluid temperature) is presented. Correlation for pressure drop under sub-cooled boiling conditions as a function of Bo (Boiling number) and Ja (Jacob number) is obtained. Correlation for single phase heat transfer coefficient in the developing region is presented as a function of z/d (ratio of axial length of the test section to diameter). Correlation for two-phase heat transfer coefficient under sub-cooled boiling condition is presented as a function of Bo, Ja and Pr (Prandtl number). Correlation between heat transfer coefficient and friction factor is obtained by applying Reynolds analogy. (author)

  17. Expression and subcellular localization of aquaporin water channels in the polarized hepatocyte cell line, WIF-B

    Directory of Open Access Journals (Sweden)

    Marinelli Raúl A

    2005-08-01

    Full Text Available Abstract Background Recent data suggest that canalicular bile secretion involves selective expression and coordinated regulation of aquaporins (AQPs, a family of water channels proteins. In order to further characterize the role of AQPs in this process, an in vitro cell system with retained polarity and expression of AQPs and relevant solute transporters involved in bile formation is highly desirable. The WIF-B cell line is a highly differentiated and polarized rat hepatoma/human fibroblast hybrid, which forms abundant bile canalicular structures. This cell line has been reported to be a good in vitro model for studying hepatocyte polarity. Results Using RT-PCR, immunoblotting and confocal immunofluorescence, we showed that WIF-B cells express the aquaporin water channels that facilitate the osmotically driven water movements in the liver, i.e. AQP8, AQP9, and AQP0; as well as the key solute transporters involved in the generation of canalicular osmotic gradients, i.e., the bile salt export pump Bsep, the organic anion transporter Mrp2 and the chloride bicarbonate exchanger AE2. The subcellular localization of the AQPs and the solute transporters in WIF-B cells was similar to that in freshly isolated rat hepatocytes and in intact liver. Immunofluorescent costaining studies showed intracellular colocalization of AQP8 and AE2, suggesting the possibility that these transporters are expressed in the same population of pericanalicular vesicles. Conclusion The hepatocyte cell line WIF-B retains the expression and subcellular localization of aquaporin water channels as well as key solute transporters for canalicular bile secretion. Thus, these cells can work as a valuable tool for regulatory and mechanistic studies of the biology of bile formation.

  18. BK virus-associated hemorrhagic cystitis after pediatric stem cell transplantation.

    Science.gov (United States)

    Han, Seung Beom; Cho, Bin; Kang, Jin Han

    2014-12-01

    Hemorrhagic cystitis is a common stem cell transplantation-related complication. The incidence of early-onset hemorrhagic cystitis, which is related to the pretransplant conditioning regimen, has decreased with the concomitant use of mesna and hyperhydration. However, late-onset hemorrhagic cystitis, which is usually caused by the BK virus, continues to develop. Although the BK virus is the most common pathogenic microorganism of poststem cell transplantation late-onset hemorrhagic cystitis, pediatricians outside the hemato-oncology and nephrology specialties tend to be unfamiliar with hemorrhagic cystitis and the BK virus. Moreover, no standard guidelines for the early diagnosis and treatment of BK virus-associated hemorrhagic cystitis after stem cell transplantation have been established. Here, we briefly introduce poststem cell transplantation BK virus-associated hemorrhagic cystitis. PMID:25653684

  19. Collinearly-improved BK evolution meets the HERA data

    Directory of Open Access Journals (Sweden)

    E. Iancu

    2015-11-01

    Full Text Available In a previous publication, we have established a collinearly-improved version of the Balitsky–Kovchegov (BK equation, which resums to all orders the radiative corrections enhanced by large double transverse logarithms. Here, we study the relevance of this equation as a tool for phenomenology, by confronting it to the HERA data. To that aim, we first improve the perturbative accuracy of our resummation, by including two classes of single-logarithmic corrections: those generated by the first non-singular terms in the DGLAP splitting functions and those expressing the one-loop running of the QCD coupling. The equation thus obtained includes all the next-to-leading order corrections to the BK equation which are enhanced by (single or double collinear logarithms. We then use numerical solutions to this equation to fit the HERA data for the electron–proton reduced cross-section at small Bjorken x. We obtain good quality fits for physically acceptable initial conditions. Our best fit, which shows a good stability up to virtualities as large as Q2=400 GeV2 for the exchanged photon, uses as an initial condition the running-coupling version of the McLerran–Venugopalan model, with the QCD coupling running according to the smallest dipole prescription.

  20. Collinearly-improved BK evolution meets the HERA data

    CERN Document Server

    Iancu, E; Mueller, A H; Soyez, G; Triantafyllopoulos, D N

    2015-01-01

    In a previous publication, we have established a collinearly-improved version of the Balitsky-Kovchegov (BK) equation, which resums to all orders the radiative corrections enhanced by large double transverse logarithms. Here, we study the relevance of this equation as a tool for phenomenology, by confronting it to the HERA data. To that aim, we first improve the perturbative accuracy of our resummation, by including two classes of single-logarithmic corrections: those generated by the first non-singular terms in the DGLAP splitting functions and those expressing the one-loop running of the QCD coupling. The equation thus obtained includes all the next-to-leading order corrections to the BK equation which are enhanced by (single or double) collinear logarithms. We then use numerical solutions to this equation to fit the HERA data for the electron-proton reduced cross-section at small Bjorken x. We obtain good quality fits for physically acceptable initial conditions. Our best fit, which shows a good stability ...

  1. The Role of L- and T-Type Calcium Channels in Local and Remote Calcium Responses in Rat Mesenteric Terminal Arterioles

    DEFF Research Database (Denmark)

    Braunstein, Thomas Hartig; Inoue, Ryuji; Cribbs, Leanne;

    2009-01-01

    Background/Aims: The roles of intercellular communication and T-type versus L-type voltage-dependent Ca(2+) channels (VDCCs) in conducted vasoconstriction to local KCl-induced depolarization were investigated in mesenteric arterioles. Methods: Ratiometric Ca(2+) imaging (R) using Fura-PE3 with...... local (DeltaR = 0.54) and remote (DeltaR = 0.17 at 500 mum) increases in intracellular Ca(2+). Remote Ca(2+) responses were inhibited by the gap junction uncouplers carbenoxolone and palmitoleic acid. Ca(V)1.2, Ca(V)3.1 and Ca(V)3.2 channels were immunolocalized in vascular smooth muscle cells and Ca...... arterioles (at 200-300 mum) using micro-application of VDCC blockers. Conclusion: Both L- and T-type channels mediate Ca(2+) entry during conducted vasoconstriction to local KCl in mesenteric arterioles. However, these channels do not participate in the conduction process per se....

  2. TIME EVOLUTION OF LOCAL SCOUR AT OBSTACLES PROTRUDING FROM CHANNEL SIDE WALLS

    Institute of Scientific and Technical Information of China (English)

    J.S.dos SANTOS; A.H.CARDOSO

    2001-01-01

    This paper deals with the effects of average flow velocity, obstacle length and sediment size on time evolution of scour depth near thin, vertical obstacles, protruding at right angle from movable bed channel side-walls. These effects are studied in the framework of the "generalised equations" of Ettema (1980),Franzetti et al. (1982) and Whitehouse (1997). The results show that i) coefficients included in the first two equations depend on flow velocity as well as on obstacle length; ii) those coefficients are independentof bed material size; iii) the coefficients involved in the equation of Whitehouse (1997) are independent of flow velocity, obstacle length and bed material size. A new method for the evaluation of Whitehouse's time scale was obtained and a new method for the characterisation of equilibrium time was established in the framework of the equation of Franzetti et al. (1982).

  3. Local Heat Transfer and Pressure Drop in a Rotating Two-Pass Ribbed Rectangular Channel

    Directory of Open Access Journals (Sweden)

    Shou-Shing Hsieh

    2001-01-01

    the duct have been determined over the trailing and leading surfaces for two pass straight channels and U-bend region. Implementing with the data from Hsieh and Liu (1996 for AR=1 and 1.5 with p/e=5 and e/DH=0.17 and 0.20, passage aspect ratio effect was further examined. Furthermore, data for 180∘ U-bend region with ribroughened turbulator on heat transfer were also measured. It was found that a complicated three-dimensional accelerated flow and secondary flow in this U-bend region caused higher heat transfer on both leading/trailing walls. Enhancement performance ratios are also presented and discussed. Results again indicate a slight decrease in heat transfer coefficient for an increase in passage aspect ratio as compared to those of previous studies.

  4. 77 FR 25073 - Special Local Regulation; Hebda Cup Rowing Regatta, Trenton Channel; Detroit River, Wyandotte, MI

    Science.gov (United States)

    2012-04-27

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulation; Hebda Cup Rowing Regatta... on the navigable waters immediately prior to, during, and immediately after the Hebda Cup Rowing... Purpose On April 28, 2012, the Wyandotte Boat Club is holding a rowing race that will require...

  5. 78 FR 24063 - Special Local Regulation; Hebda Cup Rowing Regatta, Trenton Channel; Detroit River, Wyandotte, MI

    Science.gov (United States)

    2013-04-24

    ... INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulation; Hebda Cup Rowing Regatta... on the navigable waters immediately prior to, during, and immediately after the Hebda Cup...

  6. Effect of blockers of Kv and BKCa channels on muscle tension of rabbit oddi sphincter in vivo and th e regulatory effect of paeoniflorin%Kv 和 BK Ca通道阻断剂对家兔离体 Oddi括约肌肌环张力的作用及芍药甙的调控作用

    Institute of Scientific and Technical Information of China (English)

    雒建瑞; 王芳; 冯骅; 王长淼

    2014-01-01

    Objective It is to investigate the effect of blockers of voltage-gated potassium channels ( Kv) , large-conduct-ance calcium-activated potassium channel ( BKCa) on sphincter of Oddi ( sphincter of Oddi , SO) from rabbits muscle ten-sion rings, and to explore the regulatory effect of the active ingredients of traditional Chinese medicine paeoniflorin on them . Methods Isolated rabbit sphincter of Oddi muscle rings specimens were prepared and placed on the smooth muscle perfusion bath temperature to observe the contraction effect of Kv channel blocker 4-aminopyridine (4-AP), BKCa channel blocker tetraethylammonium chloride( TEA) on isolated rabbit SO muscle rings and the effects of paeoniflorin on the contraction effects induced by 4-AP and TEA.Resul ts 4-AP and TEA both could cause contraction of SO muscle rings , with the the concen-trations increased , the contraction degrees increased .The contraction effects induced by 4-AP and TEA could be inhibited by paeoniflorin .Conclusion In vitro condition , Kv channel and BKCa channel play a major role in the maintenance of sphincter of Oddi resting membrane potential of cells .Paeoniflorin may influence the relaxant responses of SO cells possibly through the regulation of Kv and BKCa channels .%目的:探讨电压依赖性钾通道( Kv)、大电导钙激活钾通道( BKCa )阻断剂对家兔离体Oddi 括约肌( SO)肌环张力的作用及中药芍药的有效成分芍药甙对其调控作用。方法制备离体兔Oddi 括约肌肌环标本,放置于平滑肌恒温灌流浴槽中,观察Kv通道阻断剂4-aminopyridine (4-AP)、BKCa通道阻断剂tetraethylammonium chloride ( TEA)对家兔离体SO肌环的收缩作用;观察芍药甙对4-AP和TEA引起的收缩作用的影响。结果4-AP、TEA均可以引起SO肌环收缩,且随4-AP、TEA浓度增加,收缩程度也在增强。4-AP和TEA对SO肌环的收缩作用可以被芍药甙抑制。结论在离体条件下,Kv通道和BKCa通道

  7. Transient receptor potential ankyrin 1 channel localized to non-neuronal airway cells promotes non-neurogenic inflammation.

    Directory of Open Access Journals (Sweden)

    Romina Nassini

    Full Text Available BACKGROUND: The transient receptor potential ankyrin 1 (TRPA1 channel, localized to airway sensory nerves, has been proposed to mediate airway inflammation evoked by allergen and cigarette smoke (CS in rodents, via a neurogenic mechanism. However the limited clinical evidence for the role of neurogenic inflammation in asthma or chronic obstructive pulmonary disease raises an alternative possibility that airway inflammation is promoted by non-neuronal TRPA1. METHODOLOGY/PRINCIPAL FINDINGS: By using Real-Time PCR and calcium imaging, we found that cultured human airway cells, including fibroblasts, epithelial and smooth muscle cells express functional TRPA1 channels. By using immunohistochemistry, TRPA1 staining was observed in airway epithelial and smooth muscle cells in sections taken from human airways and lung, and from airways and lung of wild-type, but not TRPA1-deficient mice. In cultured human airway epithelial and smooth muscle cells and fibroblasts, acrolein and CS extract evoked IL-8 release, a response selectively reduced by TRPA1 antagonists. Capsaicin, agonist of the transient receptor potential vanilloid 1 (TRPV1, a channel co-expressed with TRPA1 by airway sensory nerves, and acrolein or CS (TRPA1 agonists, or the neuropeptide substance P (SP, which is released from sensory nerve terminals by capsaicin, acrolein or CS, produced neurogenic inflammation in mouse airways. However, only acrolein and CS, but not capsaicin or SP, released the keratinocyte chemoattractant (CXCL-1/KC, IL-8 analogue in bronchoalveolar lavage (BAL fluid of wild-type mice. This effect of TRPA1 agonists was attenuated by TRPA1 antagonism or in TRPA1-deficient mice, but not by pharmacological ablation of sensory nerves. CONCLUSIONS: Our results demonstrate that, although either TRPV1 or TRPA1 activation causes airway neurogenic inflammation, solely TRPA1 activation orchestrates an additional inflammatory response which is not neurogenic. This finding suggests

  8. Queuing Theory Based Co-Channel Interference Analysis Approach for High-Density Wireless Local Area Networks

    Science.gov (United States)

    Zhang, Jie; Han, Guangjie; Qian, Yujie

    2016-01-01

    Increased co-channel interference (CCI) in wireless local area networks (WLANs) is bringing serious resource constraints to today’s high-density wireless environments. CCI in IEEE 802.11-based networks is inevitable due to the nature of the carrier sensing mechanism however can be reduced by resource optimization approaches. That means the CCI analysis is basic, but also crucial for an efficient resource management. In this article, we present a novel CCI analysis approach based on the queuing theory, which considers the randomness of end users’ behavior and the irregularity and complexity of network traffic in high-density WLANs that adopts the M/M/c queuing model for CCI analysis. Most of the CCIs occur when multiple networks overlap and trigger channel contentions; therefore, we use the ratio of signal-overlapped areas to signal coverage as a probabilistic factor to the queuing model to analyze the CCI impacts in highly overlapped WLANs. With the queuing model, we perform simulations to see how the CCI influences the quality of service (QoS) in high-density WLANs. PMID:27563896

  9. Queuing Theory Based Co-Channel Interference Analysis Approach for High-Density Wireless Local Area Networks.

    Science.gov (United States)

    Zhang, Jie; Han, Guangjie; Qian, Yujie

    2016-08-23

    Increased co-channel interference (CCI) in wireless local area networks (WLANs) is bringing serious resource constraints to today's high-density wireless environments. CCI in IEEE 802.11-based networks is inevitable due to the nature of the carrier sensing mechanism however can be reduced by resource optimization approaches. That means the CCI analysis is basic, but also crucial for an efficient resource management. In this article, we present a novel CCI analysis approach based on the queuing theory, which considers the randomness of end users' behavior and the irregularity and complexity of network traffic in high-density WLANs that adopts the M/M/c queuing model for CCI analysis. Most of the CCIs occur when multiple networks overlap and trigger channel contentions; therefore, we use the ratio of signal-overlapped areas to signal coverage as a probabilistic factor to the queuing model to analyze the CCI impacts in highly overlapped WLANs. With the queuing model, we perform simulations to see how the CCI influences the quality of service (QoS) in high-density WLANs.

  10. Queuing Theory Based Co-Channel Interference Analysis Approach for High-Density Wireless Local Area Networks.

    Science.gov (United States)

    Zhang, Jie; Han, Guangjie; Qian, Yujie

    2016-01-01

    Increased co-channel interference (CCI) in wireless local area networks (WLANs) is bringing serious resource constraints to today's high-density wireless environments. CCI in IEEE 802.11-based networks is inevitable due to the nature of the carrier sensing mechanism however can be reduced by resource optimization approaches. That means the CCI analysis is basic, but also crucial for an efficient resource management. In this article, we present a novel CCI analysis approach based on the queuing theory, which considers the randomness of end users' behavior and the irregularity and complexity of network traffic in high-density WLANs that adopts the M/M/c queuing model for CCI analysis. Most of the CCIs occur when multiple networks overlap and trigger channel contentions; therefore, we use the ratio of signal-overlapped areas to signal coverage as a probabilistic factor to the queuing model to analyze the CCI impacts in highly overlapped WLANs. With the queuing model, we perform simulations to see how the CCI influences the quality of service (QoS) in high-density WLANs. PMID:27563896

  11. Covariance fitting of highly correlated $B_K$ data

    CERN Document Server

    Yoon, Boram; Jung, Chulwoo; Lee, Weonjong

    2011-01-01

    We present the reason why we use the diagonal approximation (uncorrelated fitting) when we perform the data analysis of highly correlated $B_K$ data on the basis of the SU(2) staggered chiral perturbation theory. Basically, the essence of the problem is that we do not have enough statistics to determine the small eigenvalues of the covariance matrix with a high precision. As a result, we have the smallest eigenvalue, which is smaller than the statistical error of the covariance matrix, corresponding to an unphysical eigenmode. We have applied a number of prescriptions available in the market such as the cutoff method and modified covariance matrix method. It turns out that the cutoff method is not a good prescription and the modified covariance matrix method is an even worse one. The diagonal approximation turns out to be a good prescription if the data points are somehow correlated and the statistics are relatively poor.

  12. Water Channels Aquaporin 4 and -1 Expression in Subependymoma Depends on the Localization of the Tumors.

    Directory of Open Access Journals (Sweden)

    Susan Noell

    Full Text Available We analyzed aquaporin 4 and -1 expression in subependymomas, benign and slow growing brain tumors WHO grade I. Ten subependymoma cases were investigated, five of the fossa inferior and five of the fossa superior.Using immunohistochemistry, we observed different aquaporin expression patterns depending on localization: aquaporin 4 and -1 were detected in infratentorial subependymomas in the entire tumor tissue. In contrast, supratentorial subependymomas revealed aquaporin 4 and -1 expression only in border areas of the tumor. PCR analyses however showed no difference in aquaporin 4 expression between all subependymomas independent of localization but at higher levels than in normal brain. In contrast, aquaporin 1 RNA levels were found to be higher only in infratentorial samples compared to supratentorial and normal brain samples. The reason for the different distribution pattern of aquaporin 4 in subependymomas still remains unclear. On the cellular level, aquaporin 4 was redistributed on the surface of the tumor cells, and in freeze fracture replicas no orthogonal arrays of particles were found. This was similar to our previous findings in malignant glioblastomas. From these studies, we know that extracellular matrix molecules within the tumor like agrin and its receptor alpha-dystroglycan are involved in forming orthogonal arrays of particles. In subependymomas neither agrin nor alpha-dystroglycan were detected around blood vessels.Taken together, we show in this study that in the benign subependymomas aquaporins 1 and 4 are dramatically redistributed and upregulated. We speculate that extracellular environments of infra- and supratentorial subependymomas are different and lead to different distribution patterns of aquaporin 4 and -1.

  13. Numerical and experimental analysis of local flow phenomena in laminar Taylor flow in a square mini-channel

    Science.gov (United States)

    Falconi, C. J.; Lehrenfeld, C.; Marschall, H.; Meyer, C.; Abiev, R.; Bothe, D.; Reusken, A.; Schlüter, M.; Wörner, M.

    2016-01-01

    The vertically upward Taylor flow in a small square channel (side length 2 mm) is one of the guiding measures within the priority program "Transport Processes at Fluidic Interfaces" (SPP 1506) of the German Research Foundation (DFG). This paper presents the results of coordinated experiments and three-dimensional numerical simulations (with three different academic computer codes) for typical local flow parameters (bubble shape, thickness of the liquid film, and velocity profiles) in different cutting planes (lateral and diagonal) for a specific co-current Taylor flow. For most quantities, the differences between the three simulation results and also between the numerical and experimental results are below a few percent. The experimental and computational results consistently show interesting three-dimensional flow effects in the rear part of the liquid film. There, a local back flow of liquid occurs in the fixed frame of reference which leads to a temporary reversal of the direction of the wall shear stress during the passage of a Taylor bubble. Notably, the axial positions of the region with local backflow and those of the minimum vertical velocity differ in the lateral and the diagonal liquid films. By a thorough analysis of the fully resolved simulation results, this previously unknown phenomenon is explained in detail and, moreover, approximate criteria for its occurrence in practical applications are given. It is the different magnitude of the velocity in the lateral film and in the corner region which leads to azimuthal pressure differences in the lateral and diagonal liquid films and causes a slight deviation of the bubble from the rotational symmetry. This deviation is opposite in the front and rear parts of the bubble and has the mentioned significant effects on the local flow field in the rear part of the liquid film.

  14. Fusion and quasifission dynamics in the reactions $^{48}$Ca+$^{249}$Bk and $^{50}$Ti+$^{249}$Bk using TDHF

    CERN Document Server

    Umar, A S; Simenel, C

    2016-01-01

    Background: Synthesis of superheavy elements (SHE) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHE have been recently produced with doubly-magic $^{48}$Ca beams. However, SHE synthesis experiments with single-magic $^{50}$Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for $Z=117,119$ superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in $^{48}$Ca,$^{50}$Ti+$^{249}$Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleu...

  15. Conformal barrier and hidden local symmetry constraints: Walking technirhos in LHC diboson channels

    Directory of Open Access Journals (Sweden)

    Hidenori S. Fukano

    2016-03-01

    Full Text Available We expand the previous analyses of the conformal barrier on the walking technirho for the 2 TeV diboson excesses reported by the ATLAS Collaboration, with a special emphasis on the hidden local symmetry (HLS constraints. We first show that the Standard Model (SM Higgs Lagrangian is equivalent to the scale-invariant nonlinear chiral Lagrangian, which is further gauge equivalent to the scale-invariant HLS model, with the scale symmetry realized nonlinearly via SM Higgs as a (pseudo-dilaton. The scale symmetry forbids the new vector boson decay to the 125 GeV Higgs plus W/Z boson, in sharp contrast to the conventional “equivalence theorem” which is invalidated by the conformality. The HLS forbids mixing between the iso-triplet technirho's, ρΠ and ρP, of the one-family walking technicolor (with four doublets ND=NF/2=4, which, without the HLS, would be generated when switching on the standard model gauging. We also present updated analyses of the walking technirho's for the diboson excesses by fully incorporating the constraints from the conformal barrier and the HLS as well as possible higher order effects: still characteristic of the one-family walking technirho is its smallness of the decay width, roughly of order Γ/Mρ∼[3/NC×1/ND]×[Γ/Mρ]QCD≃70 GeV/2 TeV (ND=NC=4, in perfect agreement with the expected diboson resonance with Γ<100 GeV. The model is so sharply distinguishable from other massive spin 1 models without the conformality and HLS that it is clearly testable at the LHC Run II. If the 2 TeV boson decay to WH/ZH is not observed in the ongoing Run II, then the conformality is operative on the 125 GeV Higgs, strongly suggesting that the 2 TeV excess events are responsible for the walking technirhos and the 125 GeV Higgs is the technidilaton.

  16. Neurogenic detrusor overactivity is associated with decreased expression and function of the large conductance voltage- and Ca(2+-activated K(+ channels.

    Directory of Open Access Journals (Sweden)

    Kiril L Hristov

    Full Text Available Patients suffering from a variety of neurological diseases such as spinal cord injury, Parkinson's disease, and multiple sclerosis often develop neurogenic detrusor overactivity (NDO, which currently lacks a universally effective therapy. Here, we tested the hypothesis that NDO is associated with changes in detrusor smooth muscle (DSM large conductance Ca(2+-activated K(+ (BK channel expression and function. DSM tissue samples from 33 patients were obtained during open bladder surgeries. NDO patients were clinically characterized preoperatively with pressure-flow urodynamics demonstrating detrusor overactivity, in the setting of a clinically relevant neurological condition. Control patients did not have overactive bladder and did not have a clinically relevant neurological disease. We conducted quantitative polymerase chain reactions (qPCR, perforated patch-clamp electrophysiology on freshly-isolated DSM cells, and functional studies on DSM contractility. qPCR experiments revealed that DSM samples from NDO patients showed decreased BK channel mRNA expression in comparison to controls. Patch-clamp experiments demonstrated reduced whole cell and transient BK currents (TBKCs in freshly-isolated DSM cells from NDO patients. Functional studies on DSM contractility showed that spontaneous phasic contractions had a decreased sensitivity to iberiotoxin, a selective BK channel inhibitor, in DSM strips isolated from NDO patients. These results reveal the novel finding that NDO is associated with decreased DSM BK channel expression and function leading to increased DSM excitability and contractility. BK channel openers or BK channel gene transfer could be an alternative strategy to control NDO. Future clinical trials are needed to evaluate the value of BK channel opening drugs or gene therapies for NDO treatment and to identify any possible adverse effects.

  17. Interaction of local anesthetics with a peptide encompassing the IV/S4-S5 linker of the Na+ channel.

    Science.gov (United States)

    Fraceto, Leonardo F; Oyama, Sérgio; Nakaie, Clóvis R; Spisni, Alberto; de Paula, Eneida; Pertinhez, Thelma A

    2006-08-20

    The peptide pIV/S4-S5 encompasses the cytoplasmic linker between helices S4-S5 in domain IV of the voltage-gated Na+ channel, residues 1644-1664. The interaction of two local anesthetics (LA), lidocaine and benzocaine, with pIV/S4-S5 has been studied by DOSY, heteronuclear NMR 1H-15N-HSQC spectroscopy and computational methods. DOSY indicates that benzocaine, a neutral ester, exhibits stronger interaction with pIV/S4-S5 than lidocaine, a charged amine-amide. Weighted average chemical shifts, Deltadelta(1H-15N), show that benzocaine affects residues L1653, M1655 and S1656 while lidocaine slightly perturbs residues I1646, L1649 and A1659, L1660, near the N- and C-terminus, respectively. Computational methods confirmed the stability of the benzocaine binding and the existence of two binding sites for lidocaine. Even considering that the approach of studying the peptide in the presence of a co-solvent (TFE/H2O, 30%/70% v/v) has an inherently limited implication, our data strongly support the existence of multiple LA binding sites in the IV/S4-S5 linker, as suggested in the literature. In addition, we consider that LA can bind to the S4-S5 linker with diverse binding modes and strength since this linker is part of the receptor for the "inactivation gate particle". Conditions for devising new functional studies, aiming to better understand Na+ channel functionality as well as the various facets of LA pharmacological activity are proposed in this work.

  18. Emerging role of calcium-activated potassium channel in the regulation of cell viability following potassium ions challenge in HEK293 cells and pharmacological modulation.

    Directory of Open Access Journals (Sweden)

    Domenico Tricarico

    Full Text Available Emerging evidences suggest that Ca(2+activated-K(+-(BK channel is involved in the regulation of cell viability. The changes of the cell viability observed under hyperkalemia (15 mEq/L or hypokalemia (0.55 mEq/L conditions were investigated in HEK293 cells expressing the hslo subunit (hslo-HEK293 in the presence or absence of BK channel modulators. The BK channel openers(10(-11-10(-3M were: acetazolamide(ACTZ, Dichlorphenamide(DCP, methazolamide(MTZ, bendroflumethiazide(BFT, ethoxzolamide(ETX, hydrochlorthiazide(HCT, quercetin(QUERC, resveratrol(RESV and NS1619; and the BK channel blockers(2 x 10(-7M-5 x 10(-3M were: tetraethylammonium(TEA, iberiotoxin(IbTx and charybdotoxin(ChTX. Experiments on cell viability and channel currents were performed using cell counting kit-8 and patch-clamp techniques, respectively. Hslo whole-cell current was potentiated by BK channel openers with different potency and efficacy in hslo-HEK293. The efficacy ranking of the openers at -60 mV(Vm was BFT> ACTZ >DCP ≥RESV≥ ETX> NS1619> MTZ≥ QUERC; HCT was not effective. Cell viability after 24 h of incubation under hyperkalemia was enhanced by 82+6% and 33+7% in hslo-HEK293 cells and HEK293 cells, respectively. IbTx, ChTX and TEA enhanced cell viability in hslo-HEK293. BK openers prevented the enhancement of the cell viability induced by hyperkalemia or IbTx in hslo-HEK293 showing an efficacy which was comparable with that observed as BK openers. BK channel modulators failed to affect cell currents and viability under hyperkalemia conditions in the absence of hslo subunit. In contrast, under hypokalemia cell viability was reduced by -22+4% and -23+6% in hslo-HEK293 and HEK293 cells, respectively; the BK channel modulators failed to affect this parameter in these cells. In conclusion, BK channel regulates cell viability under hyperkalemia but not hypokalemia conditions. BFT and ACTZ were the most potent drugs either in activating the BK current and in preventing the

  19. Emerging role of calcium-activated potassium channel in the regulation of cell viability following potassium ions challenge in HEK293 cells and pharmacological modulation.

    Science.gov (United States)

    Tricarico, Domenico; Mele, Antonietta; Calzolaro, Sara; Cannone, Gianluigi; Camerino, Giulia Maria; Dinardo, Maria Maddalena; Latorre, Ramon; Conte Camerino, Diana

    2013-01-01

    Emerging evidences suggest that Ca(2+)activated-K(+)-(BK) channel is involved in the regulation of cell viability. The changes of the cell viability observed under hyperkalemia (15 mEq/L) or hypokalemia (0.55 mEq/L) conditions were investigated in HEK293 cells expressing the hslo subunit (hslo-HEK293) in the presence or absence of BK channel modulators. The BK channel openers(10(-11)-10(-3)M) were: acetazolamide(ACTZ), Dichlorphenamide(DCP), methazolamide(MTZ), bendroflumethiazide(BFT), ethoxzolamide(ETX), hydrochlorthiazide(HCT), quercetin(QUERC), resveratrol(RESV) and NS1619; and the BK channel blockers(2 x 10(-7)M-5 x 10(-3)M) were: tetraethylammonium(TEA), iberiotoxin(IbTx) and charybdotoxin(ChTX). Experiments on cell viability and channel currents were performed using cell counting kit-8 and patch-clamp techniques, respectively. Hslo whole-cell current was potentiated by BK channel openers with different potency and efficacy in hslo-HEK293. The efficacy ranking of the openers at -60 mV(Vm) was BFT> ACTZ >DCP ≥RESV≥ ETX> NS1619> MTZ≥ QUERC; HCT was not effective. Cell viability after 24 h of incubation under hyperkalemia was enhanced by 82+6% and 33+7% in hslo-HEK293 cells and HEK293 cells, respectively. IbTx, ChTX and TEA enhanced cell viability in hslo-HEK293. BK openers prevented the enhancement of the cell viability induced by hyperkalemia or IbTx in hslo-HEK293 showing an efficacy which was comparable with that observed as BK openers. BK channel modulators failed to affect cell currents and viability under hyperkalemia conditions in the absence of hslo subunit. In contrast, under hypokalemia cell viability was reduced by -22+4% and -23+6% in hslo-HEK293 and HEK293 cells, respectively; the BK channel modulators failed to affect this parameter in these cells. In conclusion, BK channel regulates cell viability under hyperkalemia but not hypokalemia conditions. BFT and ACTZ were the most potent drugs either in activating the BK current and in preventing

  20. BK virus-associated hemorrhagic cystitis after pediatric stem cell transplantation

    OpenAIRE

    Han, Seung Beom; Cho, Bin; Kang, Jin Han

    2014-01-01

    Hemorrhagic cystitis is a common stem cell transplantation-related complication. The incidence of early-onset hemorrhagic cystitis, which is related to the pretransplant conditioning regimen, has decreased with the concomitant use of mesna and hyperhydration. However, late-onset hemorrhagic cystitis, which is usually caused by the BK virus, continues to develop. Although the BK virus is the most common pathogenic microorganism of poststem cell transplantation late-onset hemorrhagic cystitis, ...

  1. Topographical localization of the C-terminal region of the voltage-dependent sodium channel from Electrophorus electricus using antibodies raised against a synthetic peptide

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, R.D.; Fieles, W.E.; Schotland, D.L.; Hogue-Angeletti, R.; Barchi, R.L.

    1987-01-01

    A peptide corresponding to amino acid residues 1783-1794 near the C terminus of the electric eel sodium channel primary sequence of the eel (Electrophorus electricus) sodium channel has been synthesized and used to raise an antiserum in rabbits. This antiserum specifically recognized the peptide in a solid-phase radioimmunoassay. Specificity of the antiserum for the native channel protein was shown by its specific binding to a 280-kDa protein in immunoblots of eel electroplax membrane proteins. The antiserum also specifically labeled the innervated membrane of the eel electroplax in immunofluorescent studies. The membrane topology of the peptide recognized by this antiserum was proved in binding studies using oriented electroplax membrane vesicles. These vesicles were 98% right-side-out as determined by (/sup 3/H)saxitoxin binding. Binding of the antipeptide antiserum to this fraction was measured before and after permeabilization with 0.01% saponin. Specific binding to intact vesicles was low, but this binding increased 10-fold after permeabilization, implying a cytoplasmic orientation for the peptide. Confirmation for this orientation was then sought by localizing the antibody bound to intact electroplax cells with immunogold electron microscopy. The data imply that the region of the sodium channel primary sequence near the C terminus that is recognized by the anitserum is localized on the cytoplasmic side of the membrane; this localization provides some further constraints on models of sodium channel tertiary structure.

  2. Topographical localization of the C-terminal region of the voltage-dependent sodium channel from Electrophorus electricus using antibodies raised against a synthetic peptide

    International Nuclear Information System (INIS)

    A peptide corresponding to amino acid residues 1783-1794 near the C terminus of the electric eel sodium channel primary sequence of the eel (Electrophorus electricus) sodium channel has been synthesized and used to raise an antiserum in rabbits. This antiserum specifically recognized the peptide in a solid-phase radioimmunoassay. Specificity of the antiserum for the native channel protein was shown by its specific binding to a 280-kDa protein in immunoblots of eel electroplax membrane proteins. The antiserum also specifically labeled the innervated membrane of the eel electroplax in immunofluorescent studies. The membrane topology of the peptide recognized by this antiserum was proved in binding studies using oriented electroplax membrane vesicles. These vesicles were 98% right-side-out as determined by [3H]saxitoxin binding. Binding of the antipeptide antiserum to this fraction was measured before and after permeabilization with 0.01% saponin. Specific binding to intact vesicles was low, but this binding increased 10-fold after permeabilization, implying a cytoplasmic orientation for the peptide. Confirmation for this orientation was then sought by localizing the antibody bound to intact electroplax cells with immunogold electron microscopy. The data imply that the region of the sodium channel primary sequence near the C terminus that is recognized by the anitserum is localized on the cytoplasmic side of the membrane; this localization provides some further constraints on models of sodium channel tertiary structure

  3. Froth characteristic of MIBC and BK-201 frothers%起泡剂MIBC和BK-201的浮选泡沫特性

    Institute of Scientific and Technical Information of China (English)

    曾培; 欧乐明; 冯其明; 李洪强; 张福亚

    2015-01-01

    选用非极性基结构不同的起泡剂MIBC和BK-201,利用自制的泡沫性能测试系统,在两相泡沫体系下,测定两相泡沫不同高度处的气泡直径、静压强、表观溢流速度,研究起泡剂对泡沫特征及夹带的影响.结果表明:增加起泡剂浓度,气泡的兼并行为受到抑制,气泡直径逐渐减小;当MIBC浓度超过75 mg/L、BK-201浓度超过150 mg/L时,兼并行为受到显著抑制,气泡直径基本保持不变.在相同的浓度下,相比MIBC,BK-201产生的泡沫气泡直径大、含液率低、水回收速率低.因而,微细粒脉石在BK-201所形成泡沫中夹带更弱,浮选选择性更好.%By using self-designed foam property testing system, two nonpolar base structure frothers, MIBC and BK-201 were chosen to study the influences of frothers on the foam characteristic and entrainment by measuring the bubble diameter, static pressure and apparent flooding velocity in the two-phase foam. The results show that bubble merger degree reduces and air bubble diameter decreases with increasing frothers concentration. When the concentrations of MIBC and BK-201 are more than 75 and 150 mg/L, respectively, the air bubble diameter basically remains unchanged because the merger behavior is dramatically depressed. Under the same concentration, BK-201 generates larger diameter bubble, lower liquid holdup and lower water recovery compared with MIBC. As a result, the foam entrainment of fine gangue is weaker and the selectivity of flotation is better when BK-201 is used.

  4. Expression and localization of inwardly rectifying potassium channel Kit2.1 in glia cells of native bovine retina

    Institute of Scientific and Technical Information of China (English)

    PAN Ai-hua; LUO Xue-gang

    2005-01-01

    Objective The purpose of this study is to identify the molecular basis of the contacting -neuron membrane K+ conductance in glia cells of native bovine retina. Methods RT-PCR, Northern blot and Western blot analyses were used to detect the expression of the inwardly rectifying K+ (Kir) channel subunits Kir2.1 in native bovine RPE and neural retina. The distribution of Kir2.1 protein was determined in frozen sections of bovine retina-RPEchoroid by indirect immunofluorescence analysis. Results RT-PCR analysis reveals Kir2.1 transcript in both RPE and neural retina. In Northern blots, Kir2.1 probe hybridizes to an appropriately sized-transcript in neural retina but not in RPE. In Western blots, Kir2.1 antibody recognizes a major monomer of about 60 kDa in neural retina but not in RPE. Immunofluorescence reveals that Kir2.1 immunostaining is expressed at many parts of Muller cells, especially in the membrane domains of Muller cells that contact retinal neurons, i. e. , along the two stem processes,over the soma, and in the side branches extending into the synaptic layers. No immunostaining is seen in RPE. Doubling staining shows that Kir2.1 proteins and glutamine synthetase proteins which are a marker of Muller cell co-localized well. Conclusions These results reveal that Kir2.1 is localized in the Muller cells, no Kir2.1 in RPE. These data suggests that Kir2.1 may be involved in the transport of K+ in the bovine neural retina.

  5. Molecular cloning of a K+ channel from the malaria parasite Plasmodium falciparum

    DEFF Research Database (Denmark)

    Ellekvist, Peter; Ricke, Christina Høier; Litman, Thomas;

    2004-01-01

    concentrations of K(+) when inside the erythrocyte and low concentrations when in plasma. In the recently published genome of P. falciparum, we have identified a gene, pfkch1, encoding a potential K(+) channel, which to some extent resembles the big-conductance (BK) K(+) channel. We have cloned the approximately...

  6. Phase 1b randomized trial and follow-up study in Uganda of the blood-stage malaria vaccine candidate BK-SE36.

    Directory of Open Access Journals (Sweden)

    Nirianne Marie Q Palacpac

    Full Text Available BACKGROUND: Up to now a malaria vaccine remains elusive. The Plasmodium falciparum serine repeat antigen-5 formulated with aluminum hydroxyl gel (BK-SE36 is a blood-stage malaria vaccine candidate that has undergone phase 1a trial in malaria-naive Japanese adults. We have now assessed the safety and immunogenicity of BK-SE36 in a malaria endemic area in Northern Uganda. METHODS: We performed a two-stage, randomized, single-blinded, placebo-controlled phase 1b trial (Current Controlled trials ISRCTN71619711. A computer-generated sequence randomized healthy subjects for 2 subcutaneous injections at 21-day intervals in Stage1 (21-40 year-olds to 1-mL BK-SE36 (BKSE1.0 (n = 36 or saline (n = 20 and in Stage2 (6-20 year-olds to BKSE1.0 (n = 33, 0.5-mL BK-SE36 (BKSE0.5 (n = 33, or saline (n = 18. Subjects and laboratory personnel were blinded. Safety and antibody responses 21-days post-second vaccination (Day42 were assessed. Post-trial, to compare the risk of malaria episodes 130-365 days post-second vaccination, Stage2 subjects were age-matched to 50 control individuals. RESULTS: Nearly all subjects who received BK-SE36 had induration (Stage1, n = 33, 92%; Stage2, n = 63, 96% as a local adverse event. No serious adverse event related to BK-SE36 was reported. Pre-existing anti-SE36 antibody titers negatively correlated with vaccination-induced antibody response. At Day42, change in antibody titers was significant for seronegative adults (1.95-fold higher than baseline [95% CI, 1.56-2.43], p = 0.004 and 6-10 year-olds (5.71-fold [95% CI, 2.38-13.72], p = 0.002 vaccinated with BKSE1.0. Immunogenicity response to BKSE0.5 was low and not significant (1.55-fold [95% CI, 1.24-1.94], p = 0.75. In the ancillary analysis, cumulative incidence of first malaria episodes with ≥5000 parasites/µL was 7 cases/33 subjects in BKSE1.0 and 10 cases/33 subjects in BKSE0.5 vs. 29 cases/66 subjects in the control group. Risk ratio

  7. Pharmacological investigation of the role of ion channels in salivary secretion

    DEFF Research Database (Denmark)

    Stummann, Tina C; Poulsen, Jørgen H; Hay-Schmidt, Anders;

    2003-01-01

    The role of K+ and Cl- channels in salivary secretion was investigated, with emphasis on the potential role of Ca2+ -activated K+ channels. Ligand saturation kinetic assays and autoradiography showed large-conductance (BK) K+ channels to be highly expressed in rat submandibular and parotid glands......, whereas low-conductance (SK) K+ channels could not be detected. To investigate the role of K+ and Cl- channels in secretion, intact rabbit submandibular glands were vascularly perfused and secretion induced by 10 microM ACh. Secretion was inhibited by 34+/-3% following perfusion with the general K......+ channel inhibitor Ba2+ (5 mM), whereas organic inhibitors of BK (200 nM paxilline) or intermediate-conductance (IK) K+ channels (5 microM clotrimazole) had no effect. Secretion was strongly influenced by Cl- channel inhibitors, as 100 microM 5-nitro-2-(3-phenylpropylamino)benzoate (NPPB) completely...

  8. A BK inequality for randomly drawn subsets of fixed size

    CERN Document Server

    Berg, J van den

    2011-01-01

    The BK inequality, proved by van den Berg and Kesten \\cite{BeKe85}, says that, for product measures on $\\Om := \\{0,1\\}^n$, the probability that two increasing events $A$ and $B$ 'occur disjointly' is smaller than or equal to the product of the two individual probabilities. Their conjecture that this holds for {\\em all} events was proved by Reimer \\cite{Re00}. In spite of Reimer's work, several fundamental problems in this area remained open. For instance, although it is easy to see that non-product measures can not satisfy the above inequality for all events, there are several such measures on $\\Om$ which, intuitively, should satisfy the inequality for all increasing events. One of the most 'natural' candidates is what we call here the $k$-out-of-$n$ measure, the measure assigning equal probabilities to all elements of $\\Om$ with exactly $k$ 1's (and probability 0 to all other elements). The main contribution of this paper is a proof for these measures. Remarkably, although the $k$-out-of-$n$ measures are not...

  9. BK virus infection in human immunodeficiency virus-infected patients.

    Science.gov (United States)

    Ledesma, J; Muñoz, P; Garcia de Viedma, D; Cabrero, I; Loeches, B; Montilla, P; Gijon, P; Rodriguez-Sanchez, B; Bouza, E

    2012-07-01

    The aim of this study is to evaluate the prevalence of BK virus (BKV) infection in HIV-positive patients receiving highly active antiretroviral therapy (HAART) in our hospital. The presence of BKV was analysed in urine and plasma samples from 78 non-selected HIV-infected patients. Clinical data were recorded using a pre-established protocol. We used a nested PCR to amplify a specific region of the BKV T-large antigen. Positive samples were quantified using real-time PCR. Mean CD4 count in HIV-infected patients was 472 cells/mm3 and median HIV viral load was 500 cells/mm3 (74.3% vs 25.7%; p=0.007). Viruria was present in 21.7% of healthy controls (5 out of 23 samples, p=0.02). All viral loads were low (<100 copies/mL), and we could not find any association between BKV infection and renal or neurological manifestations. We provide an update on the prevalence of BKV in HIV-infected patients treated with HAART. BKV viruria was more common in HIV-infected patients; however, no role for BKV has been demonstrated in this population.

  10. Point mutations at the local anesthetic receptor site modulate the state-dependent block of rat Na v1.4 sodium channels by pyrazoline-type insecticides.

    Science.gov (United States)

    Silver, Kristopher S; Soderlund, David M

    2007-05-01

    Pyrazoline-type insecticides (PTIs) selectively block sodium channels at membrane potentials that promote slow sodium channel inactivation and are proposed to interact with a site that overlaps the local anesthetic (LA) receptor site. Mutagenesis studies identified two amino acid residues in the S6 segment of homology domain IV (Phe-1579 and Tyr-1586 in the rat Na(v)1.4 sodium channel) as principal elements of the LA receptor. To test the hypothesis that PTIs bind to the LA receptor, we constructed mutated Na(v)1.4/F1579A and Na(v)1.4/Y1586A cDNAs, expressed native and mutated channels in Xenopus oocytes, and examined the effects of these mutations on channel block by three PTIs (indoxacarb, its bioactivation product DCJW, and RH3421) by two-electrode voltage clamp. DCJW and RH3421 had no effect on Na(v)1.4 channels held at -120mV but caused a slowly developing block upon depolarization to -30mV. Estimated IC(50) values following 15min of exposure were 1 and 4muM for DCJW and RH3421, respectively. Indoxacarb failed to block Na(v)1.4 channels under all experimental conditions. Sensitivity to block by DCJW and RH3421 at -30mV was significantly reduced in Na(v)1.4/F1579A channels, a finding that is consistent with the impact of this mutation on drug binding. In contrast to its effect on drug binding, the Y1586A mutation increased the sensitivity of Na(v)1.4 channels held at -30mV to all three compounds, conferring modest sensitivity to indoxacarb and increasing sensitivity to DCJW and RH3421 by 58- and 16-fold, respectively. These results provide direct evidence for the action of PTIs at the LA receptor.

  11. Troponin T3 regulates nuclear localization of the calcium channel Cavβ1a subunit in skeletal muscle

    International Nuclear Information System (INIS)

    The voltage-gated calcium channel (Cav) β1a subunit (Cavβ1a) plays an important role in excitation–contraction coupling (ECC), a process in the myoplasm that leads to muscle-force generation. Recently, we discovered that the Cavβ1a subunit travels to the nucleus of skeletal muscle cells where it helps to regulate gene transcription. To determine how it travels to the nucleus, we performed a yeast two-hybrid screening of the mouse fast skeletal muscle cDNA library and identified an interaction with troponin T3 (TnT3), which we subsequently confirmed by co-immunoprecipitation and co-localization assays in mouse skeletal muscle in vivo and in cultured C2C12 muscle cells. Interacting domains were mapped to the leucine zipper domain in TnT3 COOH-terminus (160–244 aa) and Cavβ1a NH2-terminus (1–99 aa), respectively. The double fluorescence assay in C2C12 cells co-expressing TnT3/DsRed and Cavβ1a/YFP shows that TnT3 facilitates Cavβ1a nuclear recruitment, suggesting that the two proteins play a heretofore unknown role during early muscle differentiation in addition to their classical role in ECC regulation. - Highlights: • Previously, we demonstrated that Cavβ1a is a gene transcription regulator. • Here, we show that TnT3 interacts with Cavβ1a. • We mapped TnT3 and Cavβ1a interaction domain. • TnT3 facilitates Cavβ1a nuclear enrichment. • The two proteins play a heretofore unknown role during early muscle differentiation

  12. Requirement of subunit co-assembly and ankyrin-G for M-channel localization at the axon initial segment

    DEFF Research Database (Denmark)

    Rasmussen, Hanne B; Frøkjaer-Jensen, Christian; Jensen, Camilla Stampe;

    2007-01-01

    The potassium channel subunits KCNQ2 and KCNQ3 are believed to underlie the M current of hippocampal neurons. The M-type potassium current plays a key role in the regulation of neuronal excitability; however, the subcellular location of the ion channels underlying this regulation has been controv...

  13. Activation of human IK and SK Ca2+ -activated K+ channels by NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime)

    DEFF Research Database (Denmark)

    Strøbaek, Dorte; Teuber, Lene; Jørgensen, Tino D;

    2004-01-01

    We have identified and characterized the compound NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime) as a potent activator of human Ca2+ -activated K+ channels of SK and IK types, whereas it is devoid of effect on BK type channels. IK- and SK-channels have previously been reported to be activated b...

  14. Impact of two different commercial DNA extraction methods on BK virus viral load

    Directory of Open Access Journals (Sweden)

    Massimiliano Bergallo

    2016-03-01

    Full Text Available Background and aim: BK virus, a member of human polyomavirus family, is a worldwide distributed virus characterized by a seroprevalence rate of 70-90% in adult population. Monitoring of viral replication is made by evaluation of BK DNA by quantitative polymerase chain reaction. Many different methods can be applied for extraction of nucleic acid from several specimens. The aim of this study was to assess the impact of two different DNA extraction procedure on BK viral load. Materials and methods: DNA extraction procedure including the Nuclisens easyMAG platform (bioMerieux, Marcy l’Etoile, France and manual QIAGEN extraction (QIAGEN Hilden, Germany. BK DNA quantification was performed by Real Time TaqMan PCR using a commercial kit. Result and discussion: The samples capacity, cost and time spent were compared for both systems. In conclusion our results demonstrate that automated nucleic acid extraction method using Nuclisense easyMAG was superior to manual protocol (QIAGEN Blood Mini kit, for the extraction of BK virus from serum and urine specimens.

  15. Co-localization of putative calcium channels (phenylalkylamine-binding sites) on oil bodies in protoplasts from dark-grown sunflower seedling cotyledons.

    Science.gov (United States)

    Vandana, Shweta; Bhatla, Satish C

    2009-07-01

    Oil bodies are spherical entities containing a triacylglycerol (TAG) matrix encased by a phospholipid monolayer, which is stabilized by oil body-specific proteins, principally oleosins. Biochemical investigations in the recent past have also demonstrated the expression of calcium-binding proteins, called caleosins, as a component of oil body membranes during seed germination. Using DM-Bodipy-phenylalkylamine (PAA; a fluorescent derivative of phenylalkylamine)-a fluorescent probe known to bind L-type calcium channel proteins, present investigations provide the first report on the localization and preferential accumulation of putative calcium channel proteins on/around oil bodies during peak lipolytic phase in protoplasts derived from dark-grown sunflower (Helianthus annuus L. cv Morden) seedling cotyledons. Specificity of DM-Bodipy-PAA labeling was confirmed by using bepridil, a non-fluorescent competitor of PAA while non-specific dye accumulation has been ruled out by using Bodipy-FL as control. Co-localization of fluorescence from DM-Bodipy-PAA binding sites (ex: 504 nm; em: 511 nm) and nile red fluorescing oil bodies (ex: 552 nm; em: 636 nm) has been undertaken by epifluorescence and confocal laser scanning microscopy (CLSM). It revealed the affinity of PAA-sensitive ion channels for the oil body surface. Findings from the current investigations highlight the significance of calcium and calcium channel proteins during oil body mobilization in sunflower.

  16. Polyoma (BK) virus associated urothelial carcinoma originating within a renal allograft five years following resolution of polyoma virus nephropathy.

    Science.gov (United States)

    Salvatore, Steven P; Myers-Gurevitch, Patricia M; Chu, Stacy; Robinson, Brian D; Dadhania, Darshana; Seshan, Surya V

    2016-03-01

    A direct role for BK polyomavirus infection in malignant tumors of renal allografts and urinary tract is emerging. Case reports suggest a link between BK virus (BKV) reactivation and development of malignancy in renal allograft recipients. Herein we describe the first case of BKV positive invasive urothelial carcinoma within the renal allograft, presenting with chronic diarrhea and weight loss 5 years following resolution of BK viremia/nephropathy (BKVN). Unique to our case was the remote history of BK viremia/BKVN, rising titer of anti-HLA antibody and presence of renal limited urothelial carcinoma with microinvasion of malignant cells staining positive for SV40 large T antigen (T-Ag). These findings suggest that persistence of subclinical BKV infection within the renal allograft may play a role in the malignant transformation of epithelial cells. Patients with history of BKVN may be at risk for kidney and urinary tract malignancy despite resolution of BK viremia/BKVN.

  17. Stimulation of large-conductance calcium-activated potassium channels inhibits neurogenic contraction of human bladder from patients with urinary symptoms and reverses acetic acid-induced bladder hyperactivity in rats.

    Science.gov (United States)

    La Fuente, José M; Fernández, Argentina; Cuevas, Pedro; González-Corrochano, Rocío; Chen, Mao Xiang; Angulo, Javier

    2014-07-15

    We have analysed the effects of large-conductance calcium-activated potassium channel (BK) stimulation on neurogenic and myogenic contraction of human bladder from healthy subjects and patients with urinary symptoms and evaluated the efficacy of activating BK to relief bladder hyperactivity in rats. Bladder specimens were obtained from organ donors and from men with benign prostatic hyperplasia (BPH). Contractions elicited by electrical field stimulation (EFS) and carbachol (CCh) were evaluated in isolated bladder strips. in vivo cystometric recordings were obtained in anesthetized rats under control and acetic acid-induced hyperactive conditions. Neurogenic contractions of human bladder were potentiated by blockade of BK and small-conductance calcium-activated potassium channels (SK) but were unaffected by the blockade of intermediate calcium-activated potassium channels (IK). EFS-induced contractions were inhibited by BK stimulation with NS-8 or NS1619 or by SK/IK stimulation with NS309 (3µM). CCh-induced contractions were not modified by blockade or stimulation of BK, IK or SK. The anti-cholinergic agent, oxybutynin (0.3µM) inhibited either neurogenic or CCh-induced contractions. Neurogenic contractions of bladders from BPH patients were less sensitive to BK inhibition and more sensitive to BK activation than healthy bladders. The BK activator, NS-8 (5mg/kg; i.v.), reversed bladder hyperactivity induced by acetic acid in rats, while oxybutynin was ineffective. NS-8 did not significantly impact blood pressure or heart rate. BK stimulation specifically inhibits neurogenic contractions in patients with urinary symptoms and relieves bladder hyperactivity in vivo without compromising bladder contractile capacity or cardiovascular safety, supporting its potential therapeutic use for relieving bladder overactivity. PMID:24747752

  18. Functional upregulation of Ca(2+-activated K(+ channels in the development of substantia nigra dopamine neurons.

    Directory of Open Access Journals (Sweden)

    José A Ramírez-Latorre

    Full Text Available Many connections in the basal ganglia are made around birth when animals are exposed to a host of new affective, cognitive, and sensori-motor stimuli. It is thought that dopamine modulates cortico-striatal synapses that result in the strengthening of those connections that lead to desired outcomes. We propose that there must be a time before which stimuli cannot be processed into functional connections, otherwise it would imply an effective link between stimulus, response, and reward in uterus. Consistent with these ideas, we present evidence that early in development dopamine neurons are electrically immature and do not produce high-frequency firing in response to salient stimuli. We ask first, what makes dopamine neurons immature? and second, what are the implications of this immaturity for the basal ganglia? As an answer to the first question, we find that at birth the outward current is small (3nS-V, insensitive to Ca(2+, TEA, BK, and SK blockers. Rapidly after birth, the outward current increases to 15nS-V and becomes sensitive to Ca(2+, TEA, BK, and SK blockers. We make a detailed analysis of the kinetics of the components of the outward currents and produce a model for BK and SK channels that we use to reproduce the outward current, and to infer the geometrical arrangement of BK and Ca(2+ channels in clusters. In the first cluster, T-type Ca(2+ and BK channels are coupled within distances of ~20 nm (200 Å. The second cluster consists of L-type Ca(2+ and BK channels that are spread over distances of at least 60 nm. As for the second question, we propose that early in development, the mechanism of action selection is in a "locked-in" state that would prevent dopamine neurons from reinforcing cortico-striatal synapses that do not have a functional experiential-based value.

  19. Mutation of light-dependent phosphorylation sites of the Drosophila transient receptor potential-like (TRPL) ion channel affects its subcellular localization and stability.

    Science.gov (United States)

    Cerny, Alexander C; Oberacker, Tina; Pfannstiel, Jens; Weigold, Sebastian; Will, Carina; Huber, Armin

    2013-05-31

    The Drosophila phototransduction cascade terminates in the opening of the ion channel transient receptor potential (TRP) and TRP-like (TRPL). Contrary to TRP, TRPL undergoes light-dependent subcellular trafficking between rhabdomeric photoreceptor membranes and an intracellular storage compartment, resulting in long term light adaptation. Here, we identified in vivo phosphorylation sites of TRPL that affect TRPL stability and localization. Quantitative mass spectrometry revealed a light-dependent change in the TRPL phosphorylation pattern. Mutation of eight C-terminal phosphorylation sites neither affected multimerization of the channels nor the electrophysiological response of flies expressing the mutated channels. However, these mutations resulted in mislocalization and enhanced degradation of TRPL after prolonged dark-adaptation. Mutation of subsets of the eight C-terminal phosphorylation sites also led to a reduction of TRPL content and partial mislocalization in the dark. This suggests that a light-dependent switch in the phosphorylation pattern of the TRPL channel mediates stable expression of TRPL in the rhabdomeres upon prolonged dark-adaptation. PMID:23592784

  20. Mutation of Light-dependent Phosphorylation Sites of the Drosophila Transient Receptor Potential-like (TRPL) Ion Channel Affects Its Subcellular Localization and Stability*

    Science.gov (United States)

    Cerny, Alexander C.; Oberacker, Tina; Pfannstiel, Jens; Weigold, Sebastian; Will, Carina; Huber, Armin

    2013-01-01

    The Drosophila phototransduction cascade terminates in the opening of the ion channel transient receptor potential (TRP) and TRP-like (TRPL). Contrary to TRP, TRPL undergoes light-dependent subcellular trafficking between rhabdomeric photoreceptor membranes and an intracellular storage compartment, resulting in long term light adaptation. Here, we identified in vivo phosphorylation sites of TRPL that affect TRPL stability and localization. Quantitative mass spectrometry revealed a light-dependent change in the TRPL phosphorylation pattern. Mutation of eight C-terminal phosphorylation sites neither affected multimerization of the channels nor the electrophysiological response of flies expressing the mutated channels. However, these mutations resulted in mislocalization and enhanced degradation of TRPL after prolonged dark-adaptation. Mutation of subsets of the eight C-terminal phosphorylation sites also led to a reduction of TRPL content and partial mislocalization in the dark. This suggests that a light-dependent switch in the phosphorylation pattern of the TRPL channel mediates stable expression of TRPL in the rhabdomeres upon prolonged dark-adaptation. PMID:23592784

  1. Evaluation of polyomavirus BK reactivation in lupus patients who underwent kidney transplantation

    Directory of Open Access Journals (Sweden)

    Cristina Costa

    2012-06-01

    Full Text Available Background. A pathogenic role for polyomavirus BK in systemic lupus erythematosus (SLE has been proposed, however no study evaluated the occurrence of BK replication in renal transplant recipients according to the underlying disease leading to transplantation and its potential impact. Methods. The occurrence of BK reactivation was serially evaluated in 468 renal transplant recipients, including 11 patients with SLE as underlying disease (overall, 2370 serum and 2370 urine specimens; 65 from SLE patients. Results. Considering the overall occurrence of viral reactivation (viremia and/or viruria, 26/65 (40% specimens were positive in four SLE patients (36.3% versus 331/2143 (15.4% in 130/227 (57.3% non-SLE patients. A patient transplanted for class III lupus nephritis evidenced sustained BK viremia and viruria (with viremia values potentially indicative of polyomavirus-associated nephropathy in the absence of clinical features of renal dysfunction or recurrence of lupus nephritis. Conclusions. Further studies on larger populations and for a longer follow-up should be required to evaluate the impact of BKV reactivation in renal transplant patients with SLE as underlying disease, as well as the potential therapeutic implications.

  2. The Disappearance of the Red Supergiant Progenitor of Supernova 2008bk

    OpenAIRE

    Mattila, Seppo; Smartt, Stephen; Maund, Justyn; Benetti, Stefano; Ergon, Mattias

    2010-01-01

    Massive stars end their lives in spectacular supernova explosions. Identifying the progenitor star is a test of stellar evolution and explosion models. Here we show that the progenitor star of the supernova SN 2008bk has now disappeared, which provides conclusive evidence that this was the death of a red supergiant star.

  3. Test du Module BECKHOFF (BK7420) Entrées/Sorties deportees sur FIPIO de SCHNEIDER

    CERN Document Server

    Palluel, J; CERN. Geneva. AB Department

    2004-01-01

    Cette note présente le test du nouveau coupleur I/O déporté sur FIPIO de Beckhoff référencé BK7420 (voir photo ci-dessous), et notamment son évaluation sur différentes longueurs par rapport à un module semblable de Schneider (Momentum 170 FNT 110 01).

  4. New properties of BK-spaces defined by using regular matrix of Fibonacci numbers

    Science.gov (United States)

    Ercan, Sinan; Bektaş, ćiǧdem A.

    2016-06-01

    In the present paper, we studied the new properties of BK-spaces which were defined using regular matrix of Fibonacci numbers in [1]. We computed alpha-, beta-, gamma- duals of these spaces and obtained Schauder basis. We also derived some topological properties of these spaces.

  5. The Effect of Inclination Angle on Critical Heat Flux in a Locally Heated Liquid Film Moving Under the Action of Gas Flow in a Mini-Channel

    Directory of Open Access Journals (Sweden)

    Tkachenko Egor M.

    2016-01-01

    Full Text Available Intensively evaporating liquid films moving under the action of the cocurrent gas flow in a microchannel are promising for the use in modern cooling systems of semiconductor devices with high local heat release. This work has studied the dependence of the critical heat flux on the inclination angle of the channel. It has been found that the inclination angle in the plane parallel to the flow has no significant effect on the critical heat flux. Whereas the inclination angle in the plane perpendicular to the flow, on the contrary, significantly changes the value of the critical heat flux. However, for a given flow rate of fluid there is a threshold gas velocity at which the critical heat flux does not differ from the case of zero inclination of the channel. Thus, it can be concluded that the cooling system based on shear-driven liquid films can be potentially used when direction of the gravity changes.

  6. Surveillance of polyomavirus BK in relation to immunosuppressive therapy in kidney transplantation

    Directory of Open Access Journals (Sweden)

    Cristina Costa

    2012-03-01

    Full Text Available Introduction. Reactivation of polyomavirus BK in kidney transplant recipients has been associated to the development of nephropathy (polyomavirus-associated nephropathy, PVAN, possibly leading to the loss of the transplanted organ. Immunosuppression is the condicio sine qua non for the onset of PVAN; however, a lower incidence of BK viremia has been reported with low-level tacrolimus based immunosuppressive protocols in comparison to cyclosporine A.Aim of this study was to compare the two immunosuppressive protocols. Methods. Virological monitoring of BK was performed in 468 consecutive renal transplant patients over a period of 3 years (2370 urine e 2370 serum specimens: in particular, 1780 specimens from 362 patients treated with tacrolimus and 590 from 106 treated with cyclosporine A. Results. BK viremia was evidenced in 124 (7.0% and 12 (2.0% specimens from 40 (11.0% and 11 (10.4% patients treated with tacrolimus and cyclosporine A, respectively; similarly, BK viruria in 289 (16.2% and 58 (9.8% specimens from 67 (18.5% and 27 (25.5% patients, being the difference of incidence highly significant (p <0.0001 for both viremia and viruria at comparison between specimens and not significant for patients. No case of PVAN was diagnosed at histophatology evaluation. Conclusions. The incidence of viremia and viruria was similar to that previously reported. Our results evidenced that with low-level tacrolimus-based protocols the overall incidence of reactivation in renal transplant patients is not significantly different and there is no increased risk of PVAN, nevertheless the higher incidence of episodes of reactivation.

  7. Intermediate-dose cidofovir without probenecid in the treatment of BK virus allograft nephropathy.

    Science.gov (United States)

    Araya, Carlos E; Lew, Judy F; Fennell, Robert S; Neiberger, Richard E; Dharnidharka, Vikas R

    2006-02-01

    BK virus allograft nephropathy (BKVAN) is a rising complication in kidney transplant recipients. Reducing immunosuppression has been the initial form of therapy in most cases, but is not always associated with improvement in graft function. Anti-viral therapy with low-dose cidofovir (0.25-0.42 mg/kg/dose) has been used successfully in some patients, but dose-related nephrotoxicity has limited its use. We present our experience with 3 kidney transplant recipients diagnosed with BKVAN who received intermediate-dose cidofovir (0.75-1.0 mg/kg/dose) without probenecid, and without concomitant nephrotoxicity. Three female patients, ages 8, 19 and 20 yr, presented with elevated serum creatinine (SCr) values, BK virus stain positive on renal biopsy and high plasma BK viral loads. As a result of viral loads being >2 million copies/ml in two patients and a lack of response to reduction in immunosuppression in the third, we initiated therapy with low-dose cidofovir. Because of persistent positive BK stain and positive plasma viral load, we then administered intermediate-dose cidofovir, without probenecid, for several subsequent doses (seven to 15 infusions till date). All patients tolerated the intermediate-dose cidofovir with no significant rise in SCr during the course of the infusions. The most recent SCr values in all three patients were improved from those at the initial diagnosis of BKVAN. All three patients showed a marked drop in BK viral loads when on intermediate-dose cidofovir, with complete clearing of viremia in two patients. In our experience, intermediate-dose cidofovir without probenecid, used judiciously, is not associated with additional nephrotoxicity and may provide an additional alternative for treatment. PMID:16499584

  8. Expression and subcellular localization of aquaporin water channels in the polarized hepatocyte cell line, WIF-B

    OpenAIRE

    Marinelli Raúl A; Splinter Patrick L; Tietz Pamela S; Gradilone Sergio A; LaRusso Nicholas F

    2005-01-01

    Abstract Background Recent data suggest that canalicular bile secretion involves selective expression and coordinated regulation of aquaporins (AQPs), a family of water channels proteins. In order to further characterize the role of AQPs in this process, an in vitro cell system with retained polarity and expression of AQPs and relevant solute transporters involved in bile formation is highly desirable. The WIF-B cell line is a highly differentiated and polarized rat hepatoma/human fibroblast ...

  9. Large-scale, high-density (up to 512 channels) recording of local circuits in behaving animals

    OpenAIRE

    Berényi, Antal; Somogyvári, Zoltán; Nagy, Anett J.; Roux, Lisa; Long, John D.; Fujisawa, Shigeyoshi; Stark, Eran; Leonardo, Anthony; Harris, Timothy D.; Buzsáki, György

    2013-01-01

    Monitoring representative fractions of neurons from multiple brain circuits in behaving animals is necessary for understanding neuronal computation. Here, we describe a system that allows high-channel-count recordings from a small volume of neuronal tissue using a lightweight signal multiplexing headstage that permits free behavior of small rodents. The system integrates multishank, high-density recording silicon probes, ultraflexible interconnects, and a miniaturized microdrive. These improv...

  10. Increased function of the TRPV1 channel in small sensory neurons after local inflammation or in vitro exposure to the pro-inflammatory cytokine GRO/KC

    Institute of Scientific and Technical Information of China (English)

    Fei Dong; Yi-Ru Du; Wenrui Xie; Judith A.Strong; Xi-Jing He; Jun-Ming Zhang

    2012-01-01

    Objective Inflammation at the level of the sensory dorsal root ganglia (DRGs) leads to robust mechanical pain behavior and the local inflammation has direct excitatory effects on sensory neurons including small,primarily nociceptive,neurons.These neurons express the transient receptor potential vanilloid-1 (TRPV 1) channel,which integrates multiple signals of pain and inflammation.The aim of this study was to characterize the regulation of the TRPV1 channel by local DRG inflammation and by growth-related oncogene (GRO/KC,systemic name:CXCL1),a cytokine known to be upregulated in inflamed DRGs.Methods Activation of the TRPV1 receptor with capsaicin was studied with patch clamp methods in acutely isolated small-diameter rat sensory neurons in primary culture.In vivo,behavioral effects of TRPV1 and GRO/KC were examined by paw injections.Results Neurons isolated from lumbar DRGs 3 days after local inflammation showed enhanced TRPV1 function:tachyphylaxis (the decline in response to repeated applications of capsaicin) was significantly reduced.A similar effect on tachyphylaxis was observed in neurons pre-treated for 4 h in vitro with GRO/KC.This effect was blocked by H-89,a protein kinase A inhibitor.Consistent with the in vitro results,in vivo behavioral responses to paw injection of capsaicin were enhanced and prolonged by pre-injecting the paw with GRO/KC 4 h before the capsaicin injection.GRO/KC paw injections alone did not elicit pain behaviors.Conclusion Function of the TRPV 1 channel is enhanced by DRG inflammation and these effects are preserved in vitro during short-term culture.The effects (decreased tachyphylaxis) are mimicked by incubation with GRO/KC,which has previously been found to be strongly upregulated in this and other pain models.

  11. Pannexin2 oligomers localize in the membranes of endosomal vesicles in mammalian cells while Pannexin1 channels traffic to the plasma membrane.

    Science.gov (United States)

    Boassa, Daniela; Nguyen, Phuong; Hu, Junru; Ellisman, Mark H; Sosinsky, Gina E

    2014-01-01

    Pannexin2 (Panx2) is the largest of three members of the pannexin proteins. Pannexins are topologically related to connexins and innexins, but serve different functional roles than forming gap junctions. We previously showed that pannexins form oligomeric channels but unlike connexins and innexins, they form only single membrane channels. High levels of Panx2 mRNA and protein in the Central Nervous System (CNS) have been documented. Whereas Pannexin1 (Panx1) is fairly ubiquitous and Pannexin3 (Panx3) is found in skin and connective tissue, both are fully glycosylated, traffic to the plasma membrane and have functions correlated with extracellular ATP release. Here, we describe trafficking and subcellular localizations of exogenous Panx2 and Panx1 protein expression in MDCK, HeLa, and HEK 293T cells as well as endogenous Panx1 and Panx2 patterns in the CNS. Panx2 was found in intracellular localizations, was partially N-glycosylated, and localizations were non-overlapping with Panx1. Confocal images of hippocampal sections immunolabeled for the astrocytic protein GFAP, Panx1 and Panx2 demonstrated that the two isoforms, Panx1 and Panx2, localized at different subcellular compartments in both astrocytes and neurons. Using recombinant fusions of Panx2 with appended genetic tags developed for correlated light and electron microscopy and then expressed in different cell lines, we determined that Panx2 is localized in the membrane of intracellular vesicles and not in the endoplasmic reticulum as initially indicated by calnexin colocalization experiments. Dual immunofluorescence imaging with protein markers for specific vesicle compartments showed that Panx2 vesicles are early endosomal in origin. In electron tomographic volumes, cross-sections of these vesicles displayed fine structural details and close proximity to actin filaments. Thus, pannexins expressed at different subcellular compartments likely exert distinct functional roles, particularly in the nervous system.

  12. Diagnóstico y clasificación molecular del virus BK en receptores de trasplante renal

    OpenAIRE

    Riva, Omar; Cobos, Marisa; Clemente, J

    2010-01-01

    La infección primaria por virus BK ocurre durante la infancia permaneciendo latente en el tracto urogenital. En individuos que presentan alteraciones en la inmunidad celular, el virus se reactiva haciendo posible su detección en orina y sangre. En receptores de trasplante renal, la nefropatía producida por el virus BK puede llevar a la pérdida de la función del injerto. El virus BK es miembro de la familia Polyomaviridae, presenta un genoma de ADN circular doble cadena unido en forma covalent...

  13. The amiodarone derivative 2-methyl-3-(3,5-diiodo-4-carboxymethoxybenzyl)benzofuran (KB130015) opens large-conductance Ca2+-activated K+ channels and relaxes vascular smooth muscle.

    Science.gov (United States)

    Gessner, Guido; Heller, Regine; Hoshi, Toshinori; Heinemann, Stefan H

    2007-01-26

    2-methyl-3-(3,5-diiodo-4-carboxymethoxybenzyl)benzofuran (KB130015) has been developed to retain the antiarrhythmic properties of the parent molecule amiodarone but to eliminate its undesired side effects. In patch-clamp experiments, KB130015 activated large-conductance, Ca2+-activated BK(Ca) channels formed by hSlo1 (alpha) subunits in HEK 293 cells. Channels were reversibly activated by shifting the open-probability/voltage (P(o)/V) relationship by about -60 mV in 3 muM intracellular free Ca2+ ([Ca2+]in). No effect on the single-channel conductance was observed. KB130015-mediated activation of BK(Ca) channels was half-maximal at 20 microM with a Hill coefficient of 2.8. BK(Ca) activation by KB130015 did not require the presence of Ca2+ and still occurred with saturating (100 microM) [Ca2+]in. Effects of the prototypic BK(Ca) activator NS1619 (1,3-dihydro-1-[2-hydroxy-5-(trifluoromethyl)phenyl]-5-(trifluoromethyl)-2H-benzimidazol-2-one) and those of KB130015 were not additive suggesting that both activators may at least partially share a common mechanism of action. KB130015-mediated activation was observed also for BK(Ca) channels from insects and for human BK(Ca) channels with already profoundly left-shifted voltage-dependence. In contrast, human intermediate conductance Ca2+-activated channels were inhibited by KB130015. Using segments of porcine pulmonary arteries, KB130015 induced endothelium-independent vasorelaxation, half-maximal at 43 microM KB130015. Relaxation was inhibited by 1 mM tetraethylammonium, suggesting that KB130015 can activate vascular smooth muscle type BK(Ca) channels under physiological conditions. Interestingly, the shift in the P(o)/V relationship was considerably stronger (-90 mV in 3 microM [Ca2+]in) for BK(Ca) channels containing Slo-beta1 subunits. Thus, KB130015 belongs to a novel class of BK(Ca) channel openers that exert an effect depending on the subunit composition of the channel complex.

  14. Experimental Evaluation of the Local Packing Distributed Dynamic Channel Allocation Strategy Application for AI-Madar Telephone Telecommunication Network in Libya

    Directory of Open Access Journals (Sweden)

    Mohamed Yousef Ahmed Abou-Hussein

    2014-06-01

    Full Text Available The great challenge of the remarkably growing demand for personal communication mobile service in Libya has actively motivated Al-Madar Telephone Telecommunication Company to adopt various techniques in order to substantially improve its network capacity. An efficient allocation strategy of communication channels that could ensure good performance of the cellular network is critically needed, given the limited spectrum currently available that uses the Fixed Channel Allocation (FCA strategy. In this study, experimental investigations were conducted to improve Al-Madar Company network by proposing the evaluation of the adoption of the Local Packing Distributed Dynamic Channel Allocation (LP-DDCA strategy. The main reasons for proposing the adoption of the LP-DDCA strategy are; to minimize the call blocking probability, enhancing the network performance and increasing the number of network subscribers. This work has been done by applying actual data from an existing cellular network of Al-Madar Company in to the experimental simulation program. The results demonstrated clearly the superiority of the proposed the LP-DDCA strategy in the investigated locations (cells compared with the currently used FCA strategy. Conclusion: Application of the LP-DDCA strategy could give rise to substantial improvement in Al-Madar telecommunication mobile network performance and it will considerably increase the number of network subscribers.

  15. Positions of the cytoplasmic end of BK α S0 helix relative to S1-S6 and of β1 TM1 and TM2 relative to S0-S6.

    Science.gov (United States)

    Liu, Guoxia; Zakharov, Sergey I; Yao, Yongneng; Marx, Steven O; Karlin, Arthur

    2015-03-01

    The large-conductance, voltage- and Ca(2+)-gated K(+) (BK) channel consists of four α subunits, which form a voltage- and Ca(2+)-gated channel, and up to four modulatory β subunits. The β1 subunit is expressed in smooth muscle, where it slows BK channel kinetics and shifts the conductance-voltage (G-V) curve to the left at [Ca(2+)] > 2 µM. In addition to the six transmembrane (TM) helices, S1-S6, conserved in all voltage-dependent K(+) channels, BK α has a unique seventh TM helix, S0, which may contribute to the unusual rightward shift in the G-V curve of BK α in the absence of β1 and to a leftward shift in its presence. Such a role is supported by the close proximity of S0 to S3 and S4 in the voltage-sensing domain. Furthermore, on the extracellular side of the membrane, one of the two TM helices of β1, TM2, is adjacent to S0. We have now analyzed induced disulfide bond formation between substituted Cys residues on the cytoplasmic side of the membrane. There, in contrast, S0 is closest to the S2-S3 loop, from which position it is displaced on the addition of β1. The cytoplasmic ends of β1 TM1 and TM2 are adjacent and are located between the S2-S3 loop of one α subunit and S1 of a neighboring α subunit and are not adjacent to S0; i.e., S0 and TM2 have different trajectories through the membrane. In the absence of β1, 70% of disulfide bonding of W43C (S0) and L175C (S2-S3) has no effect on V50 for activation, implying that the cytoplasmic end of S0 and the S2-S3 loop move in concert, if at all, during activation. Otherwise, linking them together in one state would obstruct the transition to the other state, which would certainly change V50.

  16. Deviation from local thermal equilibrium in SF6 post-arc channel exposed to transient recovery voltage

    OpenAIRE

    Matsubara, Takuji; Tanaka, Yasunori; Yokomizu, Yasunobu; Matsumura, Toshiro

    1998-01-01

    Summary form only given. This paper describes the influence of applied electric field on properties of a SF6 post-arc channel. First, electrical conductivity, enthalpy and mass density of electron and heavy particles in a SF6 plasma were calculated as a functions of Te and Tg. Secondly, using this data, time variations in Te and Tg were computed in an SF6 plasma to which high electric field was applied. The calculated results revealed that applied electric field increased T e and caused devia...

  17. Subcellular localization of the delayed rectifier K(+) channels KCNQ1 and ERG1 in the rat heart

    DEFF Research Database (Denmark)

    Rasmussen, Hanne Borger; Møller, Morten; Knaus, Hans-Günther;

    2003-01-01

    -a-go-go-related gene-1 (ERG1), was investigated in the adult rat heart. Confocal immunofluorescence microscopy of atrial and ventricular cells revealed that whereas KCNQ1 labeling was detected in both the peripheral sarcolemma and a structure transversing the myocytes, ERG1 immunoreactivity was confined to the latter....... Immunoelectron microscopy of atrial and ventricular myocytes showed that the ERG1 channel was primarily expressed in the transverse tubular system and its entrance, whereas KCNQ1 was detected in both the peripheral sarcolemma and in the T tubules. Thus, whereas ERG1 displays a very restricted subcellular...

  18. Stress channelling in extreme couple-stress materials Part II: Localized folding vs faulting of a continuum in single and cross geometries

    Science.gov (United States)

    Gourgiotis, Panos A.; Bigoni, Davide

    2016-03-01

    The antiplane strain Green's functions for an applied concentrated force and moment are obtained for Cosserat elastic solids with extreme anisotropy, which can be tailored to bring the material in a state close to an instability threshold such as failure of ellipticity. It is shown that the wave propagation condition (and not ellipticity) governs the behaviour of the antiplane strain Green's functions. These Green's functions are used as perturbing agents to demonstrate in an extreme material the emergence of localized (single and cross) stress channelling and the emergence of antiplane localized folding (or creasing, or weak elastostatic shock) and faulting (or elastostatic shock) of a Cosserat continuum, phenomena which remain excluded for a Cauchy elastic material. During folding some components of the displacement gradient suffer a finite jump, whereas during faulting the displacement itself displays a finite discontinuity.

  19. Functional effects of KCNQ K+ channels in airway smooth muscle

    Science.gov (United States)

    Evseev, Alexey I.; Semenov, Iurii; Archer, Crystal R.; Medina, Jorge L.; Dube, Peter H.; Shapiro, Mark S.; Brenner, Robert

    2013-01-01

    KCNQ (Kv7) channels underlie a voltage-gated K+ current best known for control of neuronal excitability, and its inhibition by Gq/11-coupled, muscarinic signaling. Studies have indicated expression of KCNQ channels in airway smooth muscle (ASM), a tissue that is predominantly regulated by muscarinic receptor signaling. Therefore, we investigated the function of KCNQ channels in rodent ASM and their interplay with Gq/11-coupled M3 muscarinic receptors. Perforated-patch clamp of dissociated ASM cells detected a K+ current inhibited by the KCNQ antagonist, XE991, and augmented by the specific agonist, flupirtine. KCNQ channels begin to activate at voltages near resting potentials for ASM cells, and indeed XE991 depolarized resting membrane potentials. Muscarinic receptor activation inhibited KCNQ current weakly (~20%) at concentrations half-maximal for contractions. Thus, we were surprised to see that KCNQ had no affect on membrane voltage or muscle contractility following muscarinic activation. Further, M3 receptor-specific antagonist J104129 fumarate alone did not reveal KCNQ effects on muscarinic evoked depolarization or contractility. However, a role for KCNQ channels was revealed when BK-K+ channel activities are reduced. While KCNQ channels do control resting potentials, they appear to play a redundant role with BK calcium-activated K+ channels during ASM muscarinic signaling. In contrast to effect of antagonist, we observe that KCNQ agonist flupirtine caused a significant hyperpolarization and reduced contraction in vitro irrespective of muscarinic activation. Using non-invasive whole animal plethysmography, the clinically approved KCNQ agonist retigabine caused a transient reduction in indexes of airway resistance in both wild type and BK β1 knockout (KO) mice treated with the muscarinic agonist. These findings indicate that KCNQ channels can be recruited via agonists to oppose muscarinic evoked contractions and may be of therapeutic value as bronchodilators

  20. Functional effects of KCNQ K(+) channels in airway smooth muscle.

    Science.gov (United States)

    Evseev, Alexey I; Semenov, Iurii; Archer, Crystal R; Medina, Jorge L; Dube, Peter H; Shapiro, Mark S; Brenner, Robert

    2013-01-01

    KCNQ (Kv7) channels underlie a voltage-gated K(+) current best known for control of neuronal excitability, and its inhibition by Gq/11-coupled, muscarinic signaling. Studies have indicated expression of KCNQ channels in airway smooth muscle (ASM), a tissue that is predominantly regulated by muscarinic receptor signaling. Therefore, we investigated the function of KCNQ channels in rodent ASM and their interplay with Gq/11-coupled M3 muscarinic receptors. Perforated-patch clamp of dissociated ASM cells detected a K(+) current inhibited by the KCNQ antagonist, XE991, and augmented by the specific agonist, flupirtine. KCNQ channels begin to activate at voltages near resting potentials for ASM cells, and indeed XE991 depolarized resting membrane potentials. Muscarinic receptor activation inhibited KCNQ current weakly (~20%) at concentrations half-maximal for contractions. Thus, we were surprised to see that KCNQ had no affect on membrane voltage or muscle contractility following muscarinic activation. Further, M3 receptor-specific antagonist J104129 fumarate alone did not reveal KCNQ effects on muscarinic evoked depolarization or contractility. However, a role for KCNQ channels was revealed when BK-K(+) channel activities are reduced. While KCNQ channels do control resting potentials, they appear to play a redundant role with BK calcium-activated K(+) channels during ASM muscarinic signaling. In contrast to effect of antagonist, we observe that KCNQ agonist flupirtine caused a significant hyperpolarization and reduced contraction in vitro irrespective of muscarinic activation. Using non-invasive whole animal plethysmography, the clinically approved KCNQ agonist retigabine caused a transient reduction in indexes of airway resistance in both wild type and BK β1 knockout (KO) mice treated with the muscarinic agonist. These findings indicate that KCNQ channels can be recruited via agonists to oppose muscarinic evoked contractions and may be of therapeutic value as

  1. Functional effects of KCNQ K+ channels in airway smooth muscle

    Directory of Open Access Journals (Sweden)

    Alexey I Evseev

    2013-10-01

    Full Text Available KCNQ (Kv7 channels underlie a voltage-gated K+ current best known for control of neuronal excitability, and its inhibition by Gq/11-coupled, muscarinic signaling. Studies have indicated expression of KCNQ channels in airway smooth muscle (ASM, a tissue that is predominantly regulated by muscarinic receptor signaling. Therefore we investigated the function of KCNQ channels in rodent ASM and their interplay with Gq/11-coupled M3 muscarinic receptors. Perforated-patch clamp of dissociated ASM cells detected a K+ current inhibited by the KCNQ antagonist, XE991, and augmented by the specific agonist, flupirtine. KCNQ channels begin to activate at voltages near resting potentials for ASM cells, and indeed XE991 depolarized resting membrane potentials. Muscarinic receptor activation inhibited KCNQ current weakly (~20% at concentrations half-maximal for contractions. Thus, we were surprised to see that KCNQ had no affect on membrane voltage or muscle contractility following muscarinic activation. Further, M3 receptor-specific antagonist J104129 fumarate alone did not reveal KCNQ effects on muscarinic evoked depolarization or contractility. However a role for KCNQ channels was revealed when BK-K+ channel activities are reduced. While KCNQ channels do control resting potentials, they appear to play a redundant role with BK calcium-activated K+ channels during ASM muscarinic signaling. In contrast to effect of antagonist, we observe that KCNQ agonist flupirtine caused a significant hyperpolarization and reduced contraction in vitro irrespective of muscarinic activation. Using non-invasive whole animal plethysmography, the clinically approved KCNQ agonist retigabine caused a transient reduction in indexes of airway resistance in both wild type and BK β1 knockout mice treated with the muscarinic agonist. These findings indicate that KCNQ channels can be recruited via agonists to oppose muscarinic evoked contractions and may be of therapeutic value as

  2. New Marketing Channel for Special Local Agricultural Products in Anhui Province%安徽省特色农产品营销渠道创新

    Institute of Scientific and Technical Information of China (English)

    王亮; 雷勋平

    2012-01-01

    In Anhui Province, special local agricultural products represent local brands and play an importanl and leading role in forming the agricultural product structure and in increasing farmers' income. The marketing channels for thesc products have been basically formed, but there arc still some problems. We have conducted extensive researches in major areas of the province and in this paper we put forward new strategies concerning marketing channels of these products in the hope to promote development of agricultural businesses and further increase farmers' income.%特色农产品在安徽省整个农产品结构中发挥着重要的引领作用,是地方农产品品牌的代表,其产业发展对于农民增收具有重要的推动作用。安徽省特色农产品营销渠道虽已初步形成,但尚存在一些问题。本课题组通过对安徽省典型地区进行广泛调研,提出安徽省特色农产品渠道创新策略,希望促进农民的增收和农业企业的发展。

  3. Transient versus Persistent BK Viremia and Long-Term Outcomes after Kidney and Kidney–Pancreas Transplantation

    Science.gov (United States)

    Elfadawy, Nissreen; Schold, Jesse D.; Srinivas, Titte R.; Poggio, Emilio; Fatica, Richard; Avery, Robin; Mossad, Sherif B.

    2014-01-01

    Background and objectives The objective was to study the long-term impact of transient versus persistent BK viremia on kidney transplant outcomes. Design, setting, participants, & measurements In total, 609 recipients who underwent kidney transplant from 2007 to 2011 were screened at months 1–12 for the occurrence of polyomavirus BK viremia; 130 patients (21.7%) developed BK viremia during the first year post-transplant. BK viremia patients were classified according to duration of infection (more or less than 3 months), and BK viral loads (more or less than 10,000 copies/ml) were classified as transient low viremia (n=42), transient high viremia (n=18), persistent low viremia (n=23), and persistent high viremia (n=47). All patients were followed a median of 36 (3–66) months. The rates of BK polyomavirus–associated nephropathy, acute rejection, and 1-year graft function were compared with the polyomavirus BK–negative control group. Results Patient and graft survival were not significantly different among the groups. Graft function (creatinine; milligrams per deciliter) at 1 year was significantly worse in the persistent high viremia (1.75±0.6) and transient high viremia (1.85±0.7) groups compared with aviremic controls (1.47±0.4; P=0.01 and P=0.01, respectively). The incidence of BK polyomavirus–associated nephropathy was limited to the persistent high viremia group (1.3%, P<0.001). The transient high viremia (50%) and persistent high viremia (34%) groups showed significantly (P=0.01) increased incidence of acute rejection versus aviremic controls (21.5%), transient low viremia (19%), or persistent low viremia (17.3%) groups. Conclusion Low viral load BK viremia, either transient or persistent, was not associated with long-term transplant outcomes. Persistent high viremia was associated with a greater risk for BK polyomavirus–associated nephropathy and subsequent graft dysfunction. Although transient high viremia was not associated with BK

  4. Transient Receptor Potential Ankyrin 1 Channel Localized to Non-Neuronal Airway Cells Promotes Non-Neurogenic Inflammation

    DEFF Research Database (Denmark)

    Nassini, Romina; Pedretti, Pamela; Moretto, Nadia;

    2012-01-01

    inflammation in asthma or chronic obstructive pulmonary disease raises an alternative possibility that airway inflammation is promoted by non-neuronal TRPA1.By using Real-Time PCR and calcium imaging, we found that cultured human airway cells, including fibroblasts, epithelial and smooth muscle cells express...... functional TRPA1 channels. By using immunohistochemistry, TRPA1 staining was observed in airway epithelial and smooth muscle cells in sections taken from human airways and lung, and from airways and lung of wild-type, but not TRPA1-deficient mice. In cultured human airway epithelial and smooth muscle cells...... (BAL) fluid of wild-type mice. This effect of TRPA1 agonists was attenuated by TRPA1 antagonism or in TRPA1-deficient mice, but not by pharmacological ablation of sensory nerves.Our results demonstrate that, although either TRPV1 or TRPA1 activation causes airway neurogenic inflammation, solely TRPA1...

  5. Transient receptor potential ankyrin 1 channel localized to non-neuronal airway cells promotes non-neurogenic inflammation

    DEFF Research Database (Denmark)

    Nassini, Romina; Pedretti, Pamela; Moretto, Nadia;

    2012-01-01

    inflammation in asthma or chronic obstructive pulmonary disease raises an alternative possibility that airway inflammation is promoted by non-neuronal TRPA1.By using Real-Time PCR and calcium imaging, we found that cultured human airway cells, including fibroblasts, epithelial and smooth muscle cells express...... activation orchestrates an additional inflammatory response which is not neurogenic. This finding suggests that non-neuronal TRPA1 in the airways is functional and potentially capable of contributing to inflammatory airway diseases....... functional TRPA1 channels. By using immunohistochemistry, TRPA1 staining was observed in airway epithelial and smooth muscle cells in sections taken from human airways and lung, and from airways and lung of wild-type, but not TRPA1-deficient mice. In cultured human airway epithelial and smooth muscle cells...

  6. 77 FR 25077 - Special Local Regulation; Wy-Hi Rowing Regatta, Trenton Channel; Detroit River, Wyandotte, MI

    Science.gov (United States)

    2012-04-27

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulation; Wy-Hi Rowing Regatta, Trenton... navigable waters immediately prior to, during, and immediately after the Wy-Hi Rowing Regatta. This special..., the Wyandotte Boat Club is holding a rowing race that will require the immediate area to be clear...

  7. 78 FR 25572 - Special Local Regulation; Wy-Hi Rowing Regatta, Trenton Channel; Detroit River, Wyandotte, MI

    Science.gov (United States)

    2013-05-02

    ... Security FR Federal Register NPRM Notice of Proposed Rulemaking A. Regulatory History and Information The... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulation; Wy-Hi Rowing Regatta, Trenton... navigable waters immediately prior to, during, and immediately after the Wy-Hi Rowing Regatta. This...

  8. The impact of surveillance and rapid reduction in immunosuppression to control BK virus-related graft injury in kidney transplantation.

    Science.gov (United States)

    Elfadawy, Nissreen; Flechner, Stuart M; Liu, Xiaobo; Schold, Jesse; Tian, Devin; Srinivas, Titte R; Poggio, Emilio; Fatica, Richard; Avery, Robin; Mossad, Sherif B

    2013-08-01

    We prospectively screened 609 consecutive kidney (538) and kidney-pancreas (71) transplant recipients for BK viremia over a 4-year interval using polymerase chain reaction viral load detection and protocol kidney biopsies. We found that BK viremia is common at our center: total cases 26.7%, cases during first year 21.3% (mean 4 months), and recipients with ≥ 10 000 copies/ml 12.3%. We found few predictive clinical or demographic risk factors for any BK viremia or viral loads ≥ 10,000 copies/ml, other than prior treatment of biopsy confirmed acute rejection and/or higher immunosuppressive blood levels of tacrolimus (P = 0.001) or mycophenolate mofetil (P = 0.007). Viral loads at diagnosis (185 000 copies/ml at diagnosis were predictive of BK virus-associated nephropathy (BKVAN; OR: 113.25, 95% CI: 17.22-744.6, P < 0.001). Surveillance for BK viremia and rapid reduction of immunosuppression limited the incidence of BKVAN to 1.3%. The addition of leflunomide or ciprofloxacin to immunosuppressive dose reduction did not result in greater rates of viral clearance. These data support the role of early surveillance for BK viremia to limit the impact on transplant outcome, although the most effective schedule for screening awaits further investigation. PMID:23763289

  9. An Association between BK Virus Replication in Bone Marrow and Cytopenia in Kidney-Transplant Recipients

    OpenAIRE

    Emilie Pambrun; Catherine Mengelle; Geneviève Fillola; Patrick Laharrague; Laure Esposito; Isabelle Cardeau-Desangles; Arnaud Del Bello; Jacques Izopet; Lionel Rostaing; Nassim Kamar

    2014-01-01

    The human polyomavirus BK (BKV) is associated with severe complications, such as ureteric stenosis and polyomavirus-associated nephropathy (PVAN), which often occur in kidney-transplant patients. However, it is unknown if BKV can replicate within bone marrow. The aim of this study was to search for BKV replication within the bone marrow of kidney-transplant patients presenting with a hematological disorder. Seventy-two kidney-transplant patients underwent bone-marrow aspiration for cytopenia....

  10. BK/TD models for analyzing in vitro impedance data on cytotoxicity

    OpenAIRE

    Teng, Sophie; Barcellini-Couget, Sylvie; Beaudoin, Rémy; Desousa, Georges; Rahmani, Roger; Pery, Alexandre

    2015-01-01

    The ban of animal testing has enhanced the development of new in vitro technologies for cosmetics safety assessment. Impedance metrics is one such technology which enables monitoring of cell viability in real time. However, analyzing real time data requires moving from static to dynamic toxicity assessment. In the present study, we built mechanistic biokinetic/toxicodynamic (BK/TD) models to analyze the time course of cell viability in cytotoxicity assay using impedance. These models accou...

  11. Restriction of Human Polyomavirus BK Virus DNA Replication in Murine Cells and Extracts

    OpenAIRE

    Mahon, C.; Liang, B.; Tikhanovich, I.; et al

    2009-01-01

    BK virus (BKV) causes persistent and asymptomatic infections in most humans and is the etiologic agent of polyomavirus-associated nephropathy (PVAN) and other pathologies. Unfortunately, there are no animal models with which to study activation of BKV replication in the human kidney and the accompanying PVAN. Here we report studies of the restriction of BKV replication in murine cells and extracts and the cause(s) of this restriction. Upon infection of murine cells, BKV expressed large T anti...

  12. BK virus encephalopathy and sclerosing vasculopathy in a patient with hypohidrotic ectodermal dysplasia and immunodeficiency

    OpenAIRE

    Darbinyan, Armine; Major, Eugene O.; Morgello, Susan; Holland, Steven; Ryschkewitsch, Caroline; Monaco, Maria Chiara; Naidich, Thomas P.; Bederson, Joshua; Malaczynska, Joanna; Ye, Fei; Gordon, Ronald; Cunningham-Rundles, Charlotte; Fowkes, Mary; Tsankova, Nadejda M.

    2016-01-01

    Human BK polyomavirus (BKV) is reactivated under conditions of immunosuppression leading most commonly to nephropathy or cystitis; its tropism for the brain is rare and poorly understood. We present a unique case of BKV-associated encephalopathy in a man with hypohidrotic ectodermal dysplasia and immunodeficiency (HED-ID) due to IKK-gamma (NEMO) mutation, who developed progressive neurological symptoms. Brain biopsy demonstrated polyomavirus infection of gray and white matter, with predominan...

  13. Ontogenic Changes and Differential Localization of T-type Ca2+ Channel Subunits Cav3.1 and Cav3.2 in Mouse Hippocampus and Cerebellum

    Science.gov (United States)

    Aguado, Carolina; García-Madrona, Sebastián; Gil-Minguez, Mercedes; Luján, Rafael

    2016-01-01

    T-type calcium (Ca2+) channels play a central role in regulating membrane excitability in the brain. Although the contributions of T-type current to neuron output is often proposed to reflect a differential distribution of T-type channel subtypes to somato-dendritic compartments, their precise subcellular distributions in central neurons are not fully determined. Using histoblot and high-resolution immunoelectron microscopic techniques, we have investigated the expression, regional distribution and subcellular localization of T-type Cav3.1 and Cav3.2 channel subunits in the adult brain, as well as the ontogeny of expression during postnatal development. Histoblot analysis showed that Cav3.1 and Cav3.2 proteins were widely expressed in the brain, with mostly non-overlapping patterns. Cav3.1 showed the highest expression level in the molecular layer (ml) of the cerebellum (Cb), and Cav3.2 in the hippocampus (Hp) and the ml of Cb. During development, levels of Cav3.1 and Cav3.2 increased with age, although there were marked region- and developmental stage-specific differences in their expression. At the cellular and subcellular level, immunoelectron microscopy showed that labeling for Cav3.1 was present in somato-dendritic domains of hippocampal interneurons and Purkinje cells (PCs), while Cav3.2 was present in somato-dendritic domains of CA1 pyramidal cells, hippocampal interneurons and PCs. Most of the immunoparticles for Cav3.1 and Cav3.2 were either associated with the plasma membrane or the intracellular membranes, with notable differences depending on the compartment. Thus, Cav3.1 was mainly located in the plasma membrane of interneurons, whereas Cav3.2 was mainly located in the plasma membrane of dendritic spines and had a major intracellular distribution in dendritic shafts. In PCs, Cav3.1 and Cav3.2 showed similar distribution patterns. In addition to its main postsynaptic distribution, Cav3.2 but not Cav3.1 was also detected in axon terminals establishing

  14. BK/TD models for analyzing in vitro impedance data on cytotoxicity.

    Science.gov (United States)

    Teng, S; Barcellini-Couget, S; Beaudouin, R; Brochot, C; Desousa, G; Rahmani, R; Pery, A R R

    2015-06-01

    The ban of animal testing has enhanced the development of new in vitro technologies for cosmetics safety assessment. Impedance metrics is one such technology which enables monitoring of cell viability in real time. However, analyzing real time data requires moving from static to dynamic toxicity assessment. In the present study, we built mechanistic biokinetic/toxicodynamic (BK/TD) models to analyze the time course of cell viability in cytotoxicity assay using impedance. These models account for the fate of the tested compounds during the assay. BK/TD models were applied to analyze HepaRG cell viability, after single (48 h) and repeated (4 weeks) exposures to three hepatotoxic compounds (coumarin, isoeugenol and benzophenone-2). The BK/TD models properly fit the data used for their calibration that was obtained for single or repeated exposure. Only for one out of the three compounds, the models calibrated with a single exposure were able to predict repeated exposure data. We therefore recommend the use of long-term exposure in vitro data in order to adequately account for chronic hepatotoxic effects. The models we propose here are capable of being coupled with human biokinetic models in order to relate dose exposure and human hepatotoxicity. PMID:25827406

  15. BK virus as a potential oncovirus for bladder cancer in a renal transplant patient.

    Science.gov (United States)

    Yin, Wen-Yao; Lee, Ming-Che; Lai, Ning-Sheng; Lu, Ming-Chi

    2015-04-01

    Renal transplant patients have high risk for bladder cancer. The reactivation of BK virus is common in renal transplant patients especially in the urinary tract. There was some evidence suggesting that the reactivation of BK virus (BKV) in renal transplant patients may associate with the development of bladder cancer. Here we demonstrated that a patient that had persistent elevated BKV viruria (urine BKV DNA concentration more than 10(11) copies/ml) after renal transplantation. Then, bladder cancer was found in 13 months after kidney transplantation. The urine BKV DNA concentration was detected by real-time PCR and the BKV DNA in the bladder tumor was detected by PCR. BKV DNA was found in the marginal and central part of the bladder tumor. After removal of the bladder cancer, the urine BKV viral load in this patients dropped dramatically to <10(2) copies/ml. However, the urine viral load had increased modestly to 10(6) copies/ml in 3 months after surgery. Since there is a close correlation between the urine BK viral load and the presence of bladder cancer, we suggested that there might be a causal relationship between the reactivation of BKV and the development of bladder cancer in renal transplant patient.

  16. N-terminal arginines modulate plasma-membrane localization of Kv7.1/KCNE1 channel complexes.

    Directory of Open Access Journals (Sweden)

    Zenawit Girmatsion

    Full Text Available BACKGROUND AND OBJECTIVE: The slow delayed rectifier current (I(Ks is important for cardiac action potential termination. The underlying channel is composed of Kv7.1 α-subunits and KCNE1 β-subunits. While most evidence suggests a role of KCNE1 transmembrane domain and C-terminus for the interaction, the N-terminal KCNE1 polymorphism 38G is associated with reduced I(Ks and atrial fibrillation (a human arrhythmia. Structure-function relationship of the KCNE1 N-terminus for I(Ks modulation is poorly understood and was subject of this study. METHODS: We studied N-terminal KCNE1 constructs disrupting structurally important positively charged amino-acids (arginines at positions 32, 33, 36 as well as KCNE1 constructs that modify position 38 including an N-terminal truncation mutation. Experimental procedures included molecular cloning, patch-clamp recording, protein biochemistry, real-time-PCR and confocal microscopy. RESULTS: All KCNE1 constructs physically interacted with Kv7.1. I(Ks resulting from co-expression of Kv7.1 with non-atrial fibrillation '38S' was greater than with any other construct. Ionic currents resulting from co-transfection of a KCNE1 mutant with arginine substitutions ('38G-3xA' were comparable to currents evoked from cells transfected with an N-terminally truncated KCNE1-construct ('Δ1-38'. Western-blots from plasma-membrane preparations and confocal images consistently showed a greater amount of Kv7.1 protein at the plasma-membrane in cells co-transfected with the non-atrial fibrillation KCNE1-38S than with any other construct. CONCLUSIONS: The results of our study indicate that N-terminal arginines in positions 32, 33, 36 of KCNE1 are important for reconstitution of I(Ks. Furthermore, our results hint towards a role of these N-terminal amino-acids in membrane representation of the delayed rectifier channel complex.

  17. Encoding of rat working memory by power of multi-channel local field potentials via sparse non-negative matrix factorization.

    Science.gov (United States)

    Liu, Xu; Liu, Tiao-Tiao; Bai, Wen-Wen; Yi, Hu; Li, Shuang-Yan; Tian, Xin

    2013-06-01

    Working memory plays an important role in human cognition. This study investigated how working memory was encoded by the power of multi-channel local field potentials (LFPs) based on sparse nonnegative matrix factorization (SNMF). SNMF was used to extract features from LFPs recorded from the prefrontal cortex of four Sprague-Dawley rats during a memory task in a Y maze, with 10 trials for each rat. Then the power-increased LFP components were selected as working memory-related features and the other components were removed. After that, the inverse operation of SNMF was used to study the encoding of working memory in the time-frequency domain. We demonstrated that theta and gamma power increased significantly during the working memory task. The results suggested that postsynaptic activity was simulated well by the sparse activity model. The theta and gamma bands were meaningful for encoding working memory.

  18. Encoding of rat working memory by power of multi-channel local field potentials via sparse non-negative matrix factorization

    Institute of Scientific and Technical Information of China (English)

    Xu Liu; Tiao-Tiao Liu; Wen-Wen Bai; Hu Yi; Shuang-Yan Li; Xin Tian

    2013-01-01

    Working memory plays an important role in human cognition.This study investigated how working memory was encoded by the power of multi-channel local field potentials (LFPs) based on sparse nonnegative matrix factorization (SNMF).SNMF was used to extract features from LFPs recorded from the prefrontal cortex of four Sprague-Dawley rats during a memory task in a Y maze,with 10 trials for each rat.Then the power-increased LFP components were selected as working memory-related features and the other components were removed.After that,the inverse operation of SNMF was used to study the encoding of working memory in the timefrequency domain.We demonstrated that theta and gamma power increased significantly during the working memory task.The results suggested that postsynaptic activity was simulated well by the sparse activity model.The theta and gamma bands were meaningful for encoding working memory.

  19. Viabilitas dan Kemampuan Bakteri Kitinolitik Bacillus sp. BK17 dalam Formulasi Tablet untuk Mengurangi Layu Fusarium pada Benih Cabai Merah (Capsicum annuum L.)

    OpenAIRE

    Sitohang, Arance Yoane Itoi Imaulina

    2015-01-01

    Chitinolytic bacteria Bacillus sp. BK17 has been known to inhibit the growth of Fusarium oxysporum on chili seeds. Bacterial cell viability is an important factor in using the cell for biological control. This study was aimed to evaluate viability of chitinolytic bacteria Bacillus sp. BK17 and its potential in tablet formulation as a biological control againstF. oxysporum. Viability of Bacillus sp. BK17 cell was reduced in 40 days of storage. Bacillus sp. BK17 in tablet formulation was able t...

  20. CNTF-Treated Astrocyte Conditioned Medium Enhances Large-Conductance Calcium-Activated Potassium Channel Activity in Rat Cortical Neurons.

    Science.gov (United States)

    Sun, Meiqun; Liu, Hongli; Xu, Huanbai; Wang, Hongtao; Wang, Xiaojing

    2016-08-01

    Seizure activity is linked to astrocyte activation as well as dysfunctional cortical neuron excitability produced from changes in calcium-activated potassium (KCa) channel function. Ciliary neurotrophic factor-treated astrocyte conditioned medium (CNTF-ACM) can be used to investigate the peripheral effects of activated astrocytes upon cortical neurons. However, CNTF-ACM's effect upon KCa channel activity in cultured cortical neurons has not yet been investigated. Whole-cell patch clamp recordings were performed in rat cortical neurons to evaluate CNTF-ACM's effects upon charybdotoxin-sensitive large-conductance KCa (BK) channel currents and apamin-sensitive small-conductance KCa (SK) channel current. Biotinylation and RT-PCR were applied to assess CNTF-ACM's effects upon the protein and mRNA expression, respectively, of the SK channel subunits SK2 and SK3 and the BK channel subunits BKα1 and BKβ3. An anti-fibroblast growth factor-2 (FGF-2) monoclonal neutralizing antibody was used to assess the effects of the FGF-2 component of CNTF-ACM. CNTF-ACM significantly increased KCa channel current density, which was predominantly attributable to gains in BK channel activity (p  0.05). Blocking FGF-2 produced significant reductions in KCa channel current density (p > 0.05) as well as BKα1 and BKβ3 expression in CNTF-ACM-treated neurons (p > 0.05). CNTF-ACM significantly enhances BK channel activity in rat cortical neurons and that FGF-2 is partially responsible for these effects. CNTF-induced astrocyte activation results in secretion of neuroactive factors which may affect neuronal excitability and resultant seizure activity in mammalian cortical neurons. PMID:27097551

  1. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  2. Measurement of the local void fraction at high pressures in a heating channel; Mesure du taux de vide a haute pression dans un canal chauffant

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    Void fraction measurements were made in two phase flow boiling systems at high pressures in a uniformly heated, rectangular channel with a high aspect ratio. The local void fraction values were calculated from measurements of the absorption of a thin collimated X-ray beam (2 mm x 0.05 mm). The mean void fraction in a horizontal section results from integration of the local values across the section. At a fixed measuring station the quality and- void fraction were varied by changing the heat flux, flow rate and pressure systematically. Two channels were used differing in length and thickness (150.8 cm x 5.3 cm x 0.2 cm and the significant features of this study are: -1) The void fraction measurements are among the first obtained at such high pressure (80 to 140 kg/cm{sup 2}); -2) In the experimental region under consideration the measurements are systematic and numerous enough to allow accurate interpolations: mass velocity from 50 to 220 g/cm{sup 2}.s, heat flux from 40 to 170 W/cm{sup 2} and calculated steam quality from -0.2 to 0.2; -3) Many tests were performed under local boiling conditions with the mean temperature of the fluid below the saturation temperature; and -4) These results were compared to the predictions of certain models presented in the literature and simple empirical formulae were developed to fit the experimental results. (author) [French] Des mesures de taux de vide ont ete effectuees sur un ecoulement eau-vapeur a haute pression dans un canal vertical, de section rectangulaire tres allongee et chauffe a flux uniforme. Les valeurs du taux de vide local sont obtenues a partir des mesures de l'absorption d'un faisceau de rayons X finement collimate (2 mm x 0,05 mm). La valeur du taux de vide moyen dans une section droite s'en deduit par integration. Cette section droite ou sont realisees les mesures est fixe et, a pression, debit et flux donnes, les variations du titre et du taux de vide sont obtenues par variations de l

  3. The role of N-terminal and C-terminal Arg residues from BK on interaction with kinin B2 receptor.

    Science.gov (United States)

    Filippelli-Silva, Rafael; Martin, Renan P; Rodrigues, Eliete S; Nakaie, Clovis R; Oliveira, Laerte; Pesquero, João B; Shimuta, Suma I

    2016-04-01

    Bradykinin (BK) is a nonapeptide important for several physiological processes such as vasodilatation, increase in vascular permeability and release of inflammatory mediators. BK performs its actions by coupling to and activating the B2 receptor, a family A G-protein coupled receptor. Using a strategy which allows systematical monitoring of BK R1 and R9 residues and B2 receptor acidic residues Glu5.35(226) and Asp6.58(298), our study aims at clarifying the BK interaction profile with the B2 receptor [receptor residue numbers are normalized according to Ballesteros and Weinstein, Methods Neurosci. 25 (1995), pp. 366-428) followed by receptor sequence numbering in brackets]. N- and C-terminal analogs of BK (-A1, -G1, -K1, -E1 and BK-A9) were tested against wild type B2, Glu5.35(226)Ala and Asp6.58(298)Ala B2 mutant receptors for their affinity and capability to elicit responses by mechanical recordings of isolated mice stomach fundus, measuring intracellular calcium mobilization, and competitive fluorimetric binding assays. BK showed 2- and 15-fold decreased potency for Glu5.35(226) and Asp6.58(298) B2 mutant receptors, respectively. In B2-Glu5.35(226)Ala BK analogs showed milder reduction in evaluated parameters. On the other hand, in the B2-Asp6.58(298)Ala mutant, no N-terminal analog was able to elicit any response. However, the BK-A9 analog presented higher affinity parameters than BK in the latter mutant. These findings provide enough support for defining a novel interaction role of BK-R9 and Asp6.58(298) receptor residues. PMID:26584354

  4. Apelin-13 inhibits large-conductance Ca2+-activated K+ channels in cerebral artery smooth muscle cells via a PI3-kinase dependent mechanism.

    Directory of Open Access Journals (Sweden)

    Amit Modgil

    Full Text Available Apelin-13 causes vasoconstriction by acting directly on APJ receptors in vascular smooth muscle (VSM cells; however, the ionic mechanisms underlying this action at the cellular level remain unclear. Large-conductance Ca(2+-activated K(+ (BKCa channels in VSM cells are critical regulators of membrane potential and vascular tone. In the present study, we examined the effect of apelin-13 on BK(Ca channel activity in VSM cells, freshly isolated from rat middle cerebral arteries. In whole-cell patch clamp mode, apelin-13 (0.001-1 μM caused concentration-dependent inhibition of BK(Ca in VSM cells. Apelin-13 (0.1 µM significantly decreased BK(Ca current density from 71.25 ± 8.14 pA/pF to 44.52 ± 7.10 pA/pF (n=14 cells, P<0.05. This inhibitory effect of apelin-13 was confirmed by single channel recording in cell-attached patches, in which extracellular application of apelin-13 (0.1 µM decreased the open-state probability (NPo of BK(Ca channels in freshly isolated VSM cells. However, in inside-out patches, extracellular application of apelin-13 (0.1 µM did not alter the NPo of BK(Ca channels, suggesting that the inhibitory effect of apelin-13 on BKCa is not mediated by a direct action on BK(Ca. In whole cell patches, pretreatment of VSM cells with LY-294002, a PI3-kinase inhibitor, markedly attenuated the apelin-13-induced decrease in BK(Ca current density. In addition, treatment of arteries with apelin-13 (0.1 µM significantly increased the ratio of phosphorylated-Akt/total Akt, indicating that apelin-13 significantly increases PI3-kinase activity. Taken together, the data suggest that apelin-13 inhibits BK(Ca channel via a PI3-kinase-dependent signaling pathway in cerebral artery VSM cells, which may contribute to its regulatory action in the control of vascular tone.

  5. Erbium-doped ion-exchanged waveguide lasers in BK-7 glass

    OpenAIRE

    Feuchter, T.; Mwarania, E.K.; Wang, J.; Reekie, L.; J. S. Wilkinson

    1992-01-01

    Ion exchange in glass is a simple, flexible, technique to realize optical fiber compatible planar waveguide devices. Recently, neodymium-doped waveguide lasers operating at 1060 and 1300 nm have been demonstrated in this technology. Lasers operating at 1540 nm are desirable for telecommunication applications and we report here, for the first time, ion-exchanged waveguide lasers in erbium-doped glass emitting at this wavelength. Lasers in BK-7 glass doped with 0.5 wt% Er2O3 and pumped at 980 n...

  6. Low-loss waveguides fabricated in BK7 glass by high repetition rate femtosecond fiber laser

    International Nuclear Information System (INIS)

    For the first time femtosecond-laser writing has inscribed low-loss optical waveguides in Schott BK7 glass, a commercially important type of borosilicate widely used in optical applications. The use of a variable repetition rate laser enabled the identification of a narrow processing window at 1 MHz repetition rate with optimal waveguides exhibiting propagation losses of 0.3 dB/cm and efficient mode matching to standard optical fibers at a 1550 nm wavelength. The waveguides were characterized by complementary phase contrast and optical transmission microscopy, identifying a micrometer-sized guiding region within a larger complex structure of both positive and negative refractive index variations

  7. A single-center epidemiological study of BK virus infection and analysis of risk factors in patients with renal transplantation

    Directory of Open Access Journals (Sweden)

    Ji-gang LI

    2014-10-01

    Full Text Available Objective To investigate the epidemiological characteristics of BK virus (BKV infection in living renal transplantation patients, and analyze the risk factors of BKV infection and BKV nephropathy (BKVN. Methods The BKV DNA load in urine and blood samples of 43 renal transplant recipients, who had received renal transplantation in 309 Hospital from Feb. 2012 to Feb. 2013, was determined at preoperative period and 0.5, 1, 3, 6, 9, 12 and 15 months after transplantation. Meanwhile, the biopsy of grafted kidney was performed in those patients with continuously elevated serum creatinine and those with higher BKV DNA load. Patients were divided into 3 groups as follows according to the test results: BK viruria group, BK viremia group and pathologically diagnosed BKVN group. Data of each group were then recorded, including gender, age, postoperative diabetes (PTDM, acute rejection (AR, delayed recovery of graft function (DGF, postoperative pulmonary infection, preoperative immune induction therapy, postoperative immunosuppressive regimen, and other information. The risk factors for postoperative BKV infection and BKVN were analyzed. Results After an average of 15-month follow-up, it was found that the incidence of BKV viruria was 46.5%, that of BKV viremia was 14.0%, and that of BKVN was 2.3%. Sixth month after transplantation was found to be the peak time of viruria and viremia. FK506 was significantly associated with viremia in living donor renal transplantation. The immunosuppressive regimen was the immune related independent risk factor for BK viremia developing BKVN after living renal transplantation. Conclusion The incidence of BK viremia and BKVN is lower in living donor renal transplantation than in cadaver renal transplantation, but that of viruria is similar in both groups. Immunosuppressive scheme based on FK506 is an immune related independent risk factor leading to BK viremia proceeding to BKVN in living donor kidney

  8. Transition of radiative recombination channels from delocalized states to localized states in a GaInP alloy with partial atomic ordering: a direct optical signature of Mott transition?

    Science.gov (United States)

    Su, Z. C.; Ning, J. Q.; Deng, Z.; Wang, X. H.; Xu, S. J.; Wang, R. X.; Lu, S. L.; Dong, J. R.; Yang, H.

    2016-03-01

    Anderson localization is a predominant phenomenon in condensed matter and materials physics. In fact, localized and delocalized states often co-exist in one material. They are separated by a boundary called the mobility edge. Mott transition may take place between these two regimes. However, it is widely recognized that an apparent demonstration of Anderson localization or Mott transition is a challenging task. In this article, we present a direct optical observation of a transition of radiative recombination dominant channels from delocalized (i.e., local extended) states to Anderson localized states in the GaInP base layer of a GaInP/GaAs single junction solar cell by the means of the variable-temperature electroluminescence (EL) technique. It is found that by increasing temperature, we can boost a remarkable transition of radiative recombination dominant channels from the delocalized states to the localized states. The delocalized states are induced by the local atomic ordering domains (InP/GaP monolayer superlattices) while the localized states are caused by random distribution of indium (gallium) content. The efficient transfer and thermal redistribution of carriers between the two kinds of electronic states was revealed to result in both a distinct EL mechanism transition and an electrical resistance evolution with temperature. Our study gives rise to a self-consistent precise picture for carrier localization and transfer in a GaInP alloy, which is an extremely technologically important energy material for fabricating high-efficiency photovoltaic devices.

  9. Preliminary study on rotary ultrasonic machining of Bk-7 optical glass rod

    International Nuclear Information System (INIS)

    This paper presents an experimental observation on rotary ultrasonic machining (RUM) of BK7 optical glass rod. BK7 is a common technical optical glass for high quality optical components due to its high linear optical transmission in the visible range and is chemically stable. RUM is a hybrid machining process that combines the material removal mechanisms of diamond grinding and ultrasonic machining (USM) and it is non-thermal, non-chemical, creates no change in the microstructure, chemical or physical properties of the work piece. In the RUM, a controlled static load is applied to the rotating core drill with metal bonded diamond abrasive and is ultrasonically vibrated in the axial direction. A water-soluble coolant was used to cool the tool and sample during machining processes. By using DOE (Design of Experiment) approach, the effect of spindle speed and feed rate to the ultrasonic machinability had been developed. The main effects and two-factor interactions of process parameters (spindle speed) and feed rate) on output variables (MRR, surface roughness, opaqueness, chipping thickness and chipping size) are studied. (author)

  10. On the Operator ⨁Bk Related to Bessel Heat Equation

    Directory of Open Access Journals (Sweden)

    Wanchak Satsanit

    2010-01-01

    Full Text Available We study the equation (∂/∂tu(x,t=c2⊕Bku(x,t with the initial condition u(x,0=f(x for x∈Rn+. The operator ⊕Bk is the operator iterated k-times and is defined by ⊕Bk=((∑i=1pBxi4-(∑j=p+1p+qBxi4k, where p+q=n is the dimension of the Rn+, Bxi=∂2/∂xi2+(2vi/xi(∂/∂xi, 2vi=2αi+1, αi>-1/2, i=1,2,3,…,n, and k is a nonnegative integer, u(x,t is an unknown function for (x,t=(x1,x2,…,xn,t∈Rn+×(0,∞, f(x is a given generalized function, and c is a positive constant. We obtain the solution of such equation, which is related to the spectrum and the kernel, which is so called Bessel heat kernel. Moreover, such Bessel heat kernel has interesting properties and also related to the kernel of an extension of the heat equation.

  11. Adjuvant Ciprofloxacin for Persistent BK Polyomavirus Infection in Kidney Transplant Recipients

    Directory of Open Access Journals (Sweden)

    David Arroyo

    2014-01-01

    Full Text Available Background. BK virus (BKV infection is a common complication following kidney transplantation. Immunosuppression reduction is the cornerstone of treatment while adjuvant drugs have been tried in small uncontrolled studies. We sought to examine our center’s experience with the use of ciprofloxacin in patients with persistent BKV infection. Methods. Retrospective evaluation of the effect of a 30-day ciprofloxacin course (250 mg twice daily on BKV infection in kidney transplant recipients who had been diagnosed with BK viruria ≥106 copies/mL and viremia ≥500 copies/mL and in whom the infection did not resolve after immunosuppression reduction and/or treatment with other adjuvant agents. BKV in plasma and urine was evaluated after 3 months following treatment with ciprofloxacin. Results. Nine kidney transplant recipients received ciprofloxacin at a median of 130 days following the initial reduction in immunosuppression. Three patients showed complete viral clearance and another 3 had a ≥50% decrease in plasma viral load. No serious adverse events secondary to ciprofloxacin were reported and no grafts were lost due to BKV up to 1 year after treatment. Conclusion. Ciprofloxacin may be a useful therapy for persistent BKV infection despite conventional treatment. Randomized trials are required to evaluate the potential benefit of this adjuvant therapy.

  12. Risk Factors for the Development of BK Virus Nephropathy in Renal Transplant Recipients.

    Science.gov (United States)

    Pai, D; Mann, D M; Malik, A; Hoover, D R; Fyfe, B; Mann, R A

    2015-10-01

    The BK polyoma virus has, in recent years, become a significant cause of renal allograft dysfunction and failure. Among 260 adult kidney transplant recipients, those with biopsy-proven BK virus nephropathy (BKVN) were compared with those without BKVN with regard to gender, age, race, rejection episodes, time on dialysis, number of organs transplanted, HLA match, live donor versus deceased donor, cold ischemia time, delayed graft function, cytomegalovirus (CMV) serostatus of donor and recipient, induction therapy, and maintenance immunosuppression. Episodes of rejection (35.7% of patients with BKVN vs 8.5% of patients without BKVN; P = .01), transplantation of >1 organ (35.7% of patients with BKVN vs 9.0% of patients without BKVN; P = .01), positive CMV serology in both donor and recipient (71.4% of patients with BKVN vs 41.1% of patients without BKVN; P = .03), and a greater cumulative dose of daclizumab use at the time of induction (2.24 ± 0.05 mg/kg in patients with BKVN vs 2.03 ± 0.14 mg/kg in patients without BKVN; P = .04) were statistically significant risk factors for the development of BKVN. Those who developed BKVN received a higher mean cumulative dose of rabbit antithymoglobulin for induction therapy, but that difference failed to achieve statistical significance (P = .07). PMID:26518952

  13. Diffuse gastrointestinal bleeding and BK polyomavirus replication in a pediatric allogeneic haematopoietic stem cell transplant patient.

    Science.gov (United States)

    Koskenvuo, M; Lautenschlager, I; Kardas, P; Auvinen, E; Mannonen, L; Huttunen, P; Taskinen, M; Vettenranta, K; Hirsch, H H

    2015-01-01

    Patients undergoing haematopoietic stem cell transplantation (HSCT) are at high risk of severe gastrointestinal bleeding caused by infections, graft versus host disease, and disturbances in haemostasis. BK polyomavirus (BKPyV) is known to cause hemorrhagic cystitis, but there is also evidence of BKV shedding in stool and its association with gastrointestinal disease. We report putative association of BKPyV replication with high plasma viral loads in a pediatric HSCT patient developing hemorrhagic cystitis and severe gastrointestinal bleeding necessitating intensive care. The observation was based on chart review and analysis of BKPyV DNA loads in plasma and urine as well as retrospective BKPyV-specific IgM and IgG measurements in weekly samples until three months post-transplant. The gastrointestinal bleeding was observed after a >100-fold increase in the plasma BKPyV loads and the start of hemorrhagic cystitis. The BKPyV-specific antibody response indicated past infection prior to transplantation, but increasing IgG titers were seen following BKPyV replication. The gastrointestinal biopsies were taken at a late stage of the episode and were no longer informative of BK polyomavirus involvement. In conclusion, gastrointestinal complications with bleeding are a significant problem after allogeneic HSCT to which viral infections including BKPyV may contribute. PMID:25542476

  14. HIPPI and Fibre Channel

    International Nuclear Information System (INIS)

    The High-Performance Parallel Interface (HIPPI) and Fibre Channel are near-gigabit per second data communications interfaces being developed in ANSI standards Task Group X3T9.3. HIPPI is the current interface of choice in the high-end and supercomputer arena, and Fibre Channel is a follow-on effort. HIPPI came from a local area network background, and Fibre Channel came from a mainframe to peripheral interface background

  15. Possible antiviral effect of ciprofloxacin treatment on polyomavirus BK replication and analysis of non-coding control region sequences.

    Science.gov (United States)

    Umbro, Ilaria; Anzivino, Elena; Tinti, Francesca; Zavatto, Assunta; Bellizzi, Anna; Rodio, Donatella Maria; Mancini, Carlo; Pietropaolo, Valeria; Mitterhofer, Anna Paola

    2013-01-01

    Acute renal dysfunction (ARD) is a common complication in renal transplant recipients. Multiple factors contribute to ARD development, including acute rejection and microbial infections. Many viral infections after kidney transplantation result from reactivation of "latent" viruses in the host or from the graft, such as the human Polyomavirus BK (BKV). We report the case of a 39 year-old recipient of a 2nd kidney graft who experienced BKV reactivation after a second episode of acute humoral rejection. A 10-day treatment with the quinolone antibiotic ciprofloxacin was administered with an increase of immunosuppressive therapy despite the active BKV replication. Real Time PCR analysis performed after treatment with ciprofloxacin, unexpectedly showed clearance of BK viremia and regression of BK viruria. During the follow-up, BK viremia persisted undetectable while viruria decreased further and disappeared after 3 months.BKV non-coding control region sequence analysis from all positive samples always showed the presence of archetypal sequences, with two single-nucleotide substitutions and one nucleotide deletion that, interestingly, were all representative of the subtype/subgroup I/b-1 we identified by the viral protein 1 sequencing analysis.We report the potential effect of the quinolone antibiotic ciprofloxacin in the decrease of the BKV load in both blood and urine.

  16. Draft Genome Sequence of an Invasive Multidrug-Resistant Strain, Pseudomonas aeruginosa BK1, Isolated from a Keratitis Patient

    KAUST Repository

    Jeganathan, Lakshmi Priya

    2014-03-27

    Pseudomonas aeruginosa infections are difficult to treat due to the presence of a multitude of virulence factors and antibiotic resistance. Here, we report the draft genome sequence of P. aeruginosa BK1, an invasive and multidrug-resistant strain, isolated from a bacterial keratitis patient in southern India.

  17. Late post transplant HIV infection with BK viremia and allograft tuberculosis in a renal transplant recipient with Kaposi sarcoma

    OpenAIRE

    Viswanathan, V.; Kandasamy, V.; Reddy, Y. N.; Kurien, A.; Mathew, M.; Abraham, G

    2012-01-01

    In this report, we discuss a case of a 51-year-old African renal transplant who presented with metastatic Kaposi sarcoma 1 year after transplant. The Kaposi sarcoma was treated with a switch of immunosuppressants and chemotherapy. Six years after transplant, he presented with chronic allograft nephropathy, allograft tuberculosis, BK viremia, and was diagnosed to have contracted HIV infection.

  18. Electron microscopic features of a brain tumor induced in hamster by BK virus, a human papova virus.

    Directory of Open Access Journals (Sweden)

    Tsuboi,Masahiro

    1979-12-01

    Full Text Available In order to locate the target cells for malignant transformation by BK virus (a human papova virus in hamster brain, electron microscopic observation of tumor originally induced in hamster brain by BK virus was performed. With light microscopy, the BK virus-induced tumor (Vn 17 bore a close resemblance to human malignant ependymoma. Under the electron microscope, numerous microvilli and few cilia were visible on the surface of the tumor cells. These tumor cells were joined to each other by desmosomes. Gap junctions were not observed. Multilayered cuboidal cells were observed around the lumen and blood vessels in the tumor. With regard to fine structure, three types of Vn 17 cells were recognized; ependymal like cells, tanycytes with prominent cell processes, and undifferentiated cells with few cytoplasmic organelles. There was no basal lamina between the ependymal cells and the connective tissue stroma. The Vn 17 cells showed some similarity to the ultrastructural features of the epemdymal cells of newborn rabbits, suggesting that the target cells for Vn 17 may be cells related to ependyma. Malignant transformation of the cells would be initiated in the early stages after BK virus inoculation into the brain of newborn hamsters.

  19. Hydralazine-induced vasodilation involves opening of high conductance Ca2+-activated K+ channels

    DEFF Research Database (Denmark)

    Bang, Lone; Nielsen-Kudsk, J E; Gruhn, N;

    1998-01-01

    The purpose of this study was to investigate whether high conductance Ca2+-activated K+ channels (BK(Ca)) are mediating the vasodilator action of hydralazine. In isolated porcine coronary arteries, hydralazine (1-300 microM), like the K+ channel opener levcromakalim, preferentially relaxed......+-entry blocker), relaxed contractions induced by K+ (20 mM) and K+ (80 mM) equally and nimodipine-induced relaxations were neither antagonized by tetraethylammonium nor by iberiotoxin. In isolated perfused rat hearts, hydralazine (1 microM) increased coronary flow by 28.8 +/- 2.7%. Iberiotoxin (0.1 micro......M) suppressed this response by 82% (P opening of BK(Ca) takes part in the mechanism whereby...

  20. Progressive renal failure due to renal infiltration by BK polyomavirus and leukaemic cells: which is the culprit?

    Science.gov (United States)

    Sangala, Nicholas; Dewdney, Alex; Marley, Nicholas; Cranfield, Tanya; Venkat-Raman, Gopalakrishnan

    2011-02-01

    Renal infiltration with leukaemic cells is a common finding in patients suffering with chronic lymphocytic leukaemia (CLL) but rarely does it lead to significant renal dysfunction. Similarly, BK nephropathy is a recognized cause of graft failure in renal transplant recipients but rarely causes significant disease in native kidneys. In the few reports where leukaemic infiltration of the kidney has led to significant renal impairment, the pathological process causing renal dysfunction is not identified on biopsy. In these cases, it is unclear whether BK polyomavirus (BKV) nephropathy has been excluded. We describe a case of dual pathologies in a patient with Binet stage C CLL and deteriorating renal function where renal biopsy reveals leukaemic infiltration of the kidney occurring alongside BKV nephropathy. The relative importance of each pathology in relation to the rapid decline to end-stage renal failure remains unclear, but the presence of both pathologies appears to impart a poor prognosis. Additionally, we describe the novel histological finding of loss of tubular integrity resulting in tubular infiltration and occlusion by leukaemic cells. It is possible that the patient with advanced CLL is at particular risk of BK activation, and the presence of BK nephropathy may compromise tubular integrity allowing leukaemic cell infiltration and obstruction of tubules. This case bares remarkable resemblance to the first and only other report of its kind in the literature. It is not clear how available immunocytochemistry for polyoma infection is outside transplant centres, and it is possible that BK nephropathy is being under-diagnosed in patients with CLL in the context of declining renal function. At present, the combination of BKV nephropathy and leukaemic infiltration represents a management conundrum and the prognosis is poor. Further research is required in order to better understand the pathological process and therefore develop management strategies.

  1. Improving the specific activity of β-mannanase from Aspergillus niger BK01 by structure-based rational design.

    Science.gov (United States)

    Huang, Jian-Wen; Chen, Chun-Chi; Huang, Chun-Hsiang; Huang, Ting-Yung; Wu, Tzu-Hui; Cheng, Ya-Shan; Ko, Tzu-Ping; Lin, Cheng-Yen; Liu, Je-Ruei; Guo, Rey-Ting

    2014-03-01

    β-Mannanase has found various biotechnological applications because it is capable of degrading mannans into smaller sugar components. A highly potent example is the thermophilic β-mannanase from Aspergillus niger BK01 (ManBK), which can be efficiently expressed in industrial yeast strains and is thus an attractive candidate for commercial utilizations. In order to understand the molecular mechanism, which helps in strategies to improve the enzyme's performance that would meet industrial demands, 3D-structural information is a great asset. Here, we present the 1.57Å crystal structure of ManBK. The protein adopts a typical (β/α)8 fold that resembles the other GH5 family members. Polysaccharides were subsequently modeled into the substrate binding groove to identify the residues and structural features that may be involved in the catalytic reaction. Based on the structure, rational design was conducted to engineer ManBK in an attempt to enhance its enzymatic activity. Among the 23 mutants that we constructed, the most promising Y216W showed an 18±2.7% increase in specific activity by comparison with the wild type enzyme. The optimal temperature and heat tolerance profiles of Y216W were similar to those of the wild type, manifesting a preserved thermostability. Kinetic studies showed that Y216W has higher kcat values than the wild type enzyme, suggesting a faster turnover rate of catalysis. In this study we applied rational design to ManBK by using its crystal structure as a basis and identified the Y216W mutant that shows great potentials in industrial applications.

  2. Hemorrhagic Cystitis due to BK Reactivation in a Young Female Treated for Hodgkin-Disease

    Directory of Open Access Journals (Sweden)

    R. Le Calloch

    2011-01-01

    Full Text Available Hodgkin's lymphoma is a disease with a high rate of curability under classic chemo-radiotherapy regimes. Complications due to chemotherapy could include viral reactivation due to chronic lymphopenia. BK virus (BKV is a polyoma virus belonging to the Papovaviridae family with antibody seroprevalences in healthy populations varying from 60% to 80%. Initial infections are asymptomatic usually occur in early childhood, after which the viruses remain latent in the kidneys or urothelium. Reactivation of BKV occurs in individuals with severe immunosuppression during HIV infections, transplantation or, exceptionally, after classical chemotherapy. BKV incidence is approximately 0% to 5% in immunocompetent individuals. Reactivation is associated with nephropathy and haemorrhagic cystitis. Herein, we present a case of a haemorrhagic cystitis due to BKV reactivation in a patient with Hodgkin's disease treated with chemotherapy.

  3. Successful hyperbaric oxygen therapy for refractory BK virus-associated hemorrhagic cystitis after cord blood transplantation.

    Science.gov (United States)

    Hosokawa, K; Yamazaki, H; Nakamura, T; Yoroidaka, T; Imi, T; Shima, Y; Ohata, K; Takamatsu, H; Kotani, T; Kondo, Y; Takami, A; Nakao, S

    2014-10-01

    BK virus-associated hemorrhagic cystitis (BKV-HC) is a common and major cause of morbidity in recipients of allogeneic hematopoietic stem cell transplantation. A 32-year-old woman developed severe BKV-HC on day 24 after cord blood transplantation (CBT). Despite supportive therapies - such as hyperhydration, forced diuresis, and urinary catheterization - macroscopic hematuria and bladder irritation persisted for over a month. Hyperbaric oxygen (HBO) therapy at 2.1 atmospheres for 90 min per day was started on day 64 after CBT. Macroscopic hematuria resolved within a week, and microscopic hematuria was no longer detectable within 2 weeks. Hematuria did not recur after 11 sessions of HBO therapy, and no significant side effects were observed during or after treatment. HBO therapy could thus be useful in controlling refractory BKV-HC after CBT. PMID:25040402

  4. Measurement of B-->K{*}(892)gamma branching fractions and CP and Isospin asymmetries.

    Science.gov (United States)

    Aubert, B; Karyotakis, Y; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Grauges, E; Martinelli, M; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Battaglia, M; Brown, D N; Kerth, L T; Kolomensky, Yu G; Lynch, G; Osipenkov, I L; Tackmann, K; Tanabe, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schroeder, T; Asgeirsson, D J; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Randle-Conde, A; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Atmacan, H; Gary, J W; Liu, F; Long, O; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Martinez, A J; Schalk, T; Schumm, B A; Seiden, A; Wang, L; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Bloom, P C; Ford, W T; Gaz, A; Hirschauer, J F; Nagel, M; Nauenberg, U; Smith, J G; Wagner, S R; Ayad, R; Toki, W H; Wilson, R J; Feltresi, E; Hauke, A; Jasper, H; Karbach, T M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Nogowski, R; Schubert, K R; Schwierz, R; Volk, A; Bernard, D; Latour, E; Verderi, M; Clark, P J; Playfer, S; Watson, J E; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Fioravanti, E; Franchini, P; Luppi, E; Munerato, M; Negrini, M; Petrella, A; Piemontese, L; Santoro, V; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Contri, R; Guido, E; Lo Vetere, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Tosi, S; Chaisanguanthum, K S; Morii, M; Adametz, A; Marks, J; Schenk, S; Uwer, U; Bernlochner, F U; Klose, V; Lacker, H M; Bard, D J; Dauncey, P D; Tibbetts, M; Behera, P K; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Arnaud, N; Béquilleux, J; D'Orazio, A; Davier, M; Derkach, D; Firmino da Costa, J; Grosdidier, G; Le Diberder, F; Lepeltier, V; Lutz, A M; Malaescu, B; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; Clarke, C K; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Paramesvaran, S; Wren, A C; Brown, D N; Davis, C L; Denig, A G; Fritsch, M; Gradl, W; Hafner, A; Alwyn, K E; Bailey, D; Barlow, R J; Jackson, G; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Henderson, S W; Sciolla, G; Spitznagel, M; Yamamoto, R K; Zhao, M; Patel, P M; Robertson, S H; Schram, M; Lazzaro, A; Lombardo, V; Palombo, F; Stracka, S; Bauer, J M; Cremaldi, L; Godang, R; Kroeger, R; Sonnek, P; Summers, D J; Zhao, H W; Simard, M; Taras, P; Nicholson, H; De Nardo, G; Lista, L; Monorchio, D; Onorato, G; Sciacca, C; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; Losecco, J M; Wang, W F; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelli, G; Gagliardi, N; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Del Amo Sanchez, P; Ben-Haim, E; Bonneaud, G R; Briand, H; Chauveau, J; Hamon, O; Leruste, Ph; Marchiori, G; Ocariz, J; Perez, A; Prendki, J; Sitt, S; Gladney, L; Biasini, M; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Lopes Pegna, D; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Anulli, F; Baracchini, E; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Esteve, L; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yèche, Ch; Zito, M; Allen, M T; Aston, D; Bartoldus, R; Benitez, J F; Cenci, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Franco Sevilla, M; Gabareen, A M; Graham, M T; Grenier, P; Hast, C; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L

    2009-11-20

    We present an analysis of the decays B{0}-->K{*0}(892)gamma and B{+}-->K{*+}(892)gamma using a sample of about 383 x 10{6} BB[-over ] events collected with the BABAR detector at the PEP-II asymmetric energy B factory. We measure the branching fractions B(B{0}-->K{*0}gamma)=(4.47+/-0.10+/-0.16) x 10{-5} and B(B{+}-->K{*+}gamma)=(4.22+/-0.14+/-0.16) x 10{-5}. We constrain the direct CP asymmetry to be -0.033K{*}gamma)<0.028 and the isospin asymmetry to be 0.017

  5. Mathematical modeling of surface roughness in magnetic abrasive finishing of BK7 optical glass.

    Science.gov (United States)

    Pashmforoush, Farzad; Rahimi, Abdolreza; Kazemi, Mehdi

    2015-10-01

    Magnetic abrasive finishing (MAF) is one of the advanced machining processes efficiently used to finish hard-to-machine materials. Simulation and modeling of the process is of particular importance to understand the mechanics of material removal and consequently achieve a high-quality surface with a minimum of surface defects. Hence, in this paper, we performed a numerical-experimental study to mathematically model the surface roughness during the MAF of BK7 optical glass. For this purpose, the initial roughness profile was estimated using fast Fourier transform (FFT) and a Gaussian filter. We obtained the final surface profile based on the material removal mechanisms and the corresponding chipping depth values evaluated by finite element analysis. We then validated experimentally the simulation results in terms of the arithmetic average surface roughness (R(a ). The comparison between the obtained results demonstrates that the theoretical and experimental findings are in good agreement when predicting the parameters' effect on surface roughness behavior. PMID:26479596

  6. Simultaneous BK Polyomavirus (BKPyV)-associated nephropathy and hemorrhagic cystitis after living donor kidney transplantation.

    Science.gov (United States)

    Helanterä, Ilkka; Hirsch, Hans H; Wernli, Marion; Ortiz, Fernanda; Lempinen, Marko; Räisänen-Sokolowski, Anne; Auvinen, Eeva; Mannonen, Laura; Lautenschlager, Irmeli

    2016-03-01

    BK polyomavirus (BKPyV) commonly reactivates after kidney transplantation, and can cause polyomavirus-associated nephropathy (PyVAN), whereas after allogeneic stem cell transplantation the most frequent manifestation of BKPyV is polyomavirus-associated hemorrhagic cystitis (PyVHC). Despite high-level BKPyV replication in both, the pathogenesis and manifestation of both BKPyV entities appears to differ substantially. We describe an unusual case of simultaneous PyVAN and PyVHC presenting with acute symptoms in a BKPyV-IgG positive recipient eight months after kidney transplantation from a haploidentical living donor, who was BKPyV-IgG negative. Symptoms of cystitis and viremia subsided rapidly after reduction of immunosuppression. PMID:26771744

  7. Different behaviour of BK-virus infection in liver transplant recipients.

    Science.gov (United States)

    Umbro, Ilaria; Tinti, Francesca; Muiesan, Paolo; Mitterhofer, Anna Paola

    2016-01-28

    Polyomavirus BK (BKV) infects up to 90% of the general population. After primary infection, occurring early during childhood, a state of non-replicative infection is established in the reno-urinary tract, without complications for immunocompetent hosts. In immunocompromised individuals, particularly transplanted patients, asymptomatic BKV viremia and/or viruria can be observed. Renal grafts may also be sources of infection as BKV prefers kidneys rather than other solid organs for transplantation such as the liver. The mechanism behind the higher incidence of BKV infection in kidney transplant patients, compared to liver or heart transplantation, is unclear and the prevalence of BKV infection in non-renal solid organ transplants has not been yet thoroughly investigated. We evaluated the prevalence of Polyomavirus BK infection among liver transplant recipients. A PubMed search was conducted using the terms BKV infection AND liver transplant recipients; BKV AND non-renal solid organ transplant*; BKV infection AND immunosuppression; the search was limited to title/abstract and English-language articles published from 2000, to March 2015. Eleven relevant studies suggest that the prevalence of BKV viruria and/or viremia among liver transplant recipients is less than that reported in kidney or heart transplant recipients, except when chronic kidney disease (CKD) is present at the same time. Data also suggest that viruric and viremic patients have higher levels of serum creatinine than BKV negative patients. Moreover, no specific immunosuppressive drugs are associated with the onset of BKV nephropathy. The comorbidity of transplantation and CKD could play a major role in promoting BKV replication.

  8. Mutation in the myelin proteolipid protein gene alters BK and SK channel function in the caudal medulla

    OpenAIRE

    Mayer, Catherine A.; Macklin, Wendy B.; Avishai, Nanthawan; Balan, Kannan; Wilson, Christopher G.; Miller, Martha J.

    2009-01-01

    Proteolipid protein (Plp) gene mutation in rodents causes severe CNS dysmyelination, early death, and lethal hypoxic ventilatory depression (Miller et al. 2004). To determine if Plp mutation alters neuronal function critical for control of breathing, the nucleus tractus solitarii (nTS) of four rodent strains were studied: myelin deficient rats (MD), myelin synthesis deficient (Plpmsd), and Plpnull mice, as well as shiverer (Mbpshi) mice, a myelin basic protein mutant. Current-voltage relation...

  9. Spatial localization of knowledge-transfer channels and face-to-face contacts: A survey of the Jena university-industry linkages

    OpenAIRE

    Sauer, Thomas; Stoetzer, Matthias-Wolfgang; Gerlach, Andrea

    2007-01-01

    In this paper we examine the knowledge-Transfer Channels of the universities and public research institutes in Jena. The empirical study is based on a survey of 297 personal interviews with researchers of both types of organisations. Our study focuses on three questions: (a) The importance and multitude of existing transfer channels, (b) their geographic distribution and (c) the importance of face-to-face contacts. With regard to the first question the analysis reveals some shortcomings of th...

  10. APE1/Ref-1 promotes the effect of angiotensin II on Ca2+ -activated K+ channel in human endothelial cells via suppression of NADPH oxidase.

    Science.gov (United States)

    Park, Won Sun; Ko, Eun A; Jung, In Duk; Son, Youn Kyoung; Kim, Hyoung Kyu; Kim, Nari; Park, So Youn; Hong, Ki Whan; Park, Yeong-Min; Choi, Tae-Hoon; Han, Jin

    2008-10-01

    The effects of angiotensin II (Ang II) on whole-cell large conductance Ca(2+)-activated K(+) (BK(Ca)) currents was investigated in control and Apurinic/apyrimidinic endonuclease1/redox factor 1 (APE1/Ref-1)-overexpressing human umbilical vein endothelial cells (HUVECs). Ang II blocked the BK(Ca) current in a dose-dependent fashion, and this inhibition was greater in APE1/Ref-1-overexpressing HUVECs than in control HUVECs (half-inhibition values of 102.81+/-9.54 nM and 11.34+/-0.39 nM in control and APE1/Ref-1-overexpressing HUVECs, respectively). Pretreatment with the NADPH oxidase inhibitor diphenyleneiodonium (DPI) or knock down of NADPH oxidase (p22 phox) using siRNA increased the inhibitory effect of Ang II on the BK(Ca) currents, similar to the effect of APE1/Ref-1 overexpression. In addition, application of Ang II increased the superoxide and hydrogen peroxide levels in the control HUVECs but not in APE1/Ref-1-overexpressing HUVECs. Furthermore, direct application of hydrogen peroxide increased BK(Ca) channel activity. Finally, the inhibitory effect of Ang II on the BK(Ca) current was blocked by an antagonist of the Ang II type 1 (AT(1)) receptor in both control and APE1/Ref-1-overexpressing HUVECs. From these results, we conclude that the inhibitory effect of Ang II on BK(Ca) channel function is NADPH oxidase-dependent and may be promoted by APE1/Ref-1.

  11. Troponin T3 regulates nuclear localization of the calcium channel Ca{sub v}β{sub 1a} subunit in skeletal muscle

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Tan; Taylor, Jackson; Jiang, Yang [Department of Internal Medicine-Gerontology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Pereyra, Andrea S. [Department of Histology, National University of La Plata, 1900 La Plata (Argentina); Messi, Maria Laura; Wang, Zhong-Min [Department of Internal Medicine-Gerontology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Hereñú, Claudia [Department of Histology, National University of La Plata, 1900 La Plata (Argentina); Delbono, Osvaldo, E-mail: odelbono@wakehealth.edu [Department of Internal Medicine-Gerontology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Neuroscience Program, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States)

    2015-08-15

    The voltage-gated calcium channel (Ca{sub v}) β{sub 1a} subunit (Ca{sub v}β{sub 1a}) plays an important role in excitation–contraction coupling (ECC), a process in the myoplasm that leads to muscle-force generation. Recently, we discovered that the Ca{sub v}β{sub 1a} subunit travels to the nucleus of skeletal muscle cells where it helps to regulate gene transcription. To determine how it travels to the nucleus, we performed a yeast two-hybrid screening of the mouse fast skeletal muscle cDNA library and identified an interaction with troponin T3 (TnT3), which we subsequently confirmed by co-immunoprecipitation and co-localization assays in mouse skeletal muscle in vivo and in cultured C2C12 muscle cells. Interacting domains were mapped to the leucine zipper domain in TnT3 COOH-terminus (160–244 aa) and Ca{sub v}β{sub 1a} NH{sub 2}-terminus (1–99 aa), respectively. The double fluorescence assay in C2C12 cells co-expressing TnT3/DsRed and Ca{sub v}β{sub 1a}/YFP shows that TnT3 facilitates Ca{sub v}β{sub 1a} nuclear recruitment, suggesting that the two proteins play a heretofore unknown role during early muscle differentiation in addition to their classical role in ECC regulation. - Highlights: • Previously, we demonstrated that Ca{sub v}β{sub 1a} is a gene transcription regulator. • Here, we show that TnT3 interacts with Ca{sub v}β{sub 1a}. • We mapped TnT3 and Ca{sub v}β{sub 1a} interaction domain. • TnT3 facilitates Ca{sub v}β{sub 1a} nuclear enrichment. • The two proteins play a heretofore unknown role during early muscle differentiation.

  12. Functional Apical Large Conductance, Ca2+-activated, and Voltage-dependent K+ Channels Are Required for Maintenance of Airway Surface Liquid Volume*

    OpenAIRE

    Manzanares, Dahis; Gonzalez, Carlos; Ivonnet, Pedro; Chen, Ren-Shiang; Valencia-Gattas, Monica; Gregory E. Conner; Larsson, H. Peter; Salathe, Matthias

    2011-01-01

    Large conductance, Ca2+-activated, and voltage-dependent K+ (BK) channels control a variety of physiological processes in nervous, muscular, and renal epithelial tissues. In bronchial airway epithelia, extracellular ATP-mediated, apical increases in intracellular Ca2+ are important signals for ion movement through the apical membrane and regulation of water secretion. Although other, mainly basolaterally expressed K+ channels are recognized as modulators of ion transport in airway epithelial ...

  13. RFI channels

    Science.gov (United States)

    Mceliece, R. J.

    1980-01-01

    A class of channel models is presented which exhibit varying burst error severity much like channels encountered in practice. An information-theoretic analysis of these channel models is made, and conclusions are drawn that may aid in the design of coded communication systems for realistic noisy channels.

  14. Probing new physics through B->K l+ l- decays in R-parity violating minimal supersymmetric standard model

    CERN Document Server

    Mir, Azeem

    2009-01-01

    We study the decay rate of process B->K l+ l- (l=e,mu) and some of its other related observables, like forward backward asymmetry (A_{FB}), polarization asymmetry (PA) and CP-asymmetry (A_{CP}) in R-parity violating (R_{p}) Minimal Supersymmetric Standard Model (MSSM). The analysis shows that R_{p}Yukawa coupling products contribute significantly to the branching fraction of B->K l+ l- within 1 sigma and 2 sigma. Study shows that PA and A_{FB} are sensitive enough to R_{p}Yukawa coupling products and turn out to be good predictions for measurement in future experiments.The CP-asymmetry calculated in this framework agrees well with the recently reported value(i.e. 7%).

  15. No Evidence for Infection of UK Prostate Cancer Patients with XMRV, BK Virus, Trichomonas vaginalis or Human Papilloma Viruses

    OpenAIRE

    Groom, Harriet C. T.; Warren, Anne Y; David E Neal; Kate N Bishop

    2012-01-01

    The prevalence of specific infections in UK prostate cancer patients was investigated. Serum from 84 patients and 62 controls was tested for neutralisation of xenotropic murine leukaemia virus-related virus (XMRV) Envelope. No reactivity was found in the patient samples. In addition, a further 100 prostate DNA samples were tested for XMRV, BK virus, Trichomonas vaginalis and human papilloma viruses by nucleic acid detection techniques. Despite demonstrating DNA integrity and assay sensitivity...

  16. The bradykinin BK2 receptor mediates angiotensin II receptor type 2 stimulated rat duodenal mucosal alkaline secretion

    Directory of Open Access Journals (Sweden)

    Helander Herbert F

    2003-02-01

    Full Text Available Abstract Background This study investigates bradykinin and nitric oxide as potential mediators of AT2-receptor-stimulated duodenal mucosal alkaline secretion. Duodenal mucosal alkaline secretion was measured in methohexital- and α-chloralose-anaesthetised rats by means of in situ pH-stat titration. Immunohistochemistry and Western blot were used to identify the BK2 receptors. Results The AT2 receptor agonist CGP42112A (0.1 μg kg-1 min-1 administered intravenously increased the duodenal mucosal alkaline secretion by ~50 %. This increase was sensitive to the selective BK2 receptor blocker HOE140 (100 ng/kg iv, but not to luminal administration of the NOS blocker L-NAME (0.3 mM. Mean arterial pressure did not differ between groups during the procedures. Immunohistochemistry showed a distinct staining of the crypt epithelium and a moderate staining of basal cytoplasm in villus enterocytes. Conclusion The results suggest that the AT2-receptor-stimulated alkaline secretion is mediated via BK2 receptors located in the duodenal cryptal mucosal epithelium.

  17. Channelling versus inversion

    DEFF Research Database (Denmark)

    Gale, A.S.; Surlyk, Finn; Anderskouv, Kresten

    2013-01-01

    . Within this channel were smaller erosional structures (<10 m deep) that truncate originally horizontal bedding, are floored by hardgrounds, and locally have a basal fill of granular phosphorite. The entire channel system was progressively infilled by chalk, as demonstrated by the expanded succession of...... the lower Campanian Culver Chalk Formation. The beds of the channel fill are cut by small step faults, resulting from gravitational collapse. Complete burial had taken place by the base of the upper Campanian Portsdown Chalk Formation, which is of even thickness across the region. The structures are......Evidence from regional stratigraphical patterns in Santonian−Campanian chalk is used to infer the presence of a very broad channel system (5 km across) with a depth of at least 50 m, running NNW−SSE across the eastern Isle of Wight; only the western part of the channel wall and fill is exposed...

  18. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    Science.gov (United States)

    Radchenko, V. M.; Ryabinin, M. A.; Stupin, V. A.

    2010-03-01

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  19. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    International Nuclear Information System (INIS)

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  20. Determining the Solar Inactivation Rate of BK Polyomavirus by Molecular Beacon.

    Science.gov (United States)

    Reano, Dane C; Yates, Marylynn V

    2016-07-01

    The application of molecular beacons (MB) that bind to precise sequences of mRNA provides a near-universal approach in detecting evidence of viral replication. Here, we demonstrate the detection of BK Polyomavirus (BKPyV), an emerging indicator of microbiological water quality, by a quantum dot-based MB. The MB allowed us to rapidly characterize the inactivation rate of BKPyV following exposure to a solar simulator (kobs = 0.578 ± 0.024 h(-1), R(2) = 0.92). Results were validated through a traditional cell-culture assay with immunofluorescence detection (kobs = 0.568 ± 0.011 h(-1), R(2) = 0.97), which exhibited a strong correlation to MB data (R(2) = 0.93). Obtaining solar inactivation rates for BKPyV demonstrates the first use of a MB in characterizing a microbiological inactivation profile and helps assess the appropriateness of adopting BKPyV as an indicator organism for water quality. PMID:27269231

  1. Optimization, purification, and characterization of L-asparaginase from Actinomycetales bacterium BkSoiiA.

    Science.gov (United States)

    Dash, Chitrangada; Mohapatra, Sukanti Bala; Maiti, Prasanta Kumar

    2016-01-01

    Actinobacteria are promising source of a wide range of important enzymes, some of which are produced in industrial scale, with others yet to be harnessed. L-Asparaginase is used as an antineoplastic agent. The present work deals with the production and optimization of L-asparaginase from Actinomycetales bacterium BkSoiiA using submerged fermentation in M9 medium. Production optimization resulted in a modified M9 medium with yeast extract and fructose as carbon and nitrogen sources, respectively, at pH 8.0, incubated for 120 hr at 30 ± 2 °C. The crude enzyme was purified to near homogeneity by ammonium sulfate precipitation following dialysis, ion-exchange column chromatography, and finally gel filtration. The sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis (PAGE) revealed an apparent molecular weight of 57 kD. The enzyme was purified 95.06-fold and showed a final specific activity of 204.37 U/mg with 3.49% yield. The purified enzyme showed maximum activity at a pH 10.0 and was stable at pH 7.0 to 9.0. The enzyme was activated by Mn(2+) and strongly inhibited by Ba(2+). All these preliminary characterization suggests that the L-asparaginase from the source may be a tool useful to pharmaceutical industries after further research.

  2. Characterization of Immunodominant BK Polyomavirus 9mer Epitope T Cell Responses

    Science.gov (United States)

    Cioni, M.; Leboeuf, C.; Comoli, P.; Ginevri, F.

    2016-01-01

    Uncontrolled BK polyomavirus (BKPyV) replication in kidney transplant recipients (KTRs) causes polyomavirus‐associated nephropathy and allograft loss. Reducing immunosuppression is associated with clearing viremia and nephropathy and increasing BKPyV‐specific T cell responses in most patients; however, current immunoassays have limited sensitivity, target mostly CD4+ T cells, and largely fail to predict onset and clearance of BKPyV replication. To characterize BKPyV‐specific CD8+ T cells, bioinformatics were used to predict 9mer epitopes in the early viral gene region (EVGR) presented by 14 common HLAs in Europe and North America. Thirty‐nine EVGR epitopes were experimentally confirmed by interferon‐γ enzyme‐linked immunospot assays in at least 30% of BKPyV IgG–seropositive healthy participants. Most 9mers clustered in domains, and some were presented by more than one HLA class I, as typically seen for immunodominant epitopes. Specific T cell binding using MHC class I streptamers was demonstrated for 21 of 39 (54%) epitopes. In a prospective cohort of 118 pediatric KTRs, 19 patients protected or recovering from BKPyV viremia were experimentally tested, and 13 epitopes were validated. Single HLA mismatches were not associated with viremia, suggesting that failing immune control likely involves multiple factors including maintenance immunosuppression. Combining BKPyV load and T cell assays using immunodominant epitopes may help in evaluating risk and reducing immunosuppression and may lead to safe adoptive T cell transfer. PMID:26663765

  3. Ultra-precision ductile grinding of BK7 using super abrasive diamond wheel

    Institute of Scientific and Technical Information of China (English)

    ZHAO Qingliang; Brinksmeier Ekkard; Riemer Oltmann; Rickens Kai

    2007-01-01

    In this paper,a novel conditioning technique using copper bonded diamond grinding wheels of 91 μm grain size and electrolytic in-process dressing (ELID) is first developed to precisely and effectively condition a nickelelectroplated monolayer coarse-grained diamond grinding wheel of 151 μm grain size.Under optimised conditioning parameters,the super abrasive diamond wheel was well conditioned in terms of a minimized run-out error and flattened diamond grain surfaces of constant peripheral envelope.The conditioning force was monitored by a force transducer,while the modified wheel surface status was in-situ monitored by a coaxial optical distance measurement system.Finally,the grinding experiment on BK7 was conducted using the well-conditioned wheel with the corresponding surface morphology and subsurface damage measured by atomic force microscope (AFM) and scanning electric microscope (SEM),respectively.The experimental result shows that the newly developed conditioning technique is applicable and feasible to ductile grinding optical glass featuring nano scale surface roughness,indicating the potential of super abrasive diamond wheels in ductile machining brittle materials.

  4. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    Science.gov (United States)

    Abdel-Aziz, M. M.; Azim, Osama A.; Abdel-Wahab, L. A.; Seddik, Mohamed M.

    2006-10-01

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti 2O 3), Hafnium dioxide (HfO 2), and Lima (mixture of oxides SiO 2/Al 2O 3); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A.

  5. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    International Nuclear Information System (INIS)

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti2O3), Hafnium dioxide (HfO2), and Lima (mixture of oxides SiO2/Al2O3); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A

  6. Human BK Polyomavirus—The Potential for Head and Neck Malignancy and Disease

    Directory of Open Access Journals (Sweden)

    Raquel Burger-Calderon

    2015-07-01

    Full Text Available Members of the human Polyomaviridae family are ubiquitous and pathogenic among immune-compromised individuals. While only Merkel cell polyomavirus (MCPyV has conclusively been linked to human cancer, all members of the polyomavirus (PyV family encode the oncoprotein T antigen and may be potentially carcinogenic. Studies focusing on PyV pathogenesis in humans have become more abundant as the number of PyV family members and the list of associated diseases has expanded. BK polyomavirus (BKPyV in particular has emerged as a new opportunistic pathogen among HIV positive individuals, carrying harmful implications. Increasing evidence links BKPyV to HIV-associated salivary gland disease (HIVSGD. HIVSGD is associated with elevated risk of lymphoma formation and its prevalence has increased among HIV/AIDS patients. Determining the relationship between BKPyV, disease and tumorigenesis among immunosuppressed individuals is necessary and will allow for expanding effective anti-viral treatment and prevention options in the future.

  7. P-waves imaging of the FRI and BK zones at the Grimsel Rock Laboratory

    International Nuclear Information System (INIS)

    This report is one of a series documenting the results of the Nagra-DOE Cooperative (NDC-I) research program in which the cooperating scientists explore the geological, geophysical, hydrological, geochemical, and structural effects anticipated from the use of a rock mass as a geological repository for nuclear waste. Tomographic imaging studies using a high frequency (10 Khz.) piezoelectric source and a three component receiver were carried out in two different regions of the underground Nagra Grimsel test facility in Switzerland. Both sites were in fractured granite, one being in a strongly foliated granite (FRI site), and the other being in a relatively homogeneous granite (BK zone). The object of the work was to determine if the seismic techniques could be useful in imaging the fracture zones and provide information on the hydrologic conditions. Both amplitude and velocity tomograms were obtained from the Data. The results indicate that the fracture zones strongly influenced the seismic wave propagation, thus imaging the fracture zones that were hydrologically important. 11 refs., 24 figs

  8. Continuum Limit of $B_K$ from 2+1 Flavor Domain Wall QCD

    CERN Document Server

    Aoki, Y; Blum, T; Boyle, P A; Brömmel, D; Christ, N H; Dawson, C; Izubuchi, T; Jung, C; Kelly, C; Kenway, R D; Lightman, M; Mawhinney, R D; Ohta, Shigemi; Sachrajda, C T; Scholz, E E; Soni, A; Sturm, C; Wennekers, J; Zhou, R

    2010-01-01

    We determine the neutral kaon mixing matrix element $B_K$ in the continuum limit with 2+1 flavors of domain wall fermions, using the Iwasaki gauge action at two different lattice spacings. These lattice fermions have near exact chiral symmetry and therefore avoid artificial lattice operator mixing. We introduce a significant improvement to the conventional NPR method in which the bare matrix elements are renormalized non-perturbatively in the RI-MOM scheme and are then converted into the MSbar scheme using continuum perturbation theory. In addition to RI-MOM, we introduce and implement four non-exceptional intermediate momentum schemes that suppress infrared non-perturbative uncertainties in the renormalization procedure. We compute the conversion factors relating the matrix elements in this family of RI-SMOM schemes and MSbar at one-loop order. Comparison of the results obtained using these different intermediate schemes allows for a more reliable estimate of the unknown higher-order contributions and hence ...

  9. UV protection filters by dielectric multilayer thin films on Glass BK-7 and Infrasil 301

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Aziz, M.M. [Physics Department, Faculty of Education, Ain Shams University, Cairo 11566 (Egypt)]. E-mail: melaziz@link.net; Azim, Osama A. [Vacuum Coating Manager, Arab International Optronics Co., El-salam City, Cairo 11566 (Egypt); Abdel-Wahab, L.A. [Head of Thermal Analysis Lab, National Center for Radiation Research and Technology, Cairo 11566 (Egypt); Seddik, Mohamed M. [Engineering Physics Department, Faculty of Engineering, Ain Shams University, Cairo 11566 (Egypt)

    2006-10-15

    The increasing use of Ultraviolet (UV) light in medicine, industrial environments, for cosmetic use, and even in consumer products necessitates that greater attention be paid to the potential hazards of this type of electromagnetic radiation. To avoid any adverse effects of exposure to this type of radiation, four suitable protection filters were produced to block three UV bands (UVA, UVB, and UVC). The design structure of the required dielectric multilayer filters was done by optical thin film technology using the absorbing property of UV radiation for the substrates and dielectric materials. The computer analyses of the multilayer filter formulas were prepared using Macleod Software for the production processes. The deposition technique was achieved on optical substrates (Glass BK-7 and Infrasil 301) by dielectric material combinations including Titanium dioxide (Ti{sub 2}O{sub 3}), Hafnium dioxide (HfO{sub 2}), and Lima (mixture of oxides SiO{sub 2}/Al{sub 2}O{sub 3}); deposition being achieved using an electron beam gun. The output results of the theoretical and experimental transmittance values for spectral band from 200 nm to 800 nm were discussed in four processes. To analyze the suitability for use in 'real world' applications, the test pieces were subjected to the durability tests (adhesion, abrasion resistance, and humidity) according to Military Standard MIL-C-675C and MIL-C-48497A.

  10. Comparison of Single Channel Potassium Current in Biological and Synthetic Systems - Dependence on Voltage

    International Nuclear Information System (INIS)

    The influence of an external field on an ion current pattern in biological and synthetic systems was investigated. The patch clamp recordings of potassium current through a big conductance locust potassium channel (BK-channel) and a track-etched polyethylene terephthalate membrane were examined by the power spectrum, fractal analysis and relative dispersion analysis. A similar dependence of potassium current behaviour on the external voltage in both systems was found. The generalized dimension formalism is redefined to make it applicable to the analysis of time series. (author)

  11. The small molecule NS11021 is a potent and specific activator of Ca2+-activated big-conductance K+ channels

    DEFF Research Database (Denmark)

    Bentzen, Bo Hjorth; Nardi, Antonio; Calloe, Kirstine;

    2007-01-01

    Large-conductance Ca(2+)- and voltage-activated K(+) channels (Kca1.1/BK/MaxiK) are widely expressed ion channels. They provide a Ca(2+)-dependent feedback mechanism for the regulation of various body functions such as blood flow, neurotransmitter release, uresis, and immunity. In addition...... analysis revealed that NS11021 increased the open probability of the channel by altering gating kinetics without affecting the single-channel conductance. NS11021 (10 microM) influenced neither a number of cloned Kv channels nor endogenous Na(+) and Ca(2+) channels (L- and T-type) in guinea pig cardiac...... myocytes. In conclusion, NS11021 is a novel KCa1.1 channel activator with better specificity and a 10 times higher potency compared with the most broadly applied KCa1.1 opener, NS1619. Thus, NS11021 might be a valuable tool compound when addressing the physiological and pathophysiological roles of KCa1...

  12. Development of Energy Efficient, Multi-Channel, Pulsed Plasma Generator for High-Speed Flow Control by Localized Arc Filament Plasma Actuators Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The research team at The Ohio State University has been developing technologies to suppress jet noise using localized arc filament plasma actuators and are in the...

  13. Analysis of real-time mixture cytotoxicity data following repeated exposure using BK/TD models.

    Science.gov (United States)

    Teng, S; Tebby, C; Barcellini-Couget, S; De Sousa, G; Brochot, C; Rahmani, R; Pery, A R R

    2016-08-15

    Cosmetic products generally consist of multiple ingredients. Thus, cosmetic risk assessment has to deal with mixture toxicity on a long-term scale which means it has to be assessed in the context of repeated exposure. Given that animal testing has been banned for cosmetics risk assessment, in vitro assays allowing long-term repeated exposure and adapted for in vitro - in vivo extrapolation need to be developed. However, most in vitro tests only assess short-term effects and consider static endpoints which hinder extrapolation to realistic human exposure scenarios where concentration in target organs is varies over time. Thanks to impedance metrics, real-time cell viability monitoring for repeated exposure has become possible. We recently constructed biokinetic/toxicodynamic models (BK/TD) to analyze such data (Teng et al., 2015) for three hepatotoxic cosmetic ingredients: coumarin, isoeugenol and benzophenone-2. In the present study, we aim to apply these models to analyze the dynamics of mixture impedance data using the concepts of concentration addition and independent action. Metabolic interactions between the mixture components were investigated, characterized and implemented in the models, as they impacted the actual cellular exposure. Indeed, cellular metabolism following mixture exposure induced a quick disappearance of the compounds from the exposure system. We showed that isoeugenol substantially decreased the metabolism of benzophenone-2, reducing the disappearance of this compound and enhancing its in vitro toxicity. Apart from this metabolic interaction, no mixtures showed any interaction, and all binary mixtures were successfully modeled by at least one model based on exposure to the individual compounds. PMID:27317371

  14. Energy up-conversion and trapping: Dynamics of 5f states of Bk4+ in CeF4

    International Nuclear Information System (INIS)

    Energy transfer mechanisms of excited 5f states of Bk4+ (0.05 atom %) in CeF4 containing circa 0.95 atom % Cf4+ have been investigated at 4 K. The observed anti-Stokes fluorescence arises from both up-conversion and two-photon excitation. Nonexponential decays of Stokes fluorescence are ascribed to both excitation-excitation annihilation and site-dependent trapping processes and, therefore, are not describable by the Inokuti-Hirayama or exciton annihilation models. Based on the Forster-Dexter energy transfer theory, a new model is developed to fit the observed fluorescence decay data. 16 refs., 3 figs

  15. Urological management (medical and surgical) of BK-virus associated haemorrhagic cystitis in children following haematopoietic stem cell transplantation

    OpenAIRE

    Nikhil Vasdev; Angela Davidson; Christian Harkensee; Mary Slatter; Andrew Gennery; Ian Willetts; Andrew Thorpe

    2013-01-01

    Aim: Haemorrhagic cystitis (HC) is uncommon and in its severe form potentially life threatening complication of Haematopoietic stem cell transplantation (HSCT) in children. We present our single centre experience in the urological management of this clinically challenging condition. Patients and Methods: Fourteen patients were diagnosed with BK-Virus HC in our centre. The mean age at diagnosis was 8.8 years (range, 3.2-18.4 years). The mean number of days post-BMT until onset of HC was 20.8 (...

  16. Isospin Symmetry Breaking in B->K^* \\gamma Decay due to an Extra Generation of Vector Quarks

    CERN Document Server

    Ahmady, M R; Ahmady, Mohammad R.; Chishtie, Farrukh

    2005-01-01

    The extra contributions due to an extra generation of vector-like quarks to the isospin symmetry breaking observable associated with the radiative B->K^* \\gamma decay is obtained. It is shown that this additional contribution is sensitive to the nonunitarity parameter U^{sb}, which is a measure of the the strength of the non-zero tree-level flavor changing neutral current in this model. The significance of this result is that, once accurate experimental resultson the isospin asymmetry becomes available, one can constrain the U^{sb} independent of the mass of the extra quarks and so a much more stringent acceptablemodel parameter space could be obtained.

  17. Non-perturbative Renormalization of Four-Fermion Operators Relevant to $B_K$ with Staggered Quarks

    CERN Document Server

    Jeong, Hwancheol; Kim, Jongjeong; Lee, Weonjong; Pak, Jeonghwan; Park, Sungwoo

    2014-01-01

    We present preliminary results of matching factors of the four-fermion operators relevant to $B_K$, which are obtained using the non-perturbative renormalization (NPR) method in the RI-MOM scheme with HYP-smeared improved staggered fermions. We use the MILC asqtad coarse ($a \\cong 0.12\\,$fm) ensembles with $20^3 \\times 64$ geometry and $am_{\\ell}/am_s = 0.01/0.05$. We compare NPR results with those of one-loop perturbative matching.

  18. The involvement of TRP channels in sensory irritation: a mechanistic approach toward a better understanding of the biological effects of local irritants.

    Science.gov (United States)

    Lehmann, Ramona; Schöbel, Nicole; Hatt, Hanns; van Thriel, Christoph

    2016-06-01

    Peripheral nerves innervating the mucosae of the nose, mouth, and throat protect the organism against chemical hazards. Upon their stimulation, characteristic perceptions (e.g., stinging and burning) and various reflexes are triggered (e.g., sneezing and cough). The potency of a chemical to cause sensory irritation can be estimated by a mouse bioassay assessing the concentration-dependent decrease in the respiratory rate (50 % decrease: RD50). The involvement of the N. trigeminus and its sensory neurons in the irritant-induced decrease in respiratory rates are not well understood to date. In calcium imaging experiments, we tested which of eight different irritants (RD50 5-730 ppm) could induce responses in primary mouse trigeminal ganglion neurons. The tested irritants acetophenone, 2-ethylhexanol, hexyl isocyanate, isophorone, and trimethylcyclohexanol stimulated responses in trigeminal neurons. Most of these responses depended on functional TRPA1 or TRPV1 channels. For crotyl alcohol, 3-methyl-1-butanol, and sodium metabisulfite, no activation could be observed. 2-ethylhexanol can activate both TRPA1 and TRPV1, and at low contractions (100 µM) G protein-coupled receptors (GPCRs) seem to be involved. GPCRs might also be involved in the mediation of the responses to trimethylcyclohexanol. By using neurobiological tools, we showed that sensory irritation in vivo could be based on the direct activation of TRP channels but also on yet unknown interactions with GPCRs present in trigeminal neurons. Our results showed that the potency suggested by the RD50 values was not reflected by direct nerve-compound interaction. PMID:27037703

  19. Closure of multiple types of K+ channels is necessar to induce changes in renal vascular resistance in vivo in rats

    DEFF Research Database (Denmark)

    Sørensen, Charlotte Mehlin; Giese, Isaiah; Braunstein, Thomas Hartig;

    2011-01-01

    flow (RBF) in vivo in anesthetized Sprague-Dawley rats. Test agents were infused directly into the renal artery to avoid systemic effects. Inhibition of BK(Ca) and K(ir) channels (with TEA and Ba(2+), respectively) caused small and transient reductions in RBF (to 93¿±¿2% and 95¿±¿1% of baseline...... reduction. The effect of the cocktail of K(+) channel blockers was confirmed in mice using the isolated blood-perfused juxtamedullary nephron preparation. A cocktail of K(+) channel openers (K(+), NS309, NS1619 and pinacidil) had only a minor effect on baseline RBF in vivo in rats, but reduced......Inhibition of K(+) channels might mediate renal vasoconstriction. As inhibition of a single type of K(+) channel caused minor or no renal vasoconstriction in vivo in rats, we hypothesized that several classes of K(+) channels must be blocked to elicit renal vasoconstriction. We measured renal blood...

  20. MEMS in microfluidic channels.

    Energy Technology Data Exchange (ETDEWEB)

    Ashby, Carol Iris Hill; Okandan, Murat; Michalske, Terry A.; Sounart, Thomas L.; Matzke, Carolyn M.

    2004-03-01

    Microelectromechanical systems (MEMS) comprise a new class of devices that include various forms of sensors and actuators. Recent studies have shown that microscale cantilever structures are able to detect a wide range of chemicals, biomolecules or even single bacterial cells. In this approach, cantilever deflection replaces optical fluorescence detection thereby eliminating complex chemical tagging steps that are difficult to achieve with chip-based architectures. A key challenge to utilizing this new detection scheme is the incorporation of functionalized MEMS structures within complex microfluidic channel architectures. The ability to accomplish this integration is currently limited by the processing approaches used to seal lids on pre-etched microfluidic channels. This report describes Sandia's first construction of MEMS instrumented microfluidic chips, which were fabricated by combining our leading capabilities in MEMS processing with our low-temperature photolithographic method for fabricating microfluidic channels. We have explored in-situ cantilevers and other similar passive MEMS devices as a new approach to directly sense fluid transport, and have successfully monitored local flow rates and viscosities within microfluidic channels. Actuated MEMS structures have also been incorporated into microfluidic channels, and the electrical requirements for actuation in liquids have been quantified with an elegant theory. Electrostatic actuation in water has been accomplished, and a novel technique for monitoring local electrical conductivities has been invented.

  1. 肾移植术后BK病毒相关性肾病的研究现状%Study on BK virus-associated nephropathy after renal transplantation

    Institute of Scientific and Technical Information of China (English)

    肖荆; 田野

    2008-01-01

    BACKGROUND: BK viral infection after renal transplantation influences the prognosis of BK virus-associated nephropathy in renal transplant recipients. The disease has been widely studied in foreign countries.OBJECTIVE: This study was designed to sum up the diagnosis and treatment of BK virus-associated nephropathy after renal transplantation.RETRIVAL STRATEGY: Using the terms "renal transplantation; BK virus" in the English language, manuscripts responsible for BK virus-associated nephropathy after renal transplantation that were published from January 2000 to January 2007 were retrieved from the PubMed database. A total of 206 manuscripts were obtained and primarily screened. Inclusion criteria: studies addressing BK virus-associated nephropathy after renal transplantation. Exclusion criteria: repetitive studies.LITERATURE EVALUATION: The included manuscripts were primarily from PubMed database. Manuscripts were primarily original and review studies.DATA SYNTHESIS: BK virus can be found in the urine of 3%-40% of adult renal transplant recipients. BK virus reactivation rate is very high, but the histological manifestations of BK virus associated nephropathy are found only in a small number of renal transplant recipients. The prognosis of BK virus associated nephropathy is very poor. BK virus associated nephropathy develops into renal failure, leading to transplant loss, in 30%-50% patients. BK virus-caused renal transplant disease must be diagnosed according to histological manifestations. Viral infection should be primarily confirmed, but serological measurements have no predominant effects. Electron microscopy should be involved in the assessment of renal graft biopsy, especially when renal failure factors are unknown, as through the use of electron microscope, viral particles in the nucleus, cytoplasm and outside of the cells could be detectable. Viral antigen in the urine sample of patients with BK viruria can be detected by nucleic acid hybridization method

  2. Pharmacodynamics of potassium channel openers in cultured neuronal networks.

    Science.gov (United States)

    Wu, Calvin; V Gopal, Kamakshi; Lukas, Thomas J; Gross, Guenter W; Moore, Ernest J

    2014-06-01

    A novel class of drugs - potassium (K(+)) channel openers or activators - has recently been shown to cause anticonvulsive and neuroprotective effects by activating hyperpolarizing K(+) currents, and therefore, may show efficacy for treating tinnitus. This study presents measurements of the modulatory effects of four K(+) channel openers on the spontaneous activity and action potential waveforms of neuronal networks. The networks were derived from mouse embryonic auditory cortices and grown on microelectrode arrays. Pentylenetetrazol was used to create hyperactivity states in the neuronal networks as a first approximation for mimicking tinnitus or tinnitus-like activity. We then compared the pharmacodynamics of the four channel activators, retigabine and flupirtine (voltage-gated K(+) channel KV7 activators), NS1619 and isopimaric acid ("big potassium" BK channel activators). The EC50 of retigabine, flupirtine, NS1619, and isopimaric acid were 8.0, 4.0, 5.8, and 7.8µM, respectively. The reduction of hyperactivity compared to the reference activity was significant. The present results highlight the notion of re-purposing the K(+) channel activators for reducing hyperactivity of spontaneously active auditory networks, serving as a platform for these drugs to show efficacy toward target identification, prevention, as well as treatment of tinnitus. PMID:24681057

  3. Pharmacodynamics of potassium channel openers in cultured neuronal networks.

    Science.gov (United States)

    Wu, Calvin; V Gopal, Kamakshi; Lukas, Thomas J; Gross, Guenter W; Moore, Ernest J

    2014-06-01

    A novel class of drugs - potassium (K(+)) channel openers or activators - has recently been shown to cause anticonvulsive and neuroprotective effects by activating hyperpolarizing K(+) currents, and therefore, may show efficacy for treating tinnitus. This study presents measurements of the modulatory effects of four K(+) channel openers on the spontaneous activity and action potential waveforms of neuronal networks. The networks were derived from mouse embryonic auditory cortices and grown on microelectrode arrays. Pentylenetetrazol was used to create hyperactivity states in the neuronal networks as a first approximation for mimicking tinnitus or tinnitus-like activity. We then compared the pharmacodynamics of the four channel activators, retigabine and flupirtine (voltage-gated K(+) channel KV7 activators), NS1619 and isopimaric acid ("big potassium" BK channel activators). The EC50 of retigabine, flupirtine, NS1619, and isopimaric acid were 8.0, 4.0, 5.8, and 7.8µM, respectively. The reduction of hyperactivity compared to the reference activity was significant. The present results highlight the notion of re-purposing the K(+) channel activators for reducing hyperactivity of spontaneously active auditory networks, serving as a platform for these drugs to show efficacy toward target identification, prevention, as well as treatment of tinnitus.

  4. Geometric pumping in autophoretic channels

    CERN Document Server

    Michelin, Sebastien; De Canio, Gabriele; Lobato-Dauzier, Nicolas; Lauga, Eric

    2015-01-01

    Many microfluidic devices use macroscopic pressure differentials to overcome viscous friction and generate flows in microchannels. In this work, we investigate how the chemical and geometric properties of the channel walls can drive a net flow by exploiting the autophoretic slip flows induced along active walls by local concentration gradients of a solute species. We show that chemical patterning of the wall is not required to generate and control a net flux within the channel, rather channel geometry alone is sufficient. Using numerical simulations, we determine how geometric characteristics of the wall influence channel flow rate, and confirm our results analytically in the asymptotic limit of lubrication theory.

  5. Channel Allocation Algorithm of Multidimensional Heterogeneous Network Based on Local Cross Term Compensation%多维异质网络局部性交叉项补偿信道分配算法

    Institute of Scientific and Technical Information of China (English)

    吕瑾文

    2014-01-01

    In the multi-dimensional heterogeneous networks, due to bearing different protocols and network, resulting in un⁃even channel congestion and distribution. The traditional channel assignment algorithm for multidimensional heterogeneous networks uses dynamic allocation algorithm based on channel switching, the performance is bad. A channel allocation algo⁃rithm of multidimensional heterogeneous network based on local cross term compensation is proposed, channel protocol multidimensional heterogeneous network analysis and model analysis and solution are obtained, consider the fairness among users receiving SINR, introducing a partial cross term for compensating channel switching imbalance, the algorithm is improved. The experimental results show that the improved algorithm can make the life cycle of heterogeneous network to be extended, the accuracy of data transfer is improved, loss of data and channel imbalance is avoided, improve the distribu⁃tion efficiency and accuracy, it effectively ensures the fairness for users receiving SINR, the performance is superior to the traditional algorithm, it shows a good application value.%在多维异质网络中,由于承载不同的协议和网络,导致信道拥挤和分配不均衡。传统的多维异质网络信道分配算法采用基于信道切换的动态分配算法,在动态切换过程中易导致数据丢失和信道失衡。提出一种基于数据交叉项补偿机制的多维异质网络信道分配算法,进行多维异质网络信道协议分析与模型分析和求解,考虑用户间接收SINR的公平性,构建信道性能因子,引入一个局部性交叉项补偿信道切换中的失衡性实现算法改进。实验结果表明,改进算法使异质网络生命周期得到扩展,有利于数据的准确传输,避免在信道分配动态切换过程中导致的数据丢失和信道失衡,提高了分配效率和准确性,有效地保证了各用户接收SINR的公平性,信

  6. Entanglement-saving channels

    Science.gov (United States)

    Lami, L.; Giovannetti, V.

    2016-03-01

    The set of Entanglement Saving (ES) quantum channels is introduced and characterized. These are completely positive, trace preserving transformations which when acting locally on a bipartite quantum system initially prepared into a maximally entangled configuration, preserve its entanglement even when applied an arbitrary number of times. In other words, a quantum channel ψ is said to be ES if its powers ψn are not entanglement-breaking for all integers n. We also characterize the properties of the Asymptotic Entanglement Saving (AES) maps. These form a proper subset of the ES channels that is constituted by those maps that not only preserve entanglement for all finite n but which also sustain an explicitly not null level of entanglement in the asymptotic limit n → ∞. Structure theorems are provided for ES and for AES maps which yield an almost complete characterization of the former and a full characterization of the latter.

  7. Pilot conversion trial from mycophenolic acid to everolimus in ABO-incompatible kidney-transplant recipients with BK viruria and/or viremia.

    Science.gov (United States)

    Belliere, Julie; Kamar, Nassim; Mengelle, Catherine; Allal, Asma; Sallusto, Federico; Doumerc, Nicolas; Game, Xavier; Congy-Jolivet, Nicolas; Esposito, Laure; Debiol, Benedicte; Rostaing, Lionel

    2016-03-01

    Immunosuppression using everolimus (EVR) plus low-dose tacrolimus (Tac) is commonly used in organ transplantation. EVR has potential antiviral effects. Herein, the long-term outcomes and impacts of Tac-EVR on the BK virus are reported in ABO-incompatible kidney-transplant recipients. The initial immunosuppressive regimen combined steroids, Tac, and mycophenolic acid (MPA). At a median of 141 (34-529) days post-transplantation, seven stable ABO-incompatible kidney-transplant recipients were converted from MPA to EVR because of active BK replication, and compared with a reference group of fourteen ABO-incompatible patients receiving classical Tac plus MPA. At 1 month before conversion, at 1, 3 months after, and at last follow-up, clinical and biological parameters were monitored. The median time from conversion to the last follow-up was 784 (398-866) days. Conversion to EVR caused no change to rejection episodes or immunological status (isoagglutinin titers, anti-HLA antibodies). At last follow-up, median eGFR was similar in the Tac-MPA versus Tac-EVR group (40 [range: 14-56] vs. 54.5 ml/min/1.73 m(2) [range: 0-128], P = 0.07). The major adverse event was dyslipidemia. Interestingly, conversion from MPA to EVR decreased BK viral load in five patients. ABO-incompatible kidney-transplant recipients with an active BK virus infection may benefit from conversion to EVR. PMID:26575959

  8. Energy levels of 249Bk populated in the α decay of 99253Es and β- decay of 96249Cm

    International Nuclear Information System (INIS)

    The level structure of 249Bk has been investigated by measuring the γ-ray spectra of an extremely pure 253Es sample obtained by milking this nuclide from 253Cf source material produced in the High Flux Isotope Reactor at Oak Ridge National Laboratory. Additional information on the 249Bk levels was obtained from the β--decay study of 249Cm, produced by neutron irradiation of 248Cm. Using the results of the present study together with the data from previous 248Cm(α,t) and 248Cm(3He,d) reactions, the following single-particle states have been identified in 249Bk: 7/2+[633], 0.0 keV; 3/2-[521], 8.78 keV; 1/2+[400], 377.55 keV; 5/2+[642], 389.17 keV; 1/2-[530], 569.20 keV; 1/2-[521], 643.0 keV; 5/2-[523], 672.9 keV; and 9/2+[624], 1075.1 keV. Four vibrational bands were identified at 767.9, 932.2, 1150.7, and 1223.0 keV with tentative assignments of {7/2+ [633] x1-}9/2-, {7/2+ [633] x 0-}7/2-, {7/2+ [633] x 1-}5/2-, and {7/2+ [633] x 0+}7/2+, respectively. A band at 899.9 keV was observed in γ-γ coincidence measurements and given a tentative spin assignment of 3/2. It is possibly associated with a 2- phonon coupled to the ground state, with configuration {7/2+ [633] x 2-}3/2-. Three levels at 624.3, 703.5, and 769.1 keV were assigned spins of 5/2, 7/2, and 9/2, respectively. These could be the members of the 3/2+ [651] band, expected in this energy region

  9. Semi-contact-writing of polymer molds for prototyping PDMS chips with low surface roughness, sharp edges and locally varying channel heights

    Science.gov (United States)

    Gutzweiler, Ludwig; Stumpf, Fabian; Tanguy, Laurent; Roth, Guenter; Koltay, Peter; Zengerle, Roland; Riegger, Lutz

    2016-04-01

    Microfluidic systems fabricated in polydimethylsiloxane (PDMS) enable a broad variety of applications and are widespread in the field of Lab-on-a-Chip. Here we demonstrate semi-contact-writing, a novel method for fabrication of polymer based molds for casting microfluidic PDMS chips in a highly flexible, time and cost-efficient manner. The method is related to direct-writing of an aqueous polymer solution on a planar glass substrate and substitutes conventional, time- and cost-consuming UV-lithography. This technique facilitates on-demand prototyping in a low-cost manner and is therefore ideally suited for rapid chip layout iterations. No cleanroom facilities and less expertise are required. Fabrication time from scratch to ready-to-use PDMS-chip is less than 5 h. This polymer writing method enables structure widths down to 140 μm and controllable structure heights ranging from 5.5 μm for writing single layers up to 98 μm by stacking. As a unique property, freely selectable height variations across a substrate can be achieved by application of local stacking. Furthermore, the molds exhibit low surface roughness (R a   =  24 nm, R RMS  =  28 nm) and high fidelity edge sharpness. We validated the method by fabrication of molds to cast PDMS chips for droplet based flow-through PCR with single-cell sensitivity.

  10. 铜离子交换单步掩埋BK7玻璃波导的制备与表征%Characterization of Single Step Buried Waveguides on BK7 Glass by Copper Ion Exchange

    Institute of Scientific and Technical Information of China (English)

    王鹏飞; 郑杰; 鄂书林; G.C.Righini

    2004-01-01

    利用Cu离子交换技术制备了BK7玻璃平面光波导,在632.8 nm波长下,用棱镜耦合技术测量出所制备波导的有效折射率,利用反WKB方法计算并确定了平面光波导的折射率分布,通过对折射率分布进行函数拟合,发现离子交换后的样品折射率分布近似符合改进后的高斯分布,样品的折射率分布似乎是一个掩埋波导的折射率分布,求出所制备玻璃平面光波导在570℃的扩散系数De≈1.2133×10-14m2/s.同时,对所制备波导进行了电子显微镜(EMS)和次级离子质谱(SIMS)测试,得到了铜离子在玻璃表面的浓度分布,从而证明了实验所得到的BK7玻璃平面光波导是掩埋波导.这种掩埋平面波导是由单步Cu离子交换技术得到的.

  11. A comparison of HK-CONWIP and BK-CONWIP control strategies in a multi-product manufacturing system

    Directory of Open Access Journals (Sweden)

    Chukwunonyelum Emmanuel Onyeocha

    2015-12-01

    Full Text Available This paper evaluates the performance of the Hybrid Kanban Constant Work-In-Process control strategy and Basestock Kanban Constant Work-In-Process control strategy operating Shared Kanban Allocation Policy (S-KAP and Dedicated Kanban Allocation Policy (D-KAP in a multi-product serial flow line. We explored the effect of an increase of product types on the WIP inventory in the system. A simulation-based optimisation technique was used in determining the optimal settings for the strategies. The strategies were compared via pairwise comparison technique and Nelson’s ranking and selection procedure. S-KAP responds quicker to demand than D-KAP. BK-CONWIP outperforms HK-CONWIP in a serial manufacturing system. It was shown that an increase in the number of product-type increases the number of PAC and WIP inventory.

  12. No evidence for infection of UK prostate cancer patients with XMRV, BK virus, Trichomonas vaginalis or human papilloma viruses.

    Directory of Open Access Journals (Sweden)

    Harriet C T Groom

    Full Text Available The prevalence of specific infections in UK prostate cancer patients was investigated. Serum from 84 patients and 62 controls was tested for neutralisation of xenotropic murine leukaemia virus-related virus (XMRV Envelope. No reactivity was found in the patient samples. In addition, a further 100 prostate DNA samples were tested for XMRV, BK virus, Trichomonas vaginalis and human papilloma viruses by nucleic acid detection techniques. Despite demonstrating DNA integrity and assay sensitivity, we failed to detect the presence of any of these agents in DNA samples, bar one sample that was weakly positive for HPV16. Therefore we conclude that these infections are absent in this typical cohort of men with prostate cancer.

  13. Brands & Channels

    Institute of Scientific and Technical Information of China (English)

    Alice Yang

    2009-01-01

    @@ "Brands" and "Channels" are the two most important things in Ku-Hai Chen's eyes when doing business with Main-land China. Ku-Hai Chen, Executive Director of the International Trade Institute of Taiwan External Trade Development Council (TAITRA), flies frequently between Chinese Taipei and Mainland China, and was in Beijing earlier this month for his seminar.

  14. Angioedema attacks in patients with hereditary angioedema: Local manifestations of a systemic activation process.

    Science.gov (United States)

    Hofman, Zonne L M; Relan, Anurag; Zeerleder, Sacha; Drouet, Christian; Zuraw, Bruce; Hack, C Erik

    2016-08-01

    Hereditary angioedema (HAE) caused by a deficiency of functional C1-inhibitor (C1INH) becomes clinically manifest as attacks of angioedema. C1INH is the main inhibitor of the contact system. Poor control of a local activation process of this system at the site of the attack is believed to lead to the formation of bradykinin (BK), which increases local vasopermeability and mediates angioedema on interaction with BK receptor 2 on the endothelium. However, several observations in patients with HAE are difficult to explain from a pathogenic model claiming a local activation process at the site of the angioedema attack. Therefore we postulate an alternative model for angioedema attacks in patients with HAE, which assumes a systemic, fluid-phase activation of the contact system to generate BK and its breakdown products. Interaction of these peptides with endothelial receptors that are locally expressed in the affected tissues rather than with receptors constitutively expressed by the endothelium throughout the whole body explains that such a systemic activation process results in local manifestations of an attack. In particular, BK receptor 1, which is induced on the endothelium by inflammatory stimuli, such as kinins and cytokines, meets the specifications of the involved receptor. The pathogenic model discussed here also provides an explanation for why angioedema can occur at multiple sites during an attack and why HAE attacks respond well to modest increases of circulating C1INH activity levels because inhibition of fluid-phase Factor XIIa and kallikrein requires lower C1INH levels than inhibition of activator-bound factors.

  15. Quantum channel capacities - multiparty communication

    CERN Document Server

    Demianowicz, M; Demianowicz, Maciej; Horodecki, Pawel

    2006-01-01

    We analyze different aspects of multiparty communication over quantum memoryless channels and generalize some of key results known from bipartite channels to that of multiparty scenario. In particular, we introduce multiparty versions of minimal subspace transmission fidelity and entanglement transmission fidelity. We also provide alternative, local, versions of fidelities and show their equivalence to the global ones in context of capacity regions defined. The equivalence of two different capacity notions with respect to two types of the fidelities is proven. In analogy to bipartite case it is shown, via sufficiency of isometric encoding theorem, that additional classical forward side channel does not increase capacity region of any quantum channel with $k$ senders and $m$ receivers which represents a compact unit of general quantum networks theory. The result proves that recently provided capacity region of multiple access channel ([M. Horodecki et al, Nature {\\bf 436} 673 (2005)], [J.Yard et al, quant-ph/0...

  16. Channel Power in Multi-Channel Environments

    NARCIS (Netherlands)

    M.G. Dekimpe (Marnik); B. Skiera (Bernd)

    2004-01-01

    textabstractIn the literature, little attention has been paid to instances where companies add an Internet channel to their direct channel portfolio. However, actively managing multiple sales channels requires knowing the customers’ channel preferences and the resulting channel power. Two key compon

  17. The secretory KCa1.1 channel localises to crypts of distal mouse colon: functional and molecular evidence

    DEFF Research Database (Denmark)

    Sørensen, Mads Vaarby; Strandsby, Anne Bystrup; Larsen, Casper Kornbech;

    2011-01-01

    Na+ absorption is mediated by epithelial Na+ channel (ENaC) in surface cells. Previously, we identified the large conductance Ca2+-activated K+ channel, KCa1.1 or big potassium (BK) channel, as the only relevant K+ secretory pathway in mouse distal colon. The exact localisation of K(Ca)1.1 channels......) is expressed primarily in the crypts and γ-ENaC primarily in the surface cells. The KCa1.1 α-subunit mRNA was like NKCC1, mainly expressed in the crypts. The crypt to surface expression pattern of the channels and transporters was not altered when plasma aldosterone was elevated. The mRNA levels for NKCC1, γ-ENa......C and KCa1.1 α-subunit were, however, under these circumstances substantially augmented (KCa1.1 α-subunit, twofold; NKCC1, twofold and ENaC, tenfold). Functionally, we show that ENaC-mediated Na+ absorption and BK channel-mediated K+ secretion are two independent processes. These findings show that KCa1...

  18. 江苏卫视高清频道本地上星平台设计和运行%Jiangsu Satelite TV HD Channel Local Broadcasting Platform’SDesign and Operation

    Institute of Scientific and Technical Information of China (English)

    李嘉; 胡振光

    2016-01-01

    With the realization of remote encryption technology,Consider the economy and security,The JiangSu Broadcasting Corporation decided that the Jiangsu satellite channel in local broadcast. They design and construction to the principle of safety and practical innovation.The Project contains Broadcast system、Operation supervision system、P& E Supervision System and Visual system for operation and maintenance management.%随着远程加密技术得以解决,江苏省广播电视台从经济和安全性等方面考虑,决定江苏卫视高清频道转为本地上星,并开展了高清频道上星平台的项目设计施工。项目设计施工以安全、实用、创新为基本原则,分别开展播出系统、上星运行监管系统、机房及环境保障系统、运维可视化等分系统的建设。

  19. Channel Networks

    Science.gov (United States)

    Rinaldo, Andrea; Rodriguez-Iturbe, Ignacio; Rigon, Riccardo

    This review proceeds from Luna Leopold's and Ronald Shreve's lasting accomplishments dealing with the study of random-walk and topologically random channel networks. According to the random perspective, which has had a profound influence on the interpretation of natural landforms, nature's resiliency in producing recurrent networks and landforms was interpreted to be the consequence of chance. In fact, central to models of topologically random networks is the assumption of equal likelihood of any tree-like configuration. However, a general framework of analysis exists that argues that all possible network configurations draining a fixed area are not necessarily equally likely. Rather, a probability P(s) is assigned to a particular spanning tree configuration, say s, which can be generally assumed to obey a Boltzmann distribution: P(s) % e^-H(s)/T, where T is a parameter and H(s) is a global property of the network configuration s related to energetic characters, i.e. its Hamiltonian. One extreme case is the random topology model where all trees are equally likely, i.e. the limit case for T6 4 . The other extreme case is T 6 0, and this corresponds to network configurations that tend to minimize their total energy dissipation to improve their likelihood. Networks obtained in this manner are termed optimal channel networks (OCNs). Observational evidence suggests that the characters of real river networks are reproduced extremely well by OCNs. Scaling properties of energy and entropy of OCNs suggest that large network development is likely to effectively occur at zero temperature (i.e. minimizing its Hamiltonian). We suggest a corollary of dynamic accessibility of a network configuration and speculate towards a thermodynamics of critical self-organization. We thus conclude that both chance and necessity are equally important ingredients for the dynamic origin of channel networks---and perhaps of the geometry of nature.

  20. Marketingová situační analýza BK Lions Jindřichův Hradec

    OpenAIRE

    Hron, Patrik

    2014-01-01

    The aim of this bachelor thesis is to carry out an analysis of each part of marketing mix and the environment in which the BK Lions Jindřichův Hradec basketball club is situated. Suitable and applicable recommendations are suggested to make the marketing mix more effective based on analysis of marketing situation. The first part is focused on describing the marketing mix and marketing situational analysis at a theoretical level. The practical part describes particular marketing tools which ar...

  1. Evaluation of the Genetic Variation of Non Coding Control Region of BK Virus Using Nested-PCR Sequencing Method in Renal Graft Patients

    Directory of Open Access Journals (Sweden)

    A Emami

    2015-05-01

    Full Text Available Background & aim: Polyomaviruses (BK is a comprehensive infection with more than of 80% prevalence in the world. One of the most important reasons of BK virus nephropathy is in the renal transplant recipients and rejection of transplanted tissue between them. Non Coding region of this virus play a regulatory role in replication and amplification of the virus. The aim of this study was to evaluate the genetic patterns of this area in renal graft at Namazi Transplantation Center, Shiraz, Iran. Methods: In the present experimental study, 380 renal allograft serums were collected. DNAs of 129 eligible samples were extracted and evaluated using a virus genome. The presence of the virus was determined by qualitative and sequencing. Of these, 129 samples were tested for the presence of virus according to the condition study, using quantitative, qualitative genomic amplification and sequencing. Results: The study showed symptoms of nephropathy, 76 (58.9% of them were males and 46 (35.7% were females with the mean age 38.0±.089 years of age. In general, 46 patients (35.7% percent were positive for BK Polyomaviruses. After comparing the genomic sequence with applications of molecular they were categorized in three groups and then recorded in gene bank. Conclusion: About 35% of renal transplant recipients with high creatinine levels were positive for the presence of BK virus. Non-coding region of respondents in the sample survey revealed that among patients with the most common genotypes were rearranged the entire transplant patients were observed at this tranplant center. Examination of these sequences indicated that this rearrangments had a specific pattern, different from the standard strain of archaea type.

  2. Urological management (medical and surgical of BK-virus associated haemorrhagic cystitis in children following haematopoietic stem cell transplantation

    Directory of Open Access Journals (Sweden)

    Nikhil Vasdev

    2013-10-01

    Full Text Available Aim: Haemorrhagic cystitis (HC is uncommon and in its severe form potentially life threatening complication of Haematopoietic stem cell transplantation (HSCT in children. We present our single centre experience in the urological management of this clinically challenging condition. Patients and Methods: Fourteen patients were diagnosed with BK-Virus HC in our centre. The mean age at diagnosis was 8.8 years (range, 3.2-18.4 years. The mean number of days post-BMT until onset of HC was 20.8 (range, 1 – 51. While all patients tested urine positive for BKV at the clinical onset of HC, only four patients had viral quantification, with viral loads ranging from 97,000 to >1 billion/ml. 8 patients had clinical HC. Ten patients experienced acute GVHD (grade I: 6 patients, grade II: 3 patients, grade 4: 1 patient.Results: Four patients received medical management for their HC. Treatments included hyperhydration, MESNA, blood and platelet transfusion, premarin and oxybutynin (Table 6.  Two patients received both medical and surgical management which included cystoscopy with clot evacuation, bladder irrigation and supra-pubic catheter insertion. One patient received exclusive surgical management. Seven patients were treated conservatively. Conclusion: There is limited available evidence for other potential therapeutic strategies highlighting the need for more research into the pathophysiology of HSCT-associated HC. Commonly used interventions with possible clinical benefit (e.g. cidofovir, ciprofloxacin still require to be evaluated in multi-centre, high-quality studies. Potential future preventative and therapeutic options, such as modulation of conditioning, immunosuppression and engraftment, new antiviral and anti-inflammatory and less nephrotoxic agents need to be assessed.---------------------------Cite this article as:Vasdev N, Davidson A, Harkensee C, Slatter M, Gennery A, Willetts I, Thorpe A.Urological management (medical and surgical of BK

  3. Information geometry of Gaussian channels

    International Nuclear Information System (INIS)

    We define a local Riemannian metric tensor in the manifold of Gaussian channels and the distance that it induces. We adopt an information-geometric approach and define a metric derived from the Bures-Fisher metric for quantum states. The resulting metric inherits several desirable properties from the Bures-Fisher metric and is operationally motivated by distinguishability considerations: It serves as an upper bound to the attainable quantum Fisher information for the channel parameters using Gaussian states, under generic constraints on the physically available resources. Our approach naturally includes the use of entangled Gaussian probe states. We prove that the metric enjoys some desirable properties like stability and covariance. As a by-product, we also obtain some general results in Gaussian channel estimation that are the continuous-variable analogs of previously known results in finite dimensions. We prove that optimal probe states are always pure and bounded in the number of ancillary modes, even in the presence of constraints on the reduced state input in the channel. This has experimental and computational implications. It limits the complexity of optimal experimental setups for channel estimation and reduces the computational requirements for the evaluation of the metric: Indeed, we construct a converging algorithm for its computation. We provide explicit formulas for computing the multiparametric quantum Fisher information for dissipative channels probed with arbitrary Gaussian states and provide the optimal observables for the estimation of the channel parameters (e.g., bath couplings, squeezing, and temperature).

  4. Impact of mTORC1 inhibition on keratinocyte proliferation during skin tumor promotion in wild-type and BK5.AktWT mice.

    Science.gov (United States)

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2014-11-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.Akt(WT) mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15-30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2-4 h) was mediated by activation of EGFR and Akt. BK5.Akt(WT) transgenic mice, where Akt1 is overexpressed in basal epidermis, are highly sensitive to TPA-induced epidermal proliferation and two-stage skin carcinogenesis. Targeting mTORC1 with rapamycin effectively inhibited TPA-induced epidermal hyperplasia and hyperproliferation as well as tumor promotion in a dose-dependent manner in both wild-type and BK5.Akt(WT) mice. A significant expansion (∼threefold) of the label retaining cell (LRC) population per hair follicle was observed in BK5.Akt(WT) mice compared to FVB/N mice. There was also a significant increase in K15 expressing cells in the hair follicle of transgenic mice that coincided with expression of phospho-Akt, phospho-S6K, and phospho-PRAS40, suggesting an important role of mTORC1 signaling in bulge-region keratinocyte stem cell (KSC) homeostasis. After 2 weeks of TPA treatment, LRCs had moved upward into the interfollicular epidermis from the bulge region of both wild-type and BK5.Akt(WT) mice. TPA-mediated LRC proliferation and migration was significantly inhibited by rapamycin. Collectively, the current data indicate that signaling through mTORC1 contributes significantly to the process of skin tumor promotion through effects on proliferation of the target cells for tumor development.

  5. Impact of mTORC1 inhibition on keratinocyte proliferation during skin tumor promotion in wild-type and BK5.AktWT mice.

    Science.gov (United States)

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2014-11-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.Akt(WT) mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15-30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2-4 h) was mediated by activation of EGFR and Akt. BK5.Akt(WT) transgenic mice, where Akt1 is overexpressed in basal epidermis, are highly sensitive to TPA-induced epidermal proliferation and two-stage skin carcinogenesis. Targeting mTORC1 with rapamycin effectively inhibited TPA-induced epidermal hyperplasia and hyperproliferation as well as tumor promotion in a dose-dependent manner in both wild-type and BK5.Akt(WT) mice. A significant expansion (∼threefold) of the label retaining cell (LRC) population per hair follicle was observed in BK5.Akt(WT) mice compared to FVB/N mice. There was also a significant increase in K15 expressing cells in the hair follicle of transgenic mice that coincided with expression of phospho-Akt, phospho-S6K, and phospho-PRAS40, suggesting an important role of mTORC1 signaling in bulge-region keratinocyte stem cell (KSC) homeostasis. After 2 weeks of TPA treatment, LRCs had moved upward into the interfollicular epidermis from the bulge region of both wild-type and BK5.Akt(WT) mice. TPA-mediated LRC proliferation and migration was significantly inhibited by rapamycin. Collectively, the current data indicate that signaling through mTORC1 contributes significantly to the process of skin tumor promotion through effects on proliferation of the target cells for tumor development. PMID:24114993

  6. Regulation of KV channel voltage-dependent activation by transmembrane β subunits

    Directory of Open Access Journals (Sweden)

    Xiaohui eSun

    2012-04-01

    Full Text Available Voltage-activated K+ (KV channels are important for shaping action potentials and maintaining resting membrane potential in excitable cells. KV channels contain a central pore-gate domain (PGD surrounded by four voltage-sensing domains (VSD. The VSDs will change conformation in response to alterations of the membrane potential thereby inducing the opening of the PGD. Many KV channels are heteromeric protein complexes containing auxiliary β subunits. These β subunits modulate channel expression and activity to increase functional diversity and render tissue specific phenotypes. This review focuses on the KV β subunits that contain transmembrane (TM segments including the KCNE family and the β subunits of large conductance, Ca2+- and voltage-activated K+ (BK channels. These TM β subunits affect the voltage-dependent activation of KV α subunits. Experimental and computational studies have described the structural location of these β subunits in the channel complexes and the biophysical effects on VSD activation, PGD opening and VSD-PGD coupling. These results reveal some common characteristics and mechanistic insights into KV channel modulation by TM β subunits.

  7. Channeling experiment

    International Nuclear Information System (INIS)

    Channeling of water flow and tracer transport in real fractures in a granite body at Stripa have been investigated experimentally. The experimental site was located 360 m below the ground level. Two kinds of experiments were performed. In the single hole experiments, 20 cm diameter holes were drilled about 2.5 m into the rock in the plane of the fracture. Specially designed packers were used to inject water into the fracture in 5 cm intervals all along the fracture trace in the hole. The variation of the injection flowrates along the fracture were used to determine the transmissivity variations in the fracture plane. Detailed photographs were taken from inside the hole and the visual fracture aperture was compared with the injection flowrates in the same locations. Geostatistical methods were used to evaluate the results. Five holes were measured in great detail. In addition 7 holes were drilled and scanned by simpler packer systems. A double hole experiment was performed where two parallel holes were drilled in the same fracture plane at nearly 2 m distance. Pressure pulse tests were made between the holes in both directions. Tracers were injected in 5 locations in one hole and monitored for in many locations in the other hole. The single hole experiment and the double hole experiment show that most of the fracture planes are tight but that there are open sections which form connected channels over distances of at least 2 meters. It was also found in the double hole experiment that the investigated fracture was intersected by at least one fracture between the two holes which diverted a large amount of the injected tracers to several distant locations at the tunnel wall. (authours)

  8. Channeling Frustration

    Institute of Scientific and Technical Information of China (English)

    LiLi

    2013-01-01

    Transparency and inclusiveness should guide local governments to defuse NIMBY protests China's largest oil and natural gas producer Petro China published a report on the environmental impact assessment it submitted to the government for its controversial refinery in Kunming,capital of southwest China's Yunnan Province.According to

  9. Two-channel Optimal Quantum Teleportation

    OpenAIRE

    Quan, Quan; Fei, Shao-Ming; Fan, Heng; Yang, Wen-Li(Institute of Modern Physics, Northwest University, Xian, 710069, China)

    2015-01-01

    We investigate two-channel scenarios of optimal quantum teleportation based on Bell measurements and GHZ measurements. The detailed protocols are presented and the general expressions of the optimal teleportation fidelities are derived, which turn out to be functions of two-channel fully entangled fractions -- invariants under local unitary transformations. We prove that the set of states which are useful for two-channel teleportation is convex and compact. Hence witness operators exist to se...

  10. The Activation Effect of Hainantoxin-I, a Peptide Toxin from the Chinese Spider, Ornithoctonus hainana, on Intermediate-Conductance Ca2+-Activated K+ Channels

    Directory of Open Access Journals (Sweden)

    Pengfei Huang

    2014-08-01

    Full Text Available Intermediate-conductance Ca2+-activated K+ (IK channels are calcium/calmodulin-regulated voltage-independent K+ channels. Activation of IK currents is important in vessel and respiratory tissues, rendering the channels potential drug targets. A variety of small organic molecules have been synthesized and found to be potent activators of IK channels. However, the poor selectivity of these molecules limits their therapeutic value. Venom-derived peptides usually block their targets with high specificity. Therefore, we searched for novel peptide activators of IK channels by testing a series of toxins from spiders. Using electrophysiological experiments, we identified hainantoxin-I (HNTX-I as an IK-channel activator. HNTX-I has little effect on voltage-gated Na+ and Ca2+ channels from rat dorsal root ganglion neurons and on the heterologous expression of voltage-gated rapidly activating delayed rectifier K+ channels (human ether-à-go-go-related gene; human ERG in HEK293T cells. Only 35.2% ± 0.4% of the currents were activated in SK channels, and there was no effect on BK channels. We demonstrated that HNTX-I was not a phrenic nerve conduction blocker or acutely toxic. This is believed to be the first report of a peptide activator effect on IK channels. Our study suggests that the activity and selectivity of HNTX-I on IK channels make HNTX-I a promising template for designing new drugs for cardiovascular diseases.

  11. Regulated trafficking of the CFTR chloride channel

    NARCIS (Netherlands)

    Braakman, L.J.; Kleizen, B.; Jonge, H.R. de

    2000-01-01

    The cystic fibrosis transmembrane conductance regulator (CFTR), the ABC transporter encoded by the cystic fibrosis gene, is localized in the apical membrane of epithelial cells where it functions as a cyclic AMP-regulated chloride channel and as a regulator of other ion channels and transporters. Wh

  12. Activation of BK and SK channels by efferent synapses on outer hair cells in high-frequency regions of the rodent cochlea

    NARCIS (Netherlands)

    Rohmann, Kevin N; Wersinger, Eric; Braude, Jeremy P; Pyott, Sonja J; Fuchs, Paul Albert

    2015-01-01

    Cholinergic neurons of the brainstem olivary complex project to and inhibit outer hair cells (OHCs), refining acoustic sensitivity of the mammalian cochlea. In all vertebrate hair cells studied to date, cholinergic inhibition results from the combined action of ionotropic acetylcholine receptors and

  13. New localized excitations and cross-like fractal structures to the (2+1)-dimensional Broer–Kaup system

    Indian Academy of Sciences (India)

    Zitian Li

    2014-09-01

    A broad general variable separation solution with two arbitrary lower-dimensional functions of the (2+1)-dimensional Broer–Kaup (BK) equations was derived by means of a projective equation method and a variable separation hypothesis. Based on the derived variable separation excitation, some new special types of localized solutions such as oscillating solitons, instantonlike and cross-like fractal structures are revealed by selecting appropriate functions of the general variable separation solution.

  14. Massively parallel processor networks with optical express channels

    Science.gov (United States)

    Deri, R.J.; Brooks, E.D. III; Haigh, R.E.; DeGroot, A.J.

    1999-08-24

    An optical method for separating and routing local and express channel data comprises interconnecting the nodes in a network with fiber optic cables. A single fiber optic cable carries both express channel traffic and local channel traffic, e.g., in a massively parallel processor (MPP) network. Express channel traffic is placed on, or filtered from, the fiber optic cable at a light frequency or a color different from that of the local channel traffic. The express channel traffic is thus placed on a light carrier that skips over the local intermediate nodes one-by-one by reflecting off of selective mirrors placed at each local node. The local-channel-traffic light carriers pass through the selective mirrors and are not reflected. A single fiber optic cable can thus be threaded throughout a three-dimensional matrix of nodes with the x,y,z directions of propagation encoded by the color of the respective light carriers for both local and express channel traffic. Thus frequency division multiple access is used to hierarchically separate the local and express channels to eliminate the bucket brigade latencies that would otherwise result if the express traffic had to hop between every local node to reach its ultimate destination. 3 figs.

  15. Computed Tomography Findings of Human Polyomavirus BK (BKV)-Associated Cystitis in Allogeneic Hematopoietic Stem Cell Transplant Recipients

    Energy Technology Data Exchange (ETDEWEB)

    Schulze, M.; Beck, R.; Igney, A.; Vogel, M.; Maksimovic, O.; Claussen, C.D.; Faul, C.; Horger, M. (Dept. of Diagnostic Radiology, Dept. of Internal Medicine-Oncology, and Inst. of Medical Virology, Eberhard-Karls Univ., Tbingen (Germany))

    2008-12-15

    Background: Over 70% of the general population worldwide is positive for antibodies against polyomavirus hominis type 1 (BKV). Polyomavirus can be reactivated in immunocompromised patients and thereby induce urogenital tract infection, including cystitis. Purpose: To describe the computed tomography (CT) findings of human polyomavirus-induced cystitis in adult patients after allogeneic hematopoietic stem cell transplantation (allogeneic HCT). Material and Methods: The study population was a retrospective cohort of 11 consecutive adult patients (eight men, three women; age range 22-59 years, mean 42.9 years) who received allogeneic HCT between December 2003 and December 2007 and were tested positive for urinary BKV infection. All CT scans were evaluated with regard to bladder wall thickness, mucosal enhancement, distinct layering of thickened bladder wall, and presence of intravesical clots, perivesical stranding as well as attenuation values of intravesical urine. Clinical data concerning transplant and conditioning regimen variables and laboratory parameters were correlated with degree and extent of imaging findings. Results: All patients had clinical signs of cystitis with different degrees of thickening of the urinary bladder wall. Well-delineated urinary bladder layers were present in six patients. Thickening of the urinary bladder wall was continuous in nine of 11 patients. Increased attenuation of intravesical urine was found in seven patients with hemorrhagic cystitis. Four patients had intraluminal clots. Perivesical stranding was not a major CT finding, occurring in a mild fashion in three of 11 patients. The clinical classification of hemorrhagic cystitis did not correlate with the analyzed imaging parameters. Patient outcome was not influenced by this infectious complication. Conclusion: CT findings in patients with polyomavirus BK cystitis consist of different degrees of bladder wall thickening usually with good delineation of all mural layers and

  16. Computed Tomography Findings of Human Polyomavirus BK (BKV)-Associated Cystitis in Allogeneic Hematopoietic Stem Cell Transplant Recipients

    Energy Technology Data Exchange (ETDEWEB)

    Schulze, M.; Beck, R.; Igney, A.; Vogel, M.; Maksimovic, O.; Claussen, C.D.; Faul, C.; Horger, M. [Dept. of Diagnostic Radiology, Dept. of Internal Medicine-Oncology, and Inst. of Medical Virology, Eberhard-Karls Univ., Tbingen (Germany)

    2008-12-15

    Background: Over 70% of the general population worldwide is positive for antibodies against polyomavirus hominis type 1 (BKV). Polyomavirus can be reactivated in immunocompromised patients and thereby induce urogenital tract infection, including cystitis. Purpose: To describe the computed tomography (CT) findings of human polyomavirus-induced cystitis in adult patients after allogeneic hematopoietic stem cell transplantation (allogeneic HCT). Material and Methods: The study population was a retrospective cohort of 11 consecutive adult patients (eight men, three women; age range 22-59 years, mean 42.9 years) who received allogeneic HCT between December 2003 and December 2007 and were tested positive for urinary BKV infection. All CT scans were evaluated with regard to bladder wall thickness, mucosal enhancement, distinct layering of thickened bladder wall, and presence of intravesical clots, perivesical stranding as well as attenuation values of intravesical urine. Clinical data concerning transplant and conditioning regimen variables and laboratory parameters were correlated with degree and extent of imaging findings. Results: All patients had clinical signs of cystitis with different degrees of thickening of the urinary bladder wall. Well-delineated urinary bladder layers were present in six patients. Thickening of the urinary bladder wall was continuous in nine of 11 patients. Increased attenuation of intravesical urine was found in seven patients with hemorrhagic cystitis. Four patients had intraluminal clots. Perivesical stranding was not a major CT finding, occurring in a mild fashion in three of 11 patients. The clinical classification of hemorrhagic cystitis did not correlate with the analyzed imaging parameters. Patient outcome was not influenced by this infectious complication. Conclusion: CT findings in patients with polyomavirus BK cystitis consist of different degrees of bladder wall thickening usually with good delineation of all mural layers and

  17. Anisotropic flow in striped superhydrophobic channels

    CERN Document Server

    Zhou, Jiajia; Schmid, Friederike; Vinogradova, Olga I

    2012-01-01

    We report results of dissipative particle dynamics simulations and develop a semi-analytical theory and of an anisotropic flow in a parallel-plate channel with two superhydrophobic striped walls. Our approach is valid for any local slip at the gas sectors and an arbitrary distance between the plates, ranging from a thick to a thin channel. It allows us to optimize area fractions, slip lengths, channel thickness and texture orientation to maximize a transverse flow. Our results may be useful for extracting effective slip tensors from global measurements, such as the permeability of a channel, in experiments or simulations, and may also find applications in passive microfluidic mixing.

  18. Channel strategy adaptation

    OpenAIRE

    Rangan, V. Kasturi; Nueno, Jose L

    1999-01-01

    Using transaction cost theory, considerable research in marketing has focused on the conditions under which firms would use direct or vertically integrated versus indirect or arms length channels of distribution. Data from the field, however, indicate that channel configurations are more varied and complex, with multiple channels and composite channels being just as common as direct and indirect channels. In an attempt to explain this variety, this paper revisits the influence on channel stru...

  19. Impact of mTORC1 Inhibition on Keratinocyte Proliferation During Skin Tumor Promotion in Wild-Type and BK5.AktWT Mice

    OpenAIRE

    Rho, Okkyung; Kiguchi, Kaoru; Jiang, Guiyu; DiGiovanni, John

    2013-01-01

    In this study, we examined the impact of rapamycin on mTORC1 signaling during 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced keratinocyte proliferation and skin tumor promotion in both wild-type (FVB/N) and BK5.AktWT mice. TPA activated mTORC1 signaling in a time-dependent manner in cultured primary mouse keratinocytes and a mouse keratinocyte cell line. Early activation (15–30 min) of mTORC1 signaling induced by TPA was mediated in part by PKC activation, whereas later activation (2–4 h)...

  20. Information geometry of Gaussian channels

    CERN Document Server

    Monras, Alex

    2009-01-01

    We define a local Riemannian metric tensor in the manifold of Gaussian channels and the distance that it induces. We adopt an information-geometric approach and define a metric derived from the Bures-Fisher metric for quantum states. The resulting metric inherits several desirable properties from the Bures-Fisher metric and is operationally motivated from distinguishability considerations: It serves as an upper bound to the attainable quantum Fisher information for the channel parameters using Gaussian states, under some restriction on the available resources. We prove that optimal states are always pure and bounded in the number of ancillary modes that are needed. This has experimental and computational advantages: It limits the complexity of optimal experimental setups for channel estimation and reduces the computational requirements for the evaluation of the metric. Indeed, we construct a converging algorithm for computing the metric. We provide explicit formulae for computing the multiparametric quantum F...

  1. Effects of manipulating slowpoke calcium-dependent potassium channel expression on rhythmic locomotor activity in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Erin C. McKiernan

    2013-03-01

    Full Text Available Rhythmic motor behaviors are generated by networks of neurons. The sequence and timing of muscle contractions depends on both synaptic connections between neurons and the neurons’ intrinsic properties. In particular, motor neuron ion currents may contribute significantly to motor output. Large conductance Ca2+-dependent K+ (BK currents play a role in action potential repolarization, interspike interval, repetitive and burst firing, burst termination and interburst interval in neurons. Mutations in slowpoke (slo genes encoding BK channels result in motor disturbances. This study examined the effects of manipulating slo channel expression on rhythmic motor activity using Drosophila larva as a model system. Dual intracellular recordings from adjacent body wall muscles were made during spontaneous crawling-related activity in larvae expressing a slo mutation or a slo RNA interference construct. The incidence and duration of rhythmic activity in slo mutants were similar to wild-type control animals, while the timing of the motor pattern was altered. slo mutants showed decreased burst durations, cycle durations, and quiescence intervals, and increased duty cycles, relative to wild-type. Expressing slo RNAi in identified motor neurons phenocopied many of the effects observed in the mutant, including decreases in quiescence interval and cycle duration. Overall, these results show that altering slo expression in the whole larva, and specifically in motor neurons, changes the frequency of crawling activity. These results suggest an important role for motor neuron intrinsic properties in shaping the timing of motor output.

  2. VKCDB: Voltage-gated potassium channel database

    Directory of Open Access Journals (Sweden)

    Gallin Warren J

    2004-01-01

    Full Text Available Abstract Background The family of voltage-gated potassium channels comprises a functionally diverse group of membrane proteins. They help maintain and regulate the potassium ion-based component of the membrane potential and are thus central to many critical physiological processes. VKCDB (Voltage-gated potassium [K] Channel DataBase is a database of structural and functional data on these channels. It is designed as a resource for research on the molecular basis of voltage-gated potassium channel function. Description Voltage-gated potassium channel sequences were identified by using BLASTP to search GENBANK and SWISSPROT. Annotations for all voltage-gated potassium channels were selectively parsed and integrated into VKCDB. Electrophysiological and pharmacological data for the channels were collected from published journal articles. Transmembrane domain predictions by TMHMM and PHD are included for each VKCDB entry. Multiple sequence alignments of conserved domains of channels of the four Kv families and the KCNQ family are also included. Currently VKCDB contains 346 channel entries. It can be browsed and searched using a set of functionally relevant categories. Protein sequences can also be searched using a local BLAST engine. Conclusions VKCDB is a resource for comparative studies of voltage-gated potassium channels. The methods used to construct VKCDB are general; they can be used to create specialized databases for other protein families. VKCDB is accessible at http://vkcdb.biology.ualberta.ca.

  3. Vascular potassium channels in NVC.

    Science.gov (United States)

    Yamada, K

    2016-01-01

    It has long been proposed that the external potassium ion ([K(+)]0) works as a potent vasodilator in the dynamic regulation of local cerebral blood flow. Astrocytes may play a central role for producing K(+) outflow possibly through calcium-activated potassium channels on the end feet, responding to a rise in the intracellular Ca(2+) concentration, which might well reflect local neuronal activity. A mild elevation of [K(+)]0 in the end feet/vascular smooth muscle space could activate Na(+)/K(+)-ATPase concomitant with inwardly rectifying potassium (Kir) channels in vascular smooth muscle cells, leading to a hyperpolarization of vascular smooth muscle and relaxation of smooth muscle actin-positive vessels. Also proposed notion is endothelial calcium-activated potassium channels and/or inwardly rectifying potassium channel-mediated hyperpolarization of vascular smooth muscle. A larger elevation of [K(+)]0, which may occur pathophysiologically in such as spreading depression or stroke, can trigger a depolarization of vascular smooth muscle cells and vasoconstriction instead. PMID:27130411

  4. Mobile radio channels

    CERN Document Server

    Pätzold, Matthias

    2011-01-01

    Providing a comprehensive overview of the modelling, analysis and simulation of mobile radio channels, this book gives a detailed understanding of fundamental issues and examines state-of-the-art techniques in mobile radio channel modelling. It analyses several mobile fading channels, including terrestrial and satellite flat-fading channels, various types of wideband channels and advanced MIMO channels, providing a fundamental understanding of the issues currently being investigated in the field. Important classes of narrowband, wideband, and space-time wireless channels are explored in deta

  5. Co-Localization of Sodium Channel Na[v]1.6 and the Sodium--Calcium Exchanger at Sites of Axonal Injury in the Spinal Cord in EAE

    Science.gov (United States)

    Craner, Matthew J.; Hains, Bryan C.; Lo, Albert C.; Black, Joel A.; Waxman, Stephen G.

    2004-01-01

    Axonal degeneration contributes to the development of non-remitting neurological deficits and disability in multiple sclerosis, but the molecular mechanisms that underlie axonal loss in multiple sclerosis are not clearly understood. Studies of white matter axonal injury have demonstrated that voltage-gated sodium channels can provide a route for…

  6. Experimental investigation of the effect of variously-shaped ribs on local heat transfer on the outer wall of the turning portion of a U-channel inside solar air heater

    Science.gov (United States)

    Salameh, Tareq; Alami, Abdul Hai; Sunden, Bengt

    2016-03-01

    In the present work, an experimental investigation of convective heat transfer and pressure drop was carried out for the turning portion of a U-channel where the outer wall was equipped with ribs. The shape of the ribs was varied. The investigation aims to give guidelines for improving the thermo-hydraulic performance of a solar air heater at the turning portion of a U-channel. Both the U-channel and the ribs were made in acrylic material to allow optical access for measuring the surface temperature by using a high-resolution technique based on narrow band thermochromic liquid crystals (TLC R35C5 W) and a CCD camera placed to face the turning portion of the U-channel. The uncertainties were estimated to 5 and 7 % for the Nusselt number and friction factor, respectively. The pressure drop was approximately the same for all the considered shapes of the ribs while the dimpled rib case gave the highest heat transfer coefficient while the grooved rib presented the highest performance index.

  7. Role of BK virus infection in end-stage renal disease patients waiting for kidney transplantation--viral replication dynamics from pre- to post-transplant.

    Science.gov (United States)

    Mitterhofer, Anna Paola; Tinti, Francesca; Pietropaolo, Valeria; Umbro, Ilaria; Anzivino, Elena; Bellizzi, Anna; Zavatto, Assunta; Poli, Luca; Berloco, Pasquale Bartolomeo; Taliani, Gloria

    2014-03-01

    We report the prevalence of BK virus (BKV) infection before renal transplantation and the dynamics of BKV viremia from pre- to post-transplantation. We assessed 60 kidney transplanted patients from a single cohort in Italy, treated with identical immunosuppressive therapy, for BK viremia at pre-transplantation, 12 h, and three and six months post-transplantation. Polymerase chain reaction showed that the prevalence of plasma BKV replication--considered a marker of infection--was 20% in pre-transplant patients. All pre-transplant-positive patients remained positive post-transplant, whereas the majority of pre-transplant-negative patients remained negative. Viremia dynamics classification revealed three clusters of patients: Cluster A++, pre-transplant-positive patients (20%) who tested positive at least once post-transplant; Cluster B-+, pre-transplant-negative patients (28%) who tested positive at least once post-transplant; and Cluster C- -, pre-transplant-negative patients (52%) who remained negative throughout. These clusters presented significant differences related to the prevalence of substantially positive patients with high plasma viral load (>10(3) copies/mL) in cluster A, but not in donors' or grafts' characteristics. We suggest that pre-transplant viral status should be considered as an additional risk factor for post-transplant BKV replication. Therefore, pre-transplant BKV infection screening in kidney transplant patients should be performed for improving planning of personalized immunosuppressant schemes and specific post-transplant surveillance.

  8. Immunogenicity and protection from malaria infection in BK-SE36 vaccinated volunteers in Uganda is not influenced by HLA-DRB1 alleles.

    Science.gov (United States)

    Tougan, Takahiro; Ito, Kazuya; Palacpac, Nirianne Marie Q; Egwang, Thomas G; Horii, Toshihiro

    2016-10-01

    SE36 antigen, derived from serine repeat antigen 5 (SERA5) of Plasmodium falciparum, is a promising blood stage malaria vaccine candidate. Designated as BK-SE36, the SE36 antigen was formulated with aluminum hydroxyl gel (AHG) and produced under Good Manufacturing Practice (GMP) constraints. In a Phase Ib clinical trial and follow-up study in Uganda, the risk for malaria symptoms was reduced by 72% compared with the control group. Although promising, the number of responders to the vaccine in 6-20years-olds was approximately 30% with the majority in the younger cohort. This is in contrast to the phase Ia clinical trial where response to the vaccine was 100% in Japanese malaria naive adults. A consideration that can be of importance is the involvement of host genetic factors that may influence the ability to mount an effective immune response to vaccination as well as susceptibility to malaria infection. We, therefore, analyzed allelic polymorphism of human leukocyte antigen (HLA)-DRB1 alleles using sequence-based typing (SBT). In this study, DRB1 alleles did not influence antibody response to BK-SE36 and the vaccinees susceptibility to clinical malaria. PMID:27343834

  9. High prevalence of the simultaneous excretion of polyomaviruses JC and BK in the urine of HIV-infected patients without neurological symptoms in São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz Henrique da Silva Nali

    2012-08-01

    Full Text Available OBJECTIVE: To evaluate the prevalence of the urinary excretion of BKV and JCV in HIV-infected patients without neurological symptoms. METHODS: Urine samples from HIV-infected patients without neurological symptoms were tested for JC virus and BK virus by PCR. Samples were screened for the presence of polyomavirus with sets of primers complementary to the early region of JCV and BKV genome (AgT. The presence of JC virus or BK virus were confirmed by two other PCR assays using sets of primers complementary to the VP1 gene of each virus. Analysis of the data was performed by the Kruskal-Wallis test for numerical data and Pearson or Yates for categorical variables. RESULTS: A total of 75 patients were included in the study. The overall prevalence of polyomavirus DNA urinary shedding was 67/75 (89.3%. Only BKV DNA was detected in 14/75 (18.7% urine samples, and only JCV DNA was detected in 11/75 (14.7% samples. Both BKV and JCV DNA were present in 42/75 (56.0% samples. CONCLUSION: In this study we found high rates of excretion of JCV, BKV, and simultaneous excretion in HIV+ patients. Also these results differ from the others available on the literature.

  10. Channel nut tool

    Energy Technology Data Exchange (ETDEWEB)

    Olson, Marvin

    2016-01-12

    A method, system, and apparatus for installing channel nuts includes a shank, a handle formed on a first end of a shank, and an end piece with a threaded shaft configured to receive a channel nut formed on the second end of the shaft. The tool can be used to insert or remove a channel nut in a channel framing system and then removed from the channel nut.

  11. Extracellular quaternary ammonium blockade of transient receptor potential vanilloid subtype 1 channels expressed in Xenopus laevis oocytes

    DEFF Research Database (Denmark)

    Rivera-Acevedo, Ricardo E; Pless, Stephan Alexander; Schwarz, Stephan K W;

    2012-01-01

    Transient receptor potential vanilloid subtype 1 (TRPV1) channels are essential nociceptive integrators in primary afferent neurons. These nonselective cation channels are inhibited by local anesthetic compounds through an undefined mechanism. Here, we show that lidocaine inhibits TRPV1 channels ...

  12. Anestésicos locais: interação com membranas biológicas e com o canal de sódio voltagem-dependente Local anesthetics: interaction with biological membranes and with the voltage-gated sodium channel

    Directory of Open Access Journals (Sweden)

    Daniele Ribeiro de Araujo

    2008-01-01

    Full Text Available Many theories about the mechanism of action of local anesthetics (LA are described in the literature. Two types of theories can be distinguished: those that focus on the direct effects of LA on their target protein in the axon membranes, i.e. the voltage-gated sodium channel and the ones that take into account the interaction of anesthetic molecules with the lipid membrane phase for the reversible nerve blockage. Since there is a direct correlation between LA hydrophobicity and potency, it is crucial to take this physico-chemical property into account to understand the mechanism of action of LA, be it on the sodium channel protein, lipid(s, or on the whole membrane phase.

  13. Pore dimensions and the role of occupancy in unitary conductance of Shaker K channels

    Science.gov (United States)

    Díaz-Franulic, Ignacio; Sepúlveda, Romina V.; Navarro-Quezada, Nieves; González-Nilo, Fernando

    2015-01-01

    conductance of the large conductance K (BK) channel (the K channel of highest conductance), reducing the energy gap between their K+ transport rates to ∼1 kT. Thus, although Shaker’s pore sustains ion translocation as the BK channel’s does, higher energetic costs of ion stabilization or higher friction with the ion’s rigid hydration cage in its narrower aqueous cavity may entail higher resistance. PMID:26216859

  14. River channel adjustments in Southern Italy over the past 150 years and implications for channel recovery

    Science.gov (United States)

    Scorpio, Vittoria; Aucelli, Pietro P. C.; Giano, Salvatore I.; Pisano, Luca; Robustelli, Gaetano; Rosskopf, Carmen M.; Schiattarella, Marcello

    2015-12-01

    Multi-temporal GIS analysis of topographic maps and aerial photographs along with topographic and geomorphological surveys are used to assess evolutionary trends and key control factors of channel adjustments for five major rivers in southern Italy (the Trigno, Biferno, Volturno, Sinni and Crati rivers) to support assessment of channel recovery and river restoration. Three distinct phases of channel adjustment are identified over the past 150 years primarily driven by human disturbances. Firstly, slight channel widening dominated from the last decades of the nineteenth century to the 1950s. Secondly, from the 1950s to the end of the 1990s, altered sediment fluxes induced by in-channel mining and channel works brought about moderate to very intense incision (up to 6-7 m) accompanied by strong channel narrowing (up to 96%) and changes in channel configuration from multi-threaded to single-threaded patterns. Thirdly, the period from around 2000 to 2015 has been characterized by channel stabilization and local widening. Evolutionary trajectories of the rivers studied are quite similar to those reconstructed for other Italian rivers, particularly regarding the second phase of channel adjustments and ongoing transitions towards channel recovery in some reaches. Analyses of river dynamics, recovery potential and connectivity with sediment sources of the study reaches, framed in their catchment context, can be used as part of a wider interdisciplinary approach that views effective river restoration alongside sustainable and risk-reduced river management.

  15. The Earliest Ion Channels

    Science.gov (United States)

    Pohorille, A.; Wilson, M. A.; Wei, C.

    2009-12-01

    Supplying protocells with ions required assistance from channels spanning their membrane walls. The earliest channels were most likely short proteins that formed transmembrane helical bundles surrounding a water-filled pore. These simple aggregates were capable of transporting ions with efficiencies comparable to those of complex, contemporary ion channels. Channels with wide pores exhibited little ion selectivity but also imposed only modest constraints on amino acid sequences of channel-forming proteins. Channels with small pores could have been selective but also might have required a more precisely defined sequence of amino acids. In contrast to modern channels, their protocellular ancestors had only limited capabilities to regulate ion flux. It is postulated that subsequent evolution of ion channels progressed primarily to acquire precise regulation, and not high efficiency or selectivity. It is further proposed that channels and the surrounding membranes co-evolved.

  16. Gramicidin Channels: Versatile Tools

    Science.gov (United States)

    Andersen, Olaf S.; Koeppe, Roger E., II; Roux, Benoît

    Gramicidin channels are miniproteins in which two tryptophan-rich subunits associate by means of transbilayer dimerization to form the conducting channels. That is, in contrast to other ion channels, gramicidin channels do not open and close; they appear and disappear. Each subunit in the bilayer-spanning channel is tied to the bilayer/solution interface through hydrogen bonds that involve the indole NH groups as donors andwater or the phospholipid backbone as acceptors. The channel's permeability characteristics are well-defined: gramicidin channels are selective for monovalent cations, with no measurable permeability to anions or polyvalent cations; ions and water move through a pore whose wall is formed by the peptide backbone; and the single-channel conductance and cation selectivity vary when the amino acid sequence is varied, even though the permeating ions make no contact with the amino acid side chains. Given the plethora of available experimental information—for not only the wild-type channels but also for channels formed by amino acid-substituted gramicidin analogues—gramicidin channels continue to provide important insights into the microphysics of ion permeation through bilayer-spanning channels. For similar reasons, gramicidin channels constitute a system of choice for evaluating computational strategies for obtaining mechanistic insights into ion permeation through the more complex channels formed by integral membrane proteins.

  17. Multi-Channel Retailing

    Directory of Open Access Journals (Sweden)

    Dirk Morschett, Dr.,

    2005-01-01

    Full Text Available Multi-channel retailing entails the parallel use by retailing enterprises of several sales channels. The results of an online buyer survey which has been conducted to investigate the impact of multi-channel retailing (i.e. the use of several retail channels by one retail company on consumer behaviour show that the frequently expressed concern that the application of multi-channel systems in retailing would be associated with cannibalization effects, has proven unfounded. Indeed, the appropriate degree of similarity, consistency, integration and agreement achieves the exact opposite. Different channels create different advantages for consumers. Therefore the total benefit an enterprise which has a multi-channel system can offer to its consumers is larger, the greater the number of available channels. The use of multi-channel systems is associated with additional purchases in the different channels. Such systems are thus superior to those offering only one sales channel to their customers. Furthermore, multi-channel systems with integrated channels are superior to those in which the channels are essentially autonomous and independent of one another. In integrated systems, consumers can achieve synergy effects in the use of sales-channel systems. Accordingly, when appropriately formulated, multi-channel systems in retailing impact positively on consumers. They use the channels more frequently, buy more from them and there is a positive customer-loyalty impact. Multi-channel systems are strategic options for achieving customer loyalty, exploiting customer potential and for winning new customers. They are thus well suited for approaching differing and varied target groups.

  18. Channel Norm-Based User Scheduling Exploiting Channel Asymmetry in Base Station Cooperative Transmission Systems

    CERN Document Server

    Han, Shengqian; Bengtsson, Mats

    2010-01-01

    Base station cooperative transmission, which is also known as coordinated multi-point (CoMP) transmission, is a promising technique to improve spectrum efficiency in future cellular systems. However, they need large signalling overhead to gather the channel information. In this paper, we consider low feedback user scheduling in downlink coherent CoMP systems exploiting their inherent channel asymmetry. Through the analysis of the statistics of the angle between channel vectors and the tightness of a lower bound of the orthogonally projected norm, we show that channel norm provides sufficient information to judge the orthogonality among users in asymmetric channels. Based on this observation, we propose a channel norm-based user scheduler (NUS), a local channel aided NUS (LocalNUS) and a large-scale fading-based user scheduler (LUS). Simulation results show that the LocalNUS performs very close to the existing greedy user scheduler (GUS) and semi-orthogonal user scheduler (SUS) with full channel state informat...

  19. The Research Progress of BK Virus Infection After Renal Transplantation%肾移植术后BK病毒感染研究进展

    Institute of Scientific and Technical Information of China (English)

    范宇(综述); 石炳毅; 钱叶勇(审校)

    2014-01-01

    BK病毒是一种隶属于多瘤病毒种属的DNA病毒,在正常人群中的感染率高达90%。然而,仅在免疫功能受损的个体中引发相关疾病,以接受移植手术后服用免疫抑制药物的患者最为显著。 BK病毒的持续复制被认为是导致肾移植受者移植肾功能受损的重要因素,而由其引发的BK病毒性肾病( BKVN)则已成为肾移植失败的重要原因之一。应用尿细胞学染色和检测尿液或血液中BK病毒DNA载量等方法可对BK病毒感染和BKVN进行监测并早期诊断,增加了早期治疗的成功率。然而,由于缺乏特异性的抗病毒药物,BKVN的治疗仍然是非常困难。该文即针对肾移植术后BK病毒感染的流行病学、发病机制、实验室检测方法以及治疗策略的研究予以综述。%The BK virus,a DNA virus from the polyomavirus group,infects up to 90% of the general population. However,significant clinical manifestations are rare and limited to individuals with impaired im-mune functions,especially in the renal transplant recipients who recepted immunosuppressor. Persistent BK virus replication in patients with renal allografts was identified as an important cause of progressive graft dys-function,and the BK virus nephritis ( BKVN) has emerged as an important cause of renal transplant failure. Diagnostic strategies using urine cytology and BKV load measurements in urine or plasma have led to earlier diagnosis of BKV infection and BKVN,which increased the success rate of intervention. But due to the lack of specific antiviral drugs,the treatment of BKVN is difficult. In this review,we discuss the epidemiology,patho-genesis,detction method and current treatment protocols.

  20. Calcium channel blocker overdose

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/002580.htm Calcium channel blocker overdose To use the sharing features on this page, please enable JavaScript. Calcium channel blockers are a type of medicine used ...

  1. Dynamic channel allocation

    OpenAIRE

    Kaminsky, Andrew D.

    2003-01-01

    Approved for public release; distribution in unlimited. Dynamic Channel Allocation (DCA) offers the possibility of capturing unused channel capacity by allocating unused resources between competing network nodes. This can reduce or possibly eliminate channels sitting idle while information awaits transmission. This holds potential for increasing throughput on bandwidth constrained networks. The purpose of this thesis is to examine the techniques used to allocate channels on demand and acc...

  2. Desynched channels on IRCnet

    CERN Document Server

    Hansen, Michael

    2008-01-01

    In this paper we describe what a desynchronised channel on IRC is. We give procedures on how to create such a channel and how to remove desynchronisation. We explain which types of desynchronisation there are, what properties desynchronised channels have, and which properties can be exploited.

  3. Quantum Binary Symmetric Channels

    Institute of Scientific and Technical Information of China (English)

    陈小余; 仇佩亮

    2001-01-01

    Quantum binary symmetric channels are defined via the invariance of fidelity under unitary transformations ofthe input density operators. In this definition, they not only include the most studied case of the depolarizingchannel but also other channels. We investigate the character of the latter and find the maximum of the coherentinformation to estimate the capacities of the channels.

  4. Quantum Multiple Access Channel

    Institute of Scientific and Technical Information of China (English)

    侯广; 黄民信; 张永德

    2002-01-01

    We consider the transmission of classical information over a quantum channel by many senders, which is a generalization of the two-sender case. The channel capacity region is shown to be a convex hull bound by the yon Neumann entropy and the conditional yon Neumann entropies. The result allows a reasonable distribution of channel capacity over the senders.

  5. Cardiac potassium channel subtypes

    DEFF Research Database (Denmark)

    Schmitt, Nicole; Grunnet, Morten; Olesen, Søren-Peter

    2014-01-01

    About 10 distinct potassium channels in the heart are involved in shaping the action potential. Some of the K(+) channels are primarily responsible for early repolarization, whereas others drive late repolarization and still others are open throughout the cardiac cycle. Three main K(+) channels...

  6. KV7 potassium channels

    DEFF Research Database (Denmark)

    Stott, Jennifer B; Jepps, Thomas Andrew; Greenwood, Iain A

    2014-01-01

    Potassium channels are key regulators of smooth muscle tone, with increases in activity resulting in hyperpolarisation of the cell membrane, which acts to oppose vasoconstriction. Several potassium channels exist within smooth muscle, but the KV7 family of voltage-gated potassium channels have been...

  7. Observation of a resonance-like structure in the pi^+- psi' mass distribution in exclusive B-->K pi^+- psi' decays

    CERN Document Server

    Abe, K; Aihara, H; Arinstein, K; Aso, T; Aulchenko, V; Aushev, T; Aziz, T; Bahinipati, S; Bakich, A M; Balagura, V; Ban, Y; Banerjee, S; Barberio, E; Bay, A; Bedny, I; Belous, K S; Bhardwaj, V; Bitenc, U; Blyth, S; Bondar, A; Bozek, A; Bracko, M; Brodzicka, J; Browder, T E; Chang, M C; Chang, P; Chao, Y; Chen, A; Chen, K F; Chen, W T; Cheon, B G; Chiang, C C; Chistov, R; Cho, I S; Choi, S K; Choi, Y; Choi, Y K; Cole, S; Dalseno, J; Danilov, M; Das, A; Dash, M; Dragic, J; Drutskoy, A; Eidelman, S; Epifanov, D; Fratina, S; Fujii, H; Fujikawa, M; Gabyshev, N; Garmash, A; Go, A; Gokhroo, G; Goldenzweig, P; Golob, B; Grosse-Perdekamp, M; Guler, H; Ha, H; Haba, J; Hara, K; Hara, T; Hasegawa, Y; Hastings, N C; Hayasaka, K; Hayashii, H; Hazumi, M; Heffernan, D; Higuchi, T; Hinz, L; Hoedlmoser, H; Hokuue, T; Horii, Y; Hoshi, Y; Hoshina, K; Hou, S; Hou, W S; Hsiung, Y B; Hyun, H J; Igarashi, Y; Iijima, T; Ikado, K; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Jacoby, C; Joshi, N J; Kaga, M; Kah, D H; Kaji, H; Kajiwara, S; Kakuno, H; Kang, J H; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, H; Kawasaki, T; Kibayashi, A; Kichimi, H; Kim, H J; Kim, H O; Kim, J H; Kim, S K; Kim, Y J; Kinoshita, K; Korpar, S; Kozakai, Y; Krizan, P; Krokovny, P; Kumar, R; Kurihara, E; Kusaka, A; Kuzmin, A; Kwon, Y J; Lange, J S; Leder, G; Lee, J; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Li, J; Limosani, A; Lin, S W; Liu, Y; Liventsev, D; MacNaughton, J; Majumder, G; Mandl, F; Marlow, D; Matsumura, T; Matyja, A; McOnie, S; Medvedeva, T; Mikami, Y; Mitaroff, W A; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Moloney, G R; Mori, T; Müller, J; Murakami, A; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakano, E; Nakao, M; Nakayama, H; Nakazawa, H; Natkaniec, Z; Neichi, K; Nishida, S; Nishimura, K; Nishio, Y; Nishizawa, I; Nitoh, O; Noguchi, S; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, S; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, C W; Park, H; Park, K S; Parslow, N; Peak, L S; Pernicka, M; Pestotnik, R; Peters, M; Piilonen, L E; Poluektov, A; Rorie, J; Rózanska, M; Sahoo, H; Sakai, Y; Sakamoto, H; Sakaue, H; Sarangi, T R; Satoyama, N; Sayeed, K; Schietinger, T; Schneider, O; Schonmeier, P; Schümann, J; Schwanda, C; Schwartz, A J; Seidl, R; Sekiya, A; Senyo, K; Sevior, M E; Shang, L; Shapkin, M; Shen, C P; Shibuya, H; Shinomiya, S; Shiu, J G; Shwartz, B; Singh, J B; Sokolov, A; Solovieva, E; Somov, A; Stanic, S; Staric, M; Stypula, J; Sugiyama, A; Sumisawa, K; Sumiyoshi, T; Suzuki, S; Suzuki, S Y; Tajima, O; Takasaki, F; Tamai, K; Tamura, N; Tanaka, M; Taniguchi, N; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tse, Y F; Tsuboyama, T; Uchida, K; Uchida, Y; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Yu; Varner, G; Varvell, K E; Vervink, K; Villa, S; Vinokurova, A; Wang, C C; Wang, C H; Wang, J; Wang, M Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wicht, J; Widhalm, L; Wiechczynski, J; Won, E; Yabsley, B D; Yamaguchi, A; Yamamoto, H; Yamaoka, M; Yamashita, Y; Yamauchi, M; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A; Zwahlen, N

    2007-01-01

    A distinct peak is observed in the pi^+/- psi' invariant mass distribution near 4.43 GeV in B->K pi^+/- psi' decays. A fit using a Breit Wigner resonance shape yields a peak mass and width of 4433+-4(stat)+-1(syst) MeV and Gamma = 44^+17_-13(stat) ^+30_-11 MeV. The product branching fraction is determined to be Bf(B-->KZ(4430))xBf(Z(4430)-->pi^+psi') = (4.1+-1.0(stat)+-1.3(syst))x10^{-5), where Z(4430) is used to designate the observed structure. The statistical significance of the observed peak is greater than 7sigma. These results are obtained from a 605 fb-1 data sample that contains 657 million BBbar pairs collected near the Upsilon(4S) resonance with the Belle detector at the KEKB asymmetric energy e+e- collider.

  8. Transformation of primary human embryonic kidney cells to anchorage independence by a combination of BK virus DNA and the Harvey-ras oncogene

    International Nuclear Information System (INIS)

    Primary human embryonic kidney (HEK) cells were transformed by a focus assay with BK virus (BKV) DNA molecularly cloned at its unique EcoRI site. Both viral DNA sequences and viral tumor antigens were present and expressed in all the foci that the authors examined. However, cells isolated from foci were incapable of growth in soft agar. They then examined the transformation of HEK cells after their transfection with a combination of BKV DNA and either the normal or the activated form of the human Ha-ras oncogene (EJ c-Ha-ras-1). Only the cells transfected with a combination of BKV DNA and the activated form of Ha-ras DNAs were present in the transformed colonies. BKV tumor antigens and the Ha-ras p21 protein were also expressed

  9. On 1-qubit channels

    OpenAIRE

    Uhlmann, Armin

    2000-01-01

    The entropy H_T(rho) of a state rho with respect to a channel T and the Holevo capacity of the channel require the solution of difficult variational problems. For a class of 1-qubit channels, which contains all the extremal ones, the problem can be significantly simplified by associating an Hermitian antilinear operator theta to every channel of the considered class. The concurrence of the channel can be expressed by theta and turns out to be a flat roof. This allows to write down an explicit...

  10. On 1-qubit channels

    CERN Document Server

    Uhlmann, A

    2001-01-01

    The entropy H_T(rho) of a state rho with respect to a channel T and the Holevo capacity of the channel require the solution of difficult variational problems. For a class of 1-qubit channels, which contains all the extremal ones, the problem can be significantly simplified by associating an Hermitian antilinear operator theta to every channel of the considered class. The concurrence of the channel can be expressed by theta and turns out to be a flat roof. This allows to write down an explicit expression for H_T. Its maximum would give the Holevo (1-shot) capacity.

  11. Source and Channel Coding for Correlated Sources Over Multiuser Channels

    OpenAIRE

    Gunduz, Deniz; Erkip, Elza; Goldsmith, Andrea; Poor, H. Vincent

    2008-01-01

    Source and channel coding over multiuser channels in which receivers have access to correlated source side information is considered. For several multiuser channel models necessary and sufficient conditions for optimal separation of the source and channel codes are obtained. In particular, the multiple access channel, the compound multiple access channel, the interference channel and the two-way channel with correlated sources and correlated receiver side information are considered, and the o...

  12. C. elegans TRP channels.

    Science.gov (United States)

    Xiao, Rui; Xu, X Z Shawn

    2011-01-01

    Transient receptor potential (TRP) channels represent a superfamily of cation channels found in all eukaryotes. The C. elegans genome encodes seventeen TRP channels covering all of the seven TRP subfamilies. Genetic analyses in C. elegans have implicated TRP channels in a wide spectrum of behavioral and physiological processes, ranging from sensory transduction (e.g. chemosensation, touch sensation, proprioception and osmosensation) to fertilization, drug dependence, organelle biogenesis, apoptosis, gene expression, and neurotransmitter/hormone release. Many C. elegans TRP channels share similar activation and regulatory mechanisms with their vertebrate counterparts. Studies in C. elegans have also revealed some previously unrecognized functions and regulatory mechanisms of TRP channels. C. elegans represents an excellent genetic model organism for the study of function and regulation of TRP channels in vivo. PMID:21290304

  13. Geometric pumping in autophoretic channels

    Science.gov (United States)

    Michelin, Sebastien; Montenegro Johnson, Thomas; de Canio, Gabriele; Lobatto-Dauzier, Nicolas; Lauga, Eric

    2015-11-01

    Pumping at the microscale has important applications from biological fluid handling to lab-on-a-chip systems. It can be achieved either from a global (e.g. imposed pressure gradient) or local forcing (e.g. ciliary pumping). Phoretic slip flows generated from concentration or temperature gradients are examples of such local flow forcing. Autophoresis is currently receiving much attention for the design of self-propelled particles achieving force- and torque-free locomotion by combining two essential surface properties: (i) an activity that modifies the solute content of the particle's environment (e.g. catalytic reaction or solute release), and (ii) a mobility that generates a slip flow from the resulting local concentration gradients. Recent work showed that geometric asymmetry is sufficient for a chemically-homogeneous particle to self-propel. Here we extend this idea to micro-pumping in active channels whose walls possess both chemical activity and phoretic mobility. Using a combination of theoretical analysis and numerical simulations, we show that geometrically-asymmetric but chemically-homogeneous channels can generate pumping and analyze the resulting flow patterns.

  14. BK Virus-Hemorrhagic Cystitis Following Allogeneic Stem Cell Transplantation: Clinical Characteristics and Utility of Leflunomide Treatment

    Directory of Open Access Journals (Sweden)

    Young Hoon Park

    2016-08-01

    Full Text Available Objective: BK virus-hemorrhagic cystitis (BKV-HC is a potential cause of morbidity and mortality in patients having undergone allogeneic stem cell transplantation (Allo-SCT. We analyzed the clinical features of BKV-HC following Allo-SCT and reported the utility of leflunomide therapy for BKV-HC. Materials and methods: From January 2005 to June 2014, among the 69 patients underwent Allo-SCT in our institution, the patients who experienced BKV-HC were investigated retrospectively. Results: Hemorrhagic cystitis (HC was observed in 30 patients (43.5%, and among them, 18 patients (26.1% were identified as BKV-HC. The median age of the patients (12 males and 6 females was 45 years (range, 13-63. Patients received Allo-SCT from acute myeloid leukemia (n=11, aplastic anemia (n=4, myelodysplastic syndrome (n=2, and non-Hodgkin lymphoma (n=1.The donor types were a HLA-matched sibling donor for 6 patients, HLA-matched unrelated donor for 9, and a haploidentical familial donor for 2. The median onset and duration of BKV-HC was on day 21 (range, 7-97 after transplantation and 22 days (range, 6-107. Eleven patients (62.1% had grade I-II HC and seven patients (38.9% had grade III-IV (high-grade HC. Among the seven patients who had high-grade HC, one had complete response (CR, one partial response (PR, and five no response (NR. Among the five non-responders, one died of BKV-HC associated complications. The remaining four patients were treated with leflunomide, with achieving CR (n=2 and PR (n=2. The median duration from the start of leflunomide therapy to response was 13 days (range, 8–17 days. All patients tolerated the leflunomide treatment well, with three patients having mild gastrointestinal symptoms, including anorexia and abdominal bloating. Conclusion: BKV-HC was commonly observed in patients with HC following Allo-SCT. In high-grade BKV-HC patients who fail supportive care, leflunomide may be a feasible option without significant toxicity. Materials

  15. Compound Wiretap Channels

    Directory of Open Access Journals (Sweden)

    Kramer Gerhard

    2009-01-01

    Full Text Available Abstract This paper considers the compound wiretap channel, which generalizes Wyner's wiretap model to allow the channels to the (legitimate receiver and to the eavesdropper to take a number of possible states. No matter which states occur, the transmitter guarantees that the receiver decodes its message and that the eavesdropper is kept in full ignorance about the message. The compound wiretap channel can also be viewed as a multicast channel with multiple eavesdroppers, in which the transmitter sends information to all receivers and keeps the information secret from all eavesdroppers. For the discrete memoryless channel, lower and upper bounds on the secrecy capacity are derived. The secrecy capacity is established for the degraded channel and the semideterministic channel with one receiver. The parallel Gaussian channel is further studied. The secrecy capacity and the secrecy degree of freedom ( are derived for the degraded case with one receiver. Schemes to achieve the for the case with two receivers and two eavesdroppers are constructed to demonstrate the necessity of a prefix channel in encoder design. Finally, the multi-antenna (i.e., MIMO compound wiretap channel is studied. The secrecy capacity is established for the degraded case and an achievable is given for the general case.

  16. Compound Wiretap Channels

    Directory of Open Access Journals (Sweden)

    Shlomo Shamai (Shitz

    2009-01-01

    Full Text Available This paper considers the compound wiretap channel, which generalizes Wyner's wiretap model to allow the channels to the (legitimate receiver and to the eavesdropper to take a number of possible states. No matter which states occur, the transmitter guarantees that the receiver decodes its message and that the eavesdropper is kept in full ignorance about the message. The compound wiretap channel can also be viewed as a multicast channel with multiple eavesdroppers, in which the transmitter sends information to all receivers and keeps the information secret from all eavesdroppers. For the discrete memoryless channel, lower and upper bounds on the secrecy capacity are derived. The secrecy capacity is established for the degraded channel and the semideterministic channel with one receiver. The parallel Gaussian channel is further studied. The secrecy capacity and the secrecy degree of freedom (s.d.o.f. are derived for the degraded case with one receiver. Schemes to achieve the s.d.o.f. for the case with two receivers and two eavesdroppers are constructed to demonstrate the necessity of a prefix channel in encoder design. Finally, the multi-antenna (i.e., MIMO compound wiretap channel is studied. The secrecy capacity is established for the degraded case and an achievable s.d.o.f. is given for the general case.

  17. Activation of TRPV1 channels inhibits mechanosensitive Piezo channel activity by depleting membrane phosphoinositides.

    Science.gov (United States)

    Borbiro, Istvan; Badheka, Doreen; Rohacs, Tibor

    2015-02-10

    Capsaicin is an activator of the heat-sensitive TRPV1 (transient receptor potential vanilloid 1) ion channels and has been used as a local analgesic. We found that activation of TRPV1 channels with capsaicin either in dorsal root ganglion neurons or in a heterologous expression system inhibited the mechanosensitive Piezo1 and Piezo2 channels by depleting phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2] and its precursor phosphatidylinositol 4-phosphate [PI(4)P] from the plasma membrane through Ca(2+)-induced phospholipase Cδ (PLCδ) activation. Experiments with chemically inducible phosphoinositide phosphatases and receptor-induced activation of PLCβ indicated that inhibition of Piezo channels required depletion of both PI(4)P and PI(4,5)P2. The mechanically activated current amplitudes decreased substantially in the excised inside-out configuration, where the membrane patch containing Piezo1 channels is removed from the cell. PI(4,5)P2 and PI(4)P applied to these excised patches inhibited this decrease. Thus, we concluded that Piezo channel activity requires the presence of phosphoinositides, and the combined depletion of PI(4,5)P2 and PI(4)P reduces channel activity. In addition to revealing a role for distinct membrane lipids in mechanosensitive ion channel regulation, these data suggest that inhibition of Piezo2 channels may contribute to the analgesic effect of capsaicin.

  18. Channel capacity and error exponents of variable rate adaptive channel coding for Rayleigh fading channels

    OpenAIRE

    Lau, KN

    1999-01-01

    We have evaluated the information theoretical performance of variable rate adaptive channel coding for Rayleigh fading channels. The channel states are detected at the receiver and fed back to the transmitter by means of a noiseless feedback link. Based on the channel state informations, the transmitter can adjust the channel coding scheme accordingly. Coherent channel and arbitrary channel symbols with a fixed average transmitted power constraint are assumed. The channel capacity and the err...

  19. Quantum broadcast channels

    CERN Document Server

    Yard, J; Devetak, I; Yard, Jon; Hayden, Patrick; Devetak, Igor

    2006-01-01

    We analyze quantum broadcast channels, which are quantum channels with a single sender and many receivers. Focusing on channels with two receivers for simplicity, we generalize a number of results from the network Shannon theory literature which give the rates at which two senders can receive a common message, while a personalized one is sent to one of them. Our first collection of results applies to channels with a classical input and quantum outputs. The second class of theorems we prove concern sending a common classical message over a quantum broadcast channel, while sending quantum information to one of the receivers. The third group of results we obtain concern communication over an isometry, giving the rates at quantum information can be sent to one receiver, while common quantum information is sent to both, in the sense that tripartite GHZ entanglement is established. For each scenario, we provide an additivity proof for an appropriate class of channels, yielding single-letter characterizations of the...

  20. Electrokinetic inversion of ion screening charges in nano-channels

    CERN Document Server

    Zhu, Xin; Ni, Sheng; Zhang, Xingye; Liu, Yang

    2016-01-01

    This work studies a counter-intuitive but basic process of ionic screening in nano-fluidic channels. Numerical simulations and perturbation analysis reveal that, under significant electrokinetic transport, the ion screening charges can be locally inverted in the channels: their charge sign becomes the same as that of the channel surface charges. The process is identified to originate from the coupling of longitudinal transport and junction electrostatics. This finding may revise the common understanding of ionic screening in nano-channels and indicates that their ion selectivity can be locally changed by transport. Furthermore, the charge inversion process results in a body force torque on channel fluids, which is a possible mechanism for vortex generation in the channels.

  1. Nonperturbative approach to relativistic quantum communication channels

    Science.gov (United States)

    Landulfo, André G. S.

    2016-05-01

    We investigate the transmission of both classical and quantum information between two arbitrary observers in globally hyperbolic spacetimes using a quantum field as a communication channel. The field is supposed to be in some arbitrary quasifree state and no choice of representation of its canonical commutation relations is made. Both sender and receiver possess some localized two-level quantum system with which they can interact with the quantum field to prepare the input and receive the output of the channel, respectively. The interaction between the two-level systems and the quantum field is such that one can trace out the field degrees of freedom exactly and thus obtain the quantum channel in a nonperturbative way. We end the paper determining the unassisted as well as the entanglement-assisted classical and quantum channel capacities.

  2. Measuring Method for Lightning Channel Temperature

    Science.gov (United States)

    Li, X.; Zhang, J.; Chen, L.; Xue, Q.; Zhu, R.

    2016-01-01

    In this paper, we demonstrate the temperature of lightning channel utilizing the theory of lightning spectra and the model of local thermodynamic equilibrium (LTE). The impulse current generator platform (ICGS) was used to simulate the lightning discharge channel, and the spectral energy of infrared spectroscopy (930 nm) and the visible spectroscopy (648.2 nm) of the simulated lightning has been calculated. Results indicate that the peaks of luminous intensity of both infrared and visible spectra increase with the lightning current intensity in range of 5–50 kA. Based on the results, the temperature of the lightning channel is derived to be 6140.8–10424 K. Moreover, the temperature of the channel is approximately exponential to the lightning current intensity, which shows good agreement with that of the natural lightning cases. PMID:27665937

  3. Channel estimation for MIMO-OFDM systems in wireless mobile channels

    Institute of Scientific and Technical Information of China (English)

    Lu Zhen; Ge Jianhua

    2008-01-01

    New training sequences and frame structure are proposed to estimate time-varying channel for multiple-input multiple-output and orthogonal frequency division multiplexing (MIMO-OFDM) systems. The training sequences are modulatable orthogonal polyphase sequences, which have both good autocorrelations and cross-correlations. The channel impulse response (CIR) can be obtained by measuring the correlation between the received training sequence and the locally generated training sequence. The training sequences are used as guard interval instead of cyclic prefix, which not only improve the transmission efficiency but also enable the channel estimator to track time-varying channel. The simulation results show that the proposed method has about 2dB SNR gain over conventional methods in fast time-varying channel.

  4. AP Deployment Research Based on Physical Distance and Channel Isolation

    OpenAIRE

    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang

    2014-01-01

    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  5. Secure Bidirectional Communication Protocol without Quantum Channel

    OpenAIRE

    Zhang, Z. J.; Man, Z. X.

    2004-01-01

    In this letter we propose a theoretical deterministic secure direct bidirectional quantum communication protocol by using swapping quantum entanglement and local unitary operations, in which the quantum channel for photon transmission can be discarded, hence any attack with or without eavesdropping or even the destructive attack without scruple is impossible.

  6. Molecular dynamics of CYP2D6 polymorphisms in the absence and presence of a mechanism-based inactivator reveals changes in local flexibility and dominant substrate access channels.

    Directory of Open Access Journals (Sweden)

    Parker W de Waal

    Full Text Available Cytochrome P450 enzymes (CYPs represent an important enzyme superfamily involved in metabolism of many endogenous and exogenous small molecules. CYP2D6 is responsible for ∼ 15% of CYP-mediated drug metabolism and exhibits large phenotypic diversity within CYPs with over 100 different allelic variants. Many of these variants lead to functional changes in enzyme activity and substrate selectivity. Herein, a molecular dynamics comparative analysis of four different variants of CYP2D6 was performed. The comparative analysis included simulations with and without SCH 66712, a ligand that is also a mechanism-based inactivator, in order to investigate the possible structural basis of CYP2D6 inactivation. Analysis of protein stability highlighted significantly altered flexibility in both proximal and distal residues from the variant residues. In the absence of SCH 66712, *34, *17-2, and *17-3 displayed more flexibility than *1, and *53 displayed more rigidity. SCH 66712 binding reversed flexibility in *17-2 and *17-3, through *53 remained largely rigid. Throughout simulations with docked SCH 66712, ligand orientation within the heme-binding pocket was consistent with previously identified sites of metabolism and measured binding energies. Subsequent tunnel analysis of substrate access, egress, and solvent channels displayed varied bottle-neck radii. Taken together, our results indicate that SCH 66712 should inactivate these allelic variants, although varied flexibility and substrate binding-pocket accessibility may alter its interaction abilities.

  7. Intra-membrane molecular interactions of K+ channel proteins :

    Energy Technology Data Exchange (ETDEWEB)

    Moczydlowski, Edward G.

    2013-07-01

    Ion channel proteins regulate complex patterns of cellular electrical activity and ionic signaling. Certain K+ channels play an important role in immunological biodefense mechanisms of adaptive and innate immunity. Most ion channel proteins are oligomeric complexes with the conductive pore located at the central subunit interface. The long-term activity of many K+ channel proteins is dependent on the concentration of extracellular K+; however, the mechanism is unclear. Thus, this project focused on mechanisms underlying structural stability of tetrameric K+ channels. Using KcsA of Streptomyces lividans as a model K+ channel of known structure, the molecular basis of tetramer stability was investigated by: 1. Bioinformatic analysis of the tetramer interface. 2. Effect of two local anesthetics (lidocaine, tetracaine) on tetramer stability. 3. Molecular simulation of drug docking to the ion conduction pore. The results provide new insights regarding the structural stability of K+ channels and its possible role in cell physiology.

  8. Multi-channel support for DMAC in WSNs

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Currently most wireless sensor network applications assume the presence of single-channel medium access control (MAC) protocols. However, lower sensing range result in dense networks, single-channel MAC protocols may be inadequate due to higher demand for the limited bandwidth. In this paper we proposed a method of multi-channel support for DMAC in Wireless sensor networks (WSNs). The channel assignment method is based on local information of nodes. Our multi-channel DMAC protocol implement channel distribution before message collecting from source nodes to sink node and made broadcasting possible in DMAC. Analysis and simulation result displays this multi-channel protocol obviously decreases the latency without increasing energy consumption.

  9. Local Government Uses of Cable Television.

    Science.gov (United States)

    Cable Television Information Center, Washington, DC.

    The local government cable access channel is essentially a television station completely controlled by the local government. It differs from a local broadcast television station by being able to reach only those places which are connected to the cable system, having much less programming distribution costs, and having the capacity to deliver…

  10. A linearization of quantum channels

    Science.gov (United States)

    Crowder, Tanner

    2015-06-01

    Because the quantum channels form a compact, convex set, we can express any quantum channel as a convex combination of extremal channels. We give a Euclidean representation for the channels whose inverses are also valid channels; these are a subset of the extreme points. They form a compact, connected Lie group, and we calculate its Lie algebra. Lastly, we calculate a maximal torus for the group and provide a constructive approach to decomposing any invertible channel into a product of elementary channels.

  11. Influence of salinity on the localization of Na+/K +-ATPase, Na+/K+/2Cl- cotransporter (NKCC) and CFTR anion channel in chloride cells of the Hawaiian goby (Stenogobius hawaiiensis)

    Science.gov (United States)

    McCormick, S.D.; Sundell, K.; Bjornsson, Bjorn Thrandur; Brown, C.L.; Hiroi, J.

    2003-01-01

    Na+/K+-ATPase, Na+/K+/2Cl- cotransporter (NKCC) and cystic fibrosis transmembrane conductance regulator (CFTR) are the three major transport proteins thought to be involved in chloride secretion in teleost fish. If this is the case, the levels of these transporters should be high in chloride cells of seawater-acclimated fish. We therefore examined the influence of salinity on immunolocalization of Na +/K+-ATPase, NKCC and CFTR in the gills of the Hawaiian goby (Stenogobius hawaiiensis). Fish were acclimated to freshwater and 20??? and 30??? seawater for 10 days. Na+/K +-ATPase and NKCC were localized specifically to chloride cells and stained throughout most of the cell except for the nucleus and the most apical region, indicating a basolateral/tubular distribution. All Na+/K +-ATPase-positive chloride cells were also positive for NKCC in all salinities. Salinity caused a slight increase in chloride cell number and size and a slight decrease in staining intensity for Na+/K +-ATPase and NKCC, but the basic pattern of localization was not altered. Gill Na+/K+-ATPase activity was also not affected by salinity. CFTR was localized to the apical surface of chloride cells, and only cells staining positive for Na+/K+-ATPase were CFTR-positive. CFTR-positive cells greatly increased in number (5-fold), area stained (53%) and intensity (29%) after seawater acclimation. In freshwater, CFTR immunoreactivity was light and occurred over a broad apical surface on chloride cells, whereas in seawater there was intense immunoreactivity around the apical pit (which was often punctate in appearance) and a light subapical staining. The results indicate that Na+/K +-ATPase, NKCC and CFTR are all present in chloride cells and support current models that all three are responsible for chloride secretion by chloride cells of teleost fish.

  12. Neuronal trafficking of voltage-gated potassium channels

    DEFF Research Database (Denmark)

    Jensen, Camilla S; Rasmussen, Hanne Borger; Misonou, Hiroaki

    2011-01-01

    is regulated by voltage-gated potassium (Kv) channels, such as Kv4.2, which are specifically localized in the dendritic membrane. The synaptic potentials eventually depolarize the membrane of the axon initial segment, thereby activating voltage-gated sodium channels to generate action potentials. Specific Kv...

  13. RFI channels, 2

    Science.gov (United States)

    Mceliece, R. J.

    1981-01-01

    The cutoff parameters for a class of channel models exhibiting burst noise behavior were calculated and the performance of interleaved coding strategies was evaluated. It is concluded that, provided the channel memory is large enough and is properly exploited, interleaved coding is nearly optimal.

  14. Morphological dynamics of an englacial channel

    Directory of Open Access Journals (Sweden)

    G. Vatne

    2015-08-01

    Full Text Available Despite an interest in the hydraulic functioning of supraglacial and englacial channels over the last four decades, the processes and forms of such ice-bounded streams have remained poorly documented. Recent glaciological research has demonstrated the potential significance of so-called "cut and closure" streams, where englacial or subglacial flowpaths are created from the long-term incision of supraglacial channels. These flowpaths are reported to exhibit step-pool morphology, comprising knickpoints and/or knickzones, albeit exaggerated in dimensions in comparison to their supraglacial channel counterparts. However, little is known of the development of such channels' morphology. Here, we examine the spatial organization of step-pools and the upstream migration of steps, many of which form knickzones, with repeated surveys over a 10 year period in an englacial conduit in cold-based Austre Brøggerbreen, Svalbard. The observations show upstream knickpoint recession to be the dominant process for channel evolution. This is paralleled by an increase in average step height and conduit gradient over time. Characteristic channel reach types and step-riser forms are consistently observed in each of the morphological surveys reported. We suggest that the formation of steps has a hydrodynamic origin, where step-pool geometry is more efficient for energy dissipation than meanders, and that the englacial channel system is one in rapid transition rather than in dynamic equilibrium. The evolution and recession of knickzones reported here result in the formation of a 37 m moulin, suggesting over time the englacial channel may evolve towards a stable end-point characterised by a singular vertical descent to the local hydraulic base level. In light of this, our observations highlight the need to further examine the adjustment processes in cut-and-closure channels to better understand their coupling to supraglacial meltwater sources and role and potential

  15. Inmunoterapia local Local immunotherapy

    Directory of Open Access Journals (Sweden)

    E. Lasa

    2003-01-01

    Full Text Available La inmunoterapia específica, junto con la evitación del alergeno y el tratamiento sintomático, forma parte del tratamiento de la patología alérgica. La modalidad más antigua, más conocida y mejor estudiada es la inmunoterapia subcutánea (ITSC, cuya eficacia tanto a corto como a largo plazo, ha sido ampliamente demostrada en numerosos estudios. Sin embargo, a pesar de haberse demostrado segura, no está exenta de efectos adversos y precisa ser administrada bajo supervisión de personal médico. Esto ha animado a buscar nuevas vías de administración de eficacia similar, con un buen perfil de seguridad, y de buena cumplimentación por parte del paciente. De las distintas alternativas estudiadas la más relevante es la inmunoterapia sublingual (ITSL. En ésta, se administra el antígeno en forma de gotas debajo de la lengua. Existen diferentes pautas de administración en función del alergeno implicado. La dosis óptima de tratamiento está aún sin determinar, hallándose en este momento en un rango amplio de dosis respecto a la inmunoterapia subcutánea. Su mecanismo de acción es poco conocido aunque en diversos estudios se han observado cambios inmunológicos. La ITSL ha mostrado un buen perfil de seguridad con escasos efectos secundarios, habitualmente de carácter local. Asimismo se han realizado distintos ensayos clínicos en los que se ha demostrado su eficacia en el tratamiento de la alergia respiratoria tanto en niños como en adultos. Por ello, aunque aún existen datos sin resolver respecto a esta vía de administración de inmunoterapia, ha sido propuesta por la OMS como una alternativa válida a la ITSC.Specific immunotherapy, together with avoidance of the allergen and symptomatic treatment, forms part of the treatment of allergic pathology. The oldest, best known and most studied form is subcutaneous immunotherapy (SCIT, whose efficacy, both in the short and the long term, has been widely demonstrated in numerous studies

  16. Documenting localities

    CERN Document Server

    Cox, Richard J

    1996-01-01

    Now in paperback! Documenting Localities is the first effort to summarize the past decade of renewed discussion about archival appraisal theory and methodology and to provide a practical guide for the documentation of localities.This book discusses the continuing importance of the locality in American historical research and archival practice, traditional methods archivists have used to document localities, and case studies in documenting localities. These chapters draw on a wide range of writings from archivists, historians, material culture specialists, historic preservationists

  17. Athermalized channeled spectropolarimeter enhancement.

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Julia Craven; Way, Brandyn Michael; Mercier, Jeffrey Alan; Hunt, Jeffery P.

    2013-09-01

    Channeled spectropolarimetry can measure the complete polarization state of light as a function of wavelength. Typically, a channeled spectropolarimeter uses high order retarders made of uniaxial crystal to amplitude modulate the measured spectrum with the spectrally-dependent Stokes polarization information. A primary limitation of conventional channeled spectropolarimeters is related to the thermal variability of the retarders. Thermal variation often forces frequent system recalibration, particularly for field deployed systems. However, implementing thermally stable retarders, made of biaxial crystal, results in an athermal channeled spectropolarimeter that relieves the need for frequent recalibration. This report presents experimental results for an anthermalized channeled spectropolarimeter prototype produced using potassium titanyl phosphate. The results of this prototype are compared to the current thermal stabilization state of the art. Finally, the application of the technique to the thermal infrared is studied, and the athermalization concept is applied to an infrared imaging spectropolarimeter design.

  18. Response Behavior of Local Government:A Research Based on Opinion Events from Public Opinion Channel of Renmin Network%地方政府网络舆情回应行为研究--以人民网为例

    Institute of Scientific and Technical Information of China (English)

    刘泽照; 张厚鼎

    2013-01-01

    The objective of this paper is to explore an explanation on response behavior of local government and the related dynamic process in facing network public opinion events. Based on political agenda theory, a quantitative research is conducted by using the data of selected 83 samples from Renmin Network. The results show that degree of harmfulness, media attention degree, superior intervention, administra-tive hierarchical level, information transparency, and attention distribution of local government have significant impact on response behav-iors, while the event type has no significant influence.%以风险问责和注意力为关键解释变量建构理论模型,探讨地方政府对网络舆情事件的回应,以人民网舆情频道83个案例事件为数据来源对研究假设进行检验。结果显示,网络舆情事件危害程度、媒体关注度、上级是否介入、行政层级、信息透明度、注意力分配显著影响地方政府网络舆情事件响应度,而舆情事件类型对其影响不显著。研究为地方政府舆情回应问题提供了理论解释,一定程度反映出现实地方政府回应行为的动态作用机制。

  19. TPC1 - SV Channels Gain Shape

    Institute of Scientific and Technical Information of China (English)

    Rainer Hedrich; Irene Marten

    2011-01-01

    T The most prominent ion channel localized in plant vacuoles is the slow activating SV type. Slow vacuolar (SV)channels were discovered by patch clamp studies as early as 1986. In the following two decades, numerous studies revealed that these calcium- and voltage-activated, nonselective cation channels are expressed in the vacuoles of all plants and every plant tissue. The voltage-dependent properties of the SV channel are susceptible to modulation by calcium, pH, redox state, as well as regulatory proteins. In Arabidopsis, the SV channel is encoded by the AtTPC1 gene, and even though its gene product represents the by far largest conductance of the vacuolar membrane, tpc1-loss-of-function mutants appeared not to be impaired in major physiological functions such as growth, development, and reproduction. In contrast, the fou2 gain-of-function point mutation D454N within TPC1 leads to a pronounced growth phenotype and increased synthesis of the stress hormone jasmonate. Since the TPC1 gene is present in all land plants, it likely encodes a very general function. In this review, we will discuss major SV channel properties and their impact on plant cell physiology.

  20. Experimental Channel Response to Tectonic Uplift

    Science.gov (United States)

    Turowski, J. M.; Lague, D.; Crave, A.; Hovius, N.

    2004-12-01

    We performed a series of experiments to investigate the relationship between channel geometry and tectonic forcing in steady state landscapes at various uplift rates. The experiment consists of uniformly uplifted silica paste eroded by artificial rainfall. The landscape evolves by growth and amalgamation of incisions and organises into a drainage network. High precision (0.5mm pixel size) digital elevation models were taken by a stereometric camera system. Channel bed slope is found to be independent of discharge and position on the experimental surface and increases linearly with uplift rate. This suggests it is controlled by global conditions rather than local channel processes. Using hydraulic assumptions the channel parameters width, depth, cross-sectional area, wetted perimeter and hydraulic radius were derived. We find that the channel width, cross-sectional area and wetted perimeter decay exponentially with uplift rate. The hydraulic radius is approximately constant and the channel depth rises linearly with uplift rate. These results are qualitatively consistent with recent field surveys.

  1. Climate Change and Closure of Thyborøn Channel

    DEFF Research Database (Denmark)

    Larsen, Torben

    of the channel. The coasts in the Limfjord are most sensitive to flooding and the climate changes will call for many types of precautions for the rising sea level. The closure of Thyborøn Channel should be understood as an alternative to many local solutions especially in the western part of the fjord....... In general, the public conceives the channel as a preservation-worthy piece of nature but the inconvenient truth is that the channel exists only because of human intervention in the nature. At suggestion of Jørgen Bülow Beck and the author the matter was reopened in 2005 because of the discussion...

  2. Prevalence of Polyoma BK Virus (BKPyV), Epstein-Barr Virus (EBV) and Human Papilloma Virus (HPV) in Oropharyngeal Cancer.

    Science.gov (United States)

    Polz-Gruszka, Dorota; Morshed, Kamal; Jarzyński, Adrian; Polz-Dacewicz, Małgorzata

    2015-01-01

    The aim of this study was to analyze the prevalence of BK virus, Human Papillomavirus and Epstein-Barr virus in oropharyngeal cancer, and to test our hypothesis that BKV/HPV/EBV co-infection plays a role in oropharyngeal squamous cell carcinoma. The correlation between viral infection, OSCC, anatomic location, pre-treatment staging, evidence of metastases to lymph nodes, and grading was also investigated. The examination samples were collected from 62 patients from paraffin tissue blocks. Males (90.3%) with, smoking (83.9%) and alcohol abuse (67.7%) problems prevailed in the studied group. G2 histological type was recognized in 80.6% cases. T4 (77.4%) and N2 (56.5%) traits occurred in the majority of patients. No cases of metastasis were observed (M0 100%). HPV - 24.2%, EBV - 27.4% and BKV 17.7% were detected in the studied samples. We observed co-infection EBV/BKV in 8% of cases, HPV/BKV in 4.8%, and HPV/EBV in 9% cases. Only in two cases co-infection of all three viruses was found.

  3. Local food:

    DEFF Research Database (Denmark)

    Sundbo, Donna Isabella Caroline

    2013-01-01

    as expressed by a group of Danish providers and consumers is empirically investigated through interviews, observation and surveys. From this, qualitative and quantitative data are generated, the analysis of which shows how varied perceptions of local food are. The elements of which the perceptions consist......Recently there has been more focus on food in general and local food in particular. But what is local food? And what are the perceptions of this concept according to theory and to providers and consumers of local food? This article first summarises and compares three different theoretical...... perspectives on local food, namely experience economy, local food systems and what is termed pro-industrialism. These have differing and sometimes opposite conceptualisations and aims for the concept of local food. Using the perspective of experience economy as theoretical background, the concept of local food...

  4. Cold plate with combined inclined impingement and ribbed channels

    Science.gov (United States)

    Parida, Pritish R.

    2015-12-22

    Heat transfer devices and methods for making the same that include a first enclosure having at least one inlet port; a second enclosure having a bottom plate and one or more dividing walls to establish channels, at least one internal surface of each channel having rib structures to create turbulence in a fluid flow; and a jet plate connecting the first enclosure and the second enclosure having impinging jets that convey fluid from the first enclosure to the channels, said impinging jets being set at an angular deviation from normal to cause local acceleration of fluid and to increase a local heat transfer rate.

  5. Channel Choice: A Literature Review

    DEFF Research Database (Denmark)

    Østergaard Madsen, Christian; Kræmmergaard, Pernille

    2015-01-01

    The channel choice branch of e-government studies citizens’ and businesses’ choice of channels for interacting with government, and how government organizations can integrate channels and migrate users towards the most cost-efficient channels. In spite of the valuable contributions offered no sys...... no systematic overview exist of channel choice. We present a literature review of channel choice studies in government to citizen context identifying authors, countries, methods, concepts, units of analysis, and theories, and offer suggestionsfor future studies....

  6. Understanding Sodium Channel Function and Modulation Using Atomistic Simulations of Bacterial Channel Structures.

    Science.gov (United States)

    Boiteux, C; Allen, T W

    2016-01-01

    Sodium channels are chief proteins involved in electrical signaling in the nervous system, enabling critical functions like heartbeat and brain activity. New high-resolution X-ray structures for bacterial sodium channels have created an opportunity to see how these proteins operate at the molecular level. An important challenge to overcome is establishing relationships between the structures and functions of mammalian and bacterial channels. Bacterial sodium channels are known to exhibit the main structural features of their mammalian counterparts, as well as several key functional characteristics, including selective ion conduction, voltage-dependent gating, pore-based inactivation and modulation by local anesthetic, antiarrhythmic and antiepileptic drugs. Simulations have begun to shed light on each of these features in the past few years. Despite deviations in selectivity signatures for bacterial and mammalian channels, simulations have uncovered the nature of the multiion conduction mechanism associated with Na(+) binding to a high-field strength site established by charged glutamate side chains. Simulations demonstrated a surprising level of flexibility of the protein, showing that these side chains are active participants in the permeation process. They have also uncovered changes in protein structure, leading to asymmetrical collapses of the activation gate that have been proposed to correspond to inactivated structures. These observations offer the potential to examine the mechanisms of state-dependent drug activity, focusing on pore-blocking and pore-based slow inactivation in bacterial channels, without the complexities of inactivation on multiple timescales seen in eukaryotic channels. Simulations have provided molecular views of the interactions of drugs, consistent with sites predicted in mammalian channels, as well as a wealth of other sites as potential new drug targets. In this chapter, we survey the new insights into sodium channel function that

  7. A Simple Water Channel

    Science.gov (United States)

    White, A. S.

    1976-01-01

    Describes a simple water channel, for use with an overhead projector. It is run from a water tap and may be used for flow visualization experiments, including the effect of streamlining and elementary building aerodynamics. (MLH)

  8. 28-Channel rotary transformer

    Science.gov (United States)

    Mclyman, W. T.

    1981-01-01

    Transformer transmits power and digital data across rotating interface. Array has many parallel data channels, each with potential l megabaud data rate. Ferrite-cored transformers are spaced along rotor; airgap between them reduces crosstalk.

  9. Channelized Streams in Iowa

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — This draft dataset consists of all ditches or channelized pieces of stream that could be identified using three input datasets; namely the1:24,000 National...

  10. CHANNEL ESTIMATION TECHNIQUE

    DEFF Research Database (Denmark)

    2015-01-01

    A method includes determining a sequence of first coefficient estimates of a communication channel based on a sequence of pilots arranged according to a known pilot pattern and based on a receive signal, wherein the receive signal is based on the sequence of pilots transmitted over the communicat......A method includes determining a sequence of first coefficient estimates of a communication channel based on a sequence of pilots arranged according to a known pilot pattern and based on a receive signal, wherein the receive signal is based on the sequence of pilots transmitted over the...... communication channel. The method further includes determining a sequence of second coefficient estimates of the communication channel based on a decomposition of the first coefficient estimates in a dictionary matrix and a sparse vector of the second coefficient estimates, the dictionary matrix including...

  11. Sensing with Ion Channels

    CERN Document Server

    Martinac, Boris

    2008-01-01

    All living cells are able to detect and translate environmental stimuli into biologically meaningful signals. Sensations of touch, hearing, sight, taste, smell or pain are essential to the survival of all living organisms. The importance of sensory input for the existence of life thus justifies the effort made to understand its molecular origins. Sensing with Ion Channels focuses on ion channels as key molecules enabling biological systems to sense and process the physical and chemical stimuli that act upon cells in their living environment. Its aim is to serve as a reference to ion channel specialists and as a source of new information to non specialists who want to learn about the structural and functional diversity of ion channels and their role in sensory physiology.

  12. TRP channels in disease.

    Science.gov (United States)

    Jordt, S E; Ehrlich, B E

    2007-01-01

    The transient receptor potential (TRP) channels are a large family of proteins with six main subfamilies termed the TRPC (canonical), TRPV (vanilloid), TRPM (melastatin), TRPP (polycystin), TRPML (mucolipin), and TRPA (ankyrin) groups. The sheer number of different TRPs with distinct functions supports the statement that these channels are involved in a wide range of processes ranging from sensing of thermal and chemical signals to reloading intracellular stores after responding to an extracellular stimulus. Mutations in TRPs are linked to pathophysiology and specific diseases. An understanding of the role of TRPs in normal physiology is just beginning; the progression from mutations in TRPs to pathophysiology and disease will follow. In this review, we focus on two distinct aspects of TRP channel physiology, the role of TRP channels in intracellular Ca2+ homeostasis, and their role in the transduction of painful stimuli in sensory neurons. PMID:18193640

  13. Chloride channels in stroke

    Institute of Scientific and Technical Information of China (English)

    Ya-ping ZHANG; Hao ZHANG; Dayue Darrel DUAN

    2013-01-01

    Vascular remodeling of cerebral arterioles,including proliferation,migration,and apoptosis of vascular smooth muscle cells (VSMCs),is the major cause of changes in the cross-sectional area and diameter of the arteries and sudden interruption of blood flow or hemorrhage in the brain,ie,stroke.Accumulating evidence strongly supports an important role for chloride (Clˉ) channels in vascular remodeling and stroke.At least three Clˉ channel genes are expressed in VSMCs:1) the TMEM16A (or Ano1),which may encode the calcium-activated Clˉ channels (CACCs); 2) the CLC-3 Clˉ channel and Clˉ/H+ antiporter,which is closely related to the volume-regulated Clˉ channels (VRCCs); and 3) the cystic fibrosis transmembrane conductance regulator (CFTR),which encodes the PKA-and PKC-activated Clˉ channels.Activation of the CACCs by agonist-induced increase in intracellular Ca2+ causes membrane depolarization,vasoconstriction,and inhibition of VSMC proliferation.Activation of VRCCs by cell volume increase or membrane stretch promotes the production of reactive oxygen species,induces proliferation and inhibits apoptosis of VSMCs.Activation of CFTR inhibits oxidative stress and may prevent the development of hypertension.In addition,Clˉ current mediated by gammaaminobutyric acid (GABA) receptor has also been implicated a role in ischemic neuron death.This review focuses on the functional roles of Clˉ channels in the development of stroke and provides a perspective on the future directions for research and the potential to develop Clˉ channels as new targets for the prevention and treatment of stroke.

  14. Physics of Ion Channels

    OpenAIRE

    Kuyucak, Serdar; Bastug, Turgut

    2003-01-01

    We review the basic physics involved in transport of ions across membrane channels in cells. Electrochemical forces that control the diffusion of ions are discussed both from microscopic and macroscopic perspectives. A case is made for use of Brownian dynamics as the minimal phenomenological model that provides a bridge between experiments and more fundamental theoretical approaches. Application of Brownian and molecular dynamics methods to channels with known molecular structures is discussed.

  15. Identification Via Quantum Channels

    OpenAIRE

    Winter, Andreas

    2012-01-01

    We review the development of the quantum version of Ahlswede and Dueck's theory of identification via channels. As is often the case in quantum probability, there is not just one but several quantizations: we know at least two different concepts of identification of classical information via quantum channels, and three different identification capacities for quantum information. In the present summary overview we concentrate on conceptual points and open problems, referring the reader to the ...

  16. Quantum Feedback Channels

    OpenAIRE

    Bowen, Garry

    2002-01-01

    In Shannon information theory the capacity of a memoryless communication channel cannot be increased by the use of feedback. In quantum information theory the no-cloning theorem means that noiseless copying and feedback of quantum information cannot be achieved. In this paper, quantum feedback is defined as the unlimited use of a noiseless quantum channel from receiver to sender. Given such quantum feedback, it is shown to provide no increase in the entanglement--assisted capacities of a memo...

  17. Chaos in quantum channels

    OpenAIRE

    Hosur, Pavan; Qi, Xiao-Liang; Roberts, Daniel; Yoshida, Beni(Institute for Quantum Information & Matter and Walter Burke Institute for Theoretical Physics, California Institute of Technology, 1200 E. California Blvd., Pasadena, CA, 91125, U.S.A.)

    2016-01-01

    We study chaos and scrambling in unitary channels by considering their entanglement properties as states. Using out-of-time-order correlation functions to diagnose chaos, we characterize the ability of a channel to process quantum information. We show that the generic decay of such correlators implies that any input subsystem must have near vanishing mutual information with almost all partitions of the output. Additionally, we propose the negativity of the tripartite information of the channe...

  18. The present state of locally operating businesses' marketing, CASE: Born Local

    OpenAIRE

    Kuitunen, Nella

    2014-01-01

    This thesis was conducted as an assignment for a Finnish start-up company Born Local Ltd. The company has developed and recently launched a hyperlocal social media service called Nearhood, which gathers all information regarding a specific city area onto one interactive platform. For locally operating companies Nearhood provides a closely targeted channel for local marketing. Born Local Ltd is currently designing a selection of products for local marketing on Nearhood and in order to be able ...

  19. Course on Ionic Channels

    CERN Document Server

    1986-01-01

    This book is based on a series of lectures for a course on ionic channels held in Santiago, Chile, on November 17-20, 1984. It is intended as a tutorial guide on the properties, function, modulation, and reconstitution of ionic channels, and it should be accessible to graduate students taking their first steps in this field. In the presentation there has been a deliberate emphasis on the spe­ cific methodologies used toward the understanding of the workings and function of channels. Thus, in the first section, we learn to "read" single­ channel records: how to interpret them in the theoretical frame of kinetic models, which information can be extracted from gating currents in re­ lation to the closing and opening processes, and how ion transport through an open channel can be explained in terms of fluctuating energy barriers. The importance of assessing unequivocally the origin and purity of mem­ brane preparations and the use of membrane vesicles and optical tech­ niques in the stUGY of ionic channels a...

  20. Immunolocalization and expression of small-conductance calcium-activated potassium channels in human myometrium

    DEFF Research Database (Denmark)

    Rosenbaum, Sofia T; Svalø, Julie; Nielsen, Karsten;

    2012-01-01

    Small-conductance calcium-activated potassium (SK3) channels have been detected in human myometrium and we have previously shown a functional role of SK channels in human myometrium in vitro. The aims of this study were to identify the precise localization of SK3 channels and to quantify SK3 mRNA...

  1. Morphodynamics of Floodplain Chute Channels

    Science.gov (United States)

    David, S. R.; Edmonds, D. A.

    2015-12-01

    Floodplain chute channel formation is a key process that can enable rivers to transition from single-thread to multi-thread planform geometries. Floodplain chute channels are usually incisional channels connecting topographic lows across point bars and in the floodplain. Surprisingly, it is still not clear what conditions promote chute channel formation and what governs their morphodynamic behavior. Towards this end we have initiated an empirical and theoretical study of floodplain chute channels in Indiana, USA. Using elevation models and satellite imagery we mapped 3064 km2 of floodplain in Indiana, and find that 37.3% of mapped floodplains in Indiana have extensive chute channel networks. These chute channel networks consist of two types of channel segments: meander cutoffs of the main channel and chute channels linking the cutoffs together. To understand how these chute channels link meander cutoffs together and eventually create floodplain channel networks we use Delft3D to explore floodplain morphodynamics. Our first modeling experiment starts from a generic floodplain prepopulated with meander cutoffs to test under what conditions chute channels form.We find that chute channel formation is optimized at an intermediate flood discharge. If the flood discharge is too large the meander cutoffs erosively diffuse, whereas if the floodwave is too small the cutoffs fill with sediment. A moderately sized floodwave reworks the sediment surrounding the topographic lows, enhancing the development of floodplain chute channels. Our second modeling experiments explore how floodplain chute channels evolve on the West Fork of the White River, Indiana, USA. We find that the floodplain chute channels are capable of conveying the entire 10 yr floodwave (Q=1330m3/s) leaving the inter-channel areas dry. Moreover, the chute channels can incise into the floodplain while the margins of channels are aggrading, creating levees. Our results suggest that under the right conditions

  2. Amoeboid swimming in a channel

    CERN Document Server

    Wu, Hao; Hu, W -F; Thiébaud, M; Rafaï, S; Peyla, P; Lai, M -C; Misbah, C

    2016-01-01

    Several micro-organisms, such as bacteria, algae, or spermatozoa, use flagellum or cilium activity to swim in a fluid. Many other organisms use rather ample shape deformation, described as amoeboid, to propel themselves, either crawling on a substrate or swimming. Many eukaryotic cells were believed to require an underlying substratum to migrate (crawl) by using ample membrane deformation (like blebbing). There is now an increasing evidence that a large variety of cells (including those of the immune system) can migrate without the assistance of focal adhesion, and can perform swimming as efficiently as crawling. This paper deals with a detailed analysis of amoeboid swimming in a confined fluid, by modeling the swimmer as an inextensible membrane deploying local active forces. The swimmer exhibits a rich behavior: it can settle into a straight trajectory in the channel, or can navigate from one wall to the other, depending on confinement. Furthermore, the nature of the swimmer is found to be affected by the c...

  3. Local Helioseismology

    Directory of Open Access Journals (Sweden)

    Gizon Laurent

    2005-11-01

    Full Text Available We review the current status of local helioseismology, covering both theoretical and observational results. After a brief introduction to solar oscillations and wave propagation through inhomogeneous media, we describe the main techniques of local helioseismology: Fourier-Hankel decomposition, ring-diagram analysis, time-distance helioseismology, helioseismic holography, and direct modeling. We discuss local helioseismology of large-scale flows, the solar-cycle dependence of these flows, perturbations associated with regions of magnetic activity, and solar supergranulation.

  4. TRESK potassium channel in human T lymphoblasts

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez-Miguel, Dénison Selene, E-mail: amurusk@hotmail.com [Center for Biomedical Research, University of Colima, Av. 25 de Julio 965, Villa San Sebastian, C.P. 28045 Colima (Mexico); García-Dolores, Fernando, E-mail: garciaddf@yahoo.com [Department of Pathology, Institute of Forensic Sciences, Av. Niños Héroes 130, Col. Doctores, C.P. 06720 Mexico, DF (Mexico); Rosa Flores-Márquez, María, E-mail: mariafo31@yahoo.com.mx [National Medical Center of Occident (CMNO) IMSS, Belisario Dominguez 735, Col. Independencia Oriente, C.P. 44340 Guadalajara, Jalisco (Mexico); Delgado-Enciso, Iván [University of Colima, School of Medicine, Av. Universidad 333, Col. Las Viboras, C.P. 28040 Colima (Mexico); Pottosin, Igor, E-mail: pottosin@ucol.mx [Center for Biomedical Research, University of Colima, Av. 25 de Julio 965, Villa San Sebastian, C.P. 28045 Colima (Mexico); Dobrovinskaya, Oxana, E-mail: oxana@ucol.mx [Center for Biomedical Research, University of Colima, Av. 25 de Julio 965, Villa San Sebastian, C.P. 28045 Colima (Mexico)

    2013-05-03

    Highlights: • TRESK (KCNK18) mRNA is present in different T lymphoblastic cell lines. • KCNK18 mRNA was not found in resting peripheral blood lymphocytes. • Clinical samples of T lymphoblastic leukemias and lymphomas were positive for TRESK. • TRESK in T lymphoblasts has dual localization, in plasma membrane and intracellular. -- Abstract: TRESK (TWIK-related spinal cord K{sup +}) channel, encoded by KCNK18 gene, belongs to the double-pore domain K{sup +} channel family and in normal conditions is expressed predominantly in the central nervous system. In our previous patch-clamp study on Jurkat T lymphoblasts we have characterized highly selective K{sup +} channel with pharmacological profile identical to TRESK. In the present work, the presence of KCNK18 mRNA was confirmed in T lymphoblastic cell lines (Jurkat, JCaM, H9) but not in resting peripheral blood lymphocytes of healthy donors. Positive immunostaining for TRESK was demonstrated in lymphoblastic cell lines, in germinal centers of non-tumoral lymph nodes, and in clinical samples of T acute lymphoblastic leukemias/lymphomas. Besides detection in the plasma membrane, intracellular TRESK localization was also revealed. Possible involvement of TRESK channel in lymphocyte proliferation and tumorigenesis is discussed.

  5. Mitochondrial Ion Channels

    Science.gov (United States)

    O’Rourke, Brian

    2009-01-01

    In work spanning more than a century, mitochondria have been recognized for their multifunctional roles in metabolism, energy transduction, ion transport, inheritance, signaling, and cell death. Foremost among these tasks is the continuous production of ATP through oxidative phosphorylation, which requires a large electrochemical driving force for protons across the mitochondrial inner membrane. This process requires a membrane with relatively low permeability to ions to minimize energy dissipation. However, a wealth of evidence now indicates that both selective and nonselective ion channels are present in the mitochondrial inner membrane, along with several known channels on the outer membrane. Some of these channels are active under physiological conditions, and others may be activated under pathophysiological conditions to act as the major determinants of cell life and death. This review summarizes research on mitochondrial ion channels and efforts to identify their molecular correlates. Except in a few cases, our understanding of the structure of mitochondrial ion channels is limited, indicating the need for focused discovery in this area. PMID:17059356

  6. Channel Identification Machines

    Directory of Open Access Journals (Sweden)

    Aurel A. Lazar

    2012-01-01

    Full Text Available We present a formal methodology for identifying a channel in a system consisting of a communication channel in cascade with an asynchronous sampler. The channel is modeled as a multidimensional filter, while models of asynchronous samplers are taken from neuroscience and communications and include integrate-and-fire neurons, asynchronous sigma/delta modulators and general oscillators in cascade with zero-crossing detectors. We devise channel identification algorithms that recover a projection of the filter(s onto a space of input signals loss-free for both scalar and vector-valued test signals. The test signals are modeled as elements of a reproducing kernel Hilbert space (RKHS with a Dirichlet kernel. Under appropriate limiting conditions on the bandwidth and the order of the test signal space, the filter projection converges to the impulse response of the filter. We show that our results hold for a wide class of RKHSs, including the space of finite-energy bandlimited signals. We also extend our channel identification results to noisy circuits.

  7. Factor-Graph-Based Soft Self-Iterative Equalizer for Multipath Channels

    Directory of Open Access Journals (Sweden)

    Yue Guosen

    2005-01-01

    Full Text Available We consider factor-graph-based soft self-iterative equalization in wireless multipath channels. Since factor graphs are able to characterize multipath channels to per-path level, the corresponding soft self-iterative equalizer possesses reduced computational complexity in sparse multipath channels. The performance of the considered self-iterative equalizer is analyzed in both single-antenna and multiple-antenna multipath channels. When factor graphs of multipath channels have no cycles or mild cycle conditions, the considered self-iterative equalizer can converge to optimum performance after a few iterations; but it may suffer local convergence in channels with severe cycle conditions.

  8. Analysis and Application of Covert Channels of Internet Control Message Protocol

    Institute of Scientific and Technical Information of China (English)

    ZHOU Xueguang; ZHANG Huanguo

    2006-01-01

    Based on the analysis of the covert channel's working mechanism of the internet control message protocol (ICMP) in internet protocol version 4 (IPv4) and Internet Protocol version 6 (IPv6), the ICMP covert channel's algorithms of the IPv4 and IPv6 are presented, which enable automatic channeling upon IPv4/v6 nodes with non-IPv4-compatible address, and the key transmission is achieved by using this channel in the embedded Internet terminal. The result shows that the covert channel's algorithm, which we implemented if, set correct, the messages of this covert channel might go through the gateway and enter the local area network.

  9. QKD Quantum Channel Authentication

    CERN Document Server

    Kosloski, J T

    2006-01-01

    Several simple yet secure protocols to authenticate the quantum channel of various QKD schemes, by coupling the photon sender's knowledge of a shared secret and the QBER Bob observes, are presented. It is shown that Alice can encrypt certain portions of the information needed for the QKD protocols, using a sequence whose security is based on computational-complexity, without compromising all of the sequence's entropy. It is then shown that after a Man-in-the-Middle attack on the quantum and classical channels, there is still enough entropy left in the sequence for Bob to detect the presence of Eve by monitoring the QBER. Finally, it is shown that the principles presented can be implemented to authenticate the quantum channel associated with any type of QKD scheme, and they can also be used for Alice to authenticate Bob.

  10. Dequantization Via Quantum Channels

    Science.gov (United States)

    Andersson, Andreas

    2016-10-01

    For a unital completely positive map {Φ} ("quantum channel") governing the time propagation of a quantum system, the Stinespring representation gives an enlarged system evolving unitarily. We argue that the Stinespring representations of each power {Φ^m} of the single map together encode the structure of the original quantum channel and provide an interaction-dependent model for the bath. The same bath model gives a "classical limit" at infinite time {mto∞} in the form of a noncommutative "manifold" determined by the channel. In this way, a simplified analysis of the system can be performed by making the large- m approximation. These constructions are based on a noncommutative generalization of Berezin quantization. The latter is shown to involve very fundamental aspects of quantum-information theory, which are thereby put in a completely new light.

  11. Dequantization Via Quantum Channels

    Science.gov (United States)

    Andersson, Andreas

    2016-08-01

    For a unital completely positive map {Φ} ("quantum channel") governing the time propagation of a quantum system, the Stinespring representation gives an enlarged system evolving unitarily. We argue that the Stinespring representations of each power {Φ^m} of the single map together encode the structure of the original quantum channel and provide an interaction-dependent model for the bath. The same bath model gives a "classical limit" at infinite time {mto∞} in the form of a noncommutative "manifold" determined by the channel. In this way, a simplified analysis of the system can be performed by making the large-m approximation. These constructions are based on a noncommutative generalization of Berezin quantization. The latter is shown to involve very fundamental aspects of quantum-information theory, which are thereby put in a completely new light.

  12. Chaos in quantum channels

    CERN Document Server

    Hosur, Pavan; Roberts, Daniel A; Yoshida, Beni

    2015-01-01

    We study chaos and scrambling in unitary channels by considering their entanglement properties as states. Using out-of-time-order correlation functions to diagnose chaos, we characterize the ability of a channel to process quantum information. We show that the generic decay of such correlators implies that any input subsystem must have near vanishing mutual information with almost all partitions of the output. Additionally, we propose the negativity of the tripartite information of the channel as a general diagnostic of scrambling. This measures the delocalization of information and is closely related to the decay of out-of-time-order correlators. We back up our results with numerics in two non-integrable models and analytic results in a perfect tensor network model of chaotic time evolution. These results show that the butterfly effect in quantum systems implies the information-theoretic definition of scrambling.

  13. Voltage-Gated Proton Channels

    OpenAIRE

    DeCoursey, Thomas E.

    2008-01-01

    Voltage-gated proton channels, HV1, have vaulted from the realm of the esoteric into the forefront of a central question facing ion channel biophysicists, namely the mechanism by which voltage-dependent gating occurs. This transformation is the result of several factors. Identification of the gene in 2006 revealed that proton channels are homologues of the voltage-sensing domain of most other voltage-gated ion channels. Unique, or at least eccentric, properties of proton channels include dime...

  14. Nonperturbative approach to relativistic quantum communication channels

    OpenAIRE

    Landulfo, Andre G. S.

    2016-01-01

    We investigate the transmission of both classical and quantum information between two arbitrary observers in globally hyperbolic spacetimes using a quantum field as a communication channel. The field is supposed to be in some arbitrary quasifree state and no choice of representation of its canonical commutation relations is made. Both sender and receiver possess some localized two-level quantum system with which they can interact with the quantum field to prepare the input and receive the out...

  15. The neutron channeling phenomenon.

    Science.gov (United States)

    Khanouchi, A; Sabir, A; Boulkheir, M; Ichaoui, R; Ghassoun, J; Jehouani, A

    1997-01-01

    Shields, used for protection against radiation, are often pierced with vacuum channels for passing cables and other instruments for measurements. The neutron transmission through these shields is an unavoidable phenomenon. In this work we study and discuss the effect of channels on neutron transmission through shields. We consider an infinite homogeneous slab, with a fixed thickness (20 lambda, with lambda the mean free path of the neutron in the slab), which contains a vacuum channel. This slab is irradiated with an infinite source of neutrons on the left side and on the other side (right side) many detectors with windows equal to 2 lambda are placed in order to evaluate the neutron transmission probabilities (Khanouchi, A., Aboubekr, A., Ghassoun, J. and Jehouani, A. (1994) Rencontre Nationale des Jeunes Chercheurs en Physique. Casa Blanca Maroc; Khanouchi, A., Sabir, A., Ghassoun, J. and Jehouani, A. (1995) Premier Congré International des Intéractions Rayonnements Matière. Eljadida Maroc). The neutron history within the slab is simulated by the Monte Carlo method (Booth, T. E. and Hendricks, J. S. (1994) Nuclear Technology 5) and using the exponential biasing technique in order to improve the Monte Carlo calculation (Levitt, L. B. (1968) Nuclear Science and Engineering 31, 500-504; Jehouani, A., Ghassoun, J. and Aboubker, A. (1994) In Proceedings of the 6th International Symposium on Radiation Physics, Rabat, Morocco). Then different geometries of the vacuum channel have been studied. For each geometry we have determined the detector response and calculated the neutron transmission probability for different detector positions. This neutron transmission probability presents a peak for the detectors placed in front of the vacuum channel. This study allowed us to clearly identify the neutron channeling phenomenon. One application of our study is to detect vacuum defects in materials. PMID:9463884

  16. Local Knowledge Transfer and Performance: Implications for Alliance Formation in Asia

    OpenAIRE

    Shige Makino; Andrew Delios

    1996-01-01

    Foreign firms in host country environments frequently face location-based disadvantages. This study proposes three means (channels) of overcoming local knowledge disadvantages. Based on a sample of 558 Japanese joint ventures (JVs) located in Southeast and East Asia, we find that partnering with local firms (the first channel) can be a primary strategy for accessing local knowledge and improving JV performance. JV experience in the host country (the second channel) also mitigates local knowle...

  17. Net Locality

    DEFF Research Database (Denmark)

    de Souza e Silva, Adriana Araujo; Gordon, Eric

    Provides an introduction to the new theory of Net Locality and the profound effect on individuals and societies when everything is located or locatable. Describes net locality as an emerging form of location awareness central to all aspects of digital media, from mobile phones, to Google Maps...

  18. BLIND CHANNEL ESTIMATION IN DELAY DIVERSITY FOR FREQUENCY SELECTIVE CHANNELS

    Institute of Scientific and Technical Information of China (English)

    Zhao Zheng; Jia Ying; Yin Qinye

    2003-01-01

    Delay diversity is an effective transmit diversity technique to combat adverse ef-fects of fading. Thus far, previous work in delay diversity assumed that perfect estimates ofcurrent channel fading conditions are available at the receiver and training symbols are requiredto estimate the channel from the transmitter to the receiver. However, increasing the number ofthe antennas increases the required training interval and reduces the available time within whichdata may be transmitted. Learning the channel coefficients becomes increasingly difficult for thefrequency selective channels. In this paper, with the subspace method and the delay character ofdelay diversity, a channel estimation method is proposed, which does not use training symbols. Itaddresses the transmit diversity for a frequency selective channel from a single carrier perspectivein the form of a simple equivalent fiat fading model. Monte Carlo simulations give the perfor-mance of channel estimation and the performance comparison of our channel-estimation-baseddetector with decision feedback equalization, which uses the perfect channel information.

  19. K(v)7 channels: function, pharmacology and channel modulators.

    Science.gov (United States)

    Dalby-Brown, William; Hansen, Henrik H; Korsgaard, Mads P G; Mirza, Naheed; Olesen, Søren-P

    2006-01-01

    K(v)7 channels are unique among K(+) channels, since four out of the five channel subtypes have well-documented roles in the development of human diseases. They have distinct physiological functions in the heart and in the nervous system, which can be ascribed to their voltage-gating properties. The K(v)7 channels also lend themselves to pharmacological modulation, and synthetic openers as well as blockers of the channels, regulating neuronal excitability, have existed even before the K(v)7 channels were identified by cloning. In the present review we give an account on the focused efforts to develop selective modulators, openers as well as blockers, of the K(v)7 channel subtypes, which have been undertaken during recent years, along with a discussion of the K(v)7 ion channel physiology and therapeutic indications for modulators of the neuronal K(v)7 channels.

  20. Chemistry in Microfluidic Channels

    Science.gov (United States)

    Chia, Matthew C.; Sweeney, Christina M.; Odom, Teri W.

    2011-01-01

    General chemistry introduces principles such as acid-base chemistry, mixing, and precipitation that are usually demonstrated in bulk solutions. In this laboratory experiment, we describe how chemical reactions can be performed in a microfluidic channel to show advanced concepts such as laminar fluid flow and controlled precipitation. Three sets of…

  1. Beyond the Manual Channel

    DEFF Research Database (Denmark)

    the manual channel. Not surprisingly, most papers deal with non-manuals on the face. Once again, the papers at this workshop clearly identify the potentials of even closer cooperation between sign linguists and sign language engineers, and we think it is events like this that contribute a lot to a better...

  2. TRP channels: an overview

    DEFF Research Database (Denmark)

    Pedersen, Stine Falsig; Owsianik, Grzegorz; Nilius, Bernd

    2005-01-01

    to a plethora of data on the roles of TRPs in a variety of tissues and species, including mammals, insects, and yeast. The present review summarizes the most pertinent recent evidence regarding the structural and functional properties of TRP channels, focusing on the regulation and physiology of mammalian TRPs....

  3. All channels open

    NARCIS (Netherlands)

    Frank Huysmans; Jos de Haan

    2010-01-01

    Original title: Alle kanalen staan open. The rapid changes taking place in the media landscape in the Netherlands - characterised by digitisation and convergence of media technologies - raise the question of how the Dutch are dealing with the many new opportunities that have opened up. All channels

  4. Channeling through Bent Crystals

    Energy Technology Data Exchange (ETDEWEB)

    Mack, Stephanie; /Ottawa U. /SLAC

    2012-09-07

    Bent crystals have demonstrated potential for use in beam collimation. A process called channeling is when accelerated particle beams are trapped by the nuclear potentials in the atomic planes within a crystal lattice. If the crystal is bent then the particles can follow the bending angle of the crystal. There are several different effects that are observed when particles travel through a bent crystal including dechanneling, volume capture, volume reflection and channeling. With a crystal placed at the edge of a particle beam, part of the fringe of the beam can be deflected away towards a detector or beam dump, thus helping collimate the beam. There is currently FORTRAN code by Igor Yazynin that has been used to model the passage of particles through a bent crystal. Using this code, the effects mentioned were explored for beam energy that would be seen at the Facility for Advanced Accelerator Experimental Tests (FACET) at a range of crystal orientations with respect to the incoming beam. After propagating 5 meters in vacuum space past the crystal the channeled particles were observed to separate from most of the beam with some noise due to dechanneled particles. Progressively smaller bending radii, with corresponding shorter crystal lengths, were compared and it was seen that multiple scattering decreases with the length of the crystal therefore allowing for cleaner detection of the channeled particles. The input beam was then modified and only a portion of the beam sent through the crystal. With the majority of the beam not affected by the crystal, most particles were not deflected and after propagation the channeled particles were seen to be deflected approximately 5mm. After a portion of the beam travels through the crystal, the entire beam was then sent through a quadrupole magnet, which increased the separation of the channeled particles from the remainder of the beam to a distance of around 20mm. A different code, which was developed at SLAC, was used to

  5. Channels and valley networks. [of planet Mars surface

    Science.gov (United States)

    Baker, Victor R.; Carr, Michael H.; Gulick, Virginia C.; Williams, Cameron R.; Marley, Mark S.

    1992-01-01

    Attention is given to Martian channels and valley networks, since they have become a principal element of evidence to the effect that the Martian atmosphere evolved from an early volatile-rich state to its present condition. The outflow channels are relatively young, later Hesperian or Amazonian in age. They formed by immense outbursts of fluid from subsurface sources. Complexity in outflow-channel morphology was generated by varying amounts of sediment and ice in the aqueous-fluid flow systems. The overall cataclysmic-flood morphology may thus be locally transitional to morphologies generated by ice and debris flowage. Although local areas of valley networks, such as on Alba Patera, formed coevally with outflow channel activity, regionally extensive networks dominate in the heavily cratered terrains. The morphology of many valleys suggests genesis by ground-water sapping; for some valleys, surface runoff may have been more important.

  6. Localized Scleroderma

    Science.gov (United States)

    ... educational offerings from your local chapter. • Discounted registration fees to the annual National Patient Education Conference. Please consider joining the Scleroderma Foundation today. A membership form is attached on the reverse side of ...

  7. Ontology Localization

    OpenAIRE

    Espinoza Mejía, Mauricio; Montiel-Ponsoda, Elena; Aguado de Cea, G.; A. GÓMEZ-PÉREZ

    2012-01-01

    In the context of the Semantic Web, resources on the net can be enriched by well-defined, machine-understandable metadata describing their associated conceptual meaning. These metadata consisting of natural language descriptions of concepts are the focus of the activity we describe in this chapter, namely, ontology localization. In the framework of the NeOn Methodology, ontology localization is defined as the activity of adapting an ontology to a particular language and culture. This adaptati...

  8. Local Contexts

    Directory of Open Access Journals (Sweden)

    Philippe Schlenker

    2009-07-01

    Full Text Available The dynamic approach posits that a presupposition must be satisfied in its local context. But how is a local context derived from the global one? Extant dynamic analyses must specify in the lexical entry of any operator what its 'Context Change Potential' is, and for this very reason they fail to be sufficiently explanatory. To circumvent the problem, we revise two assumptions of the dynamic approach: we take the update process to be derivative from a classical, non-dynamic semantics -- which obviates the need for dynamic lexical entries; and we deny that a local context encodes what the speech act participants 'take for granted.' Instead, we take the local context of an expression E in a sentence S to be the smallest domain that one may restrict attention to when assessing E without jeopardizing the truth conditions of S. To match the results of dynamic semantics, local contexts must be computed incrementally, using only information about the expressions that precede E. This version of the theory can be shown to be nearly equivalent to the dynamic theory of Heim 1983 -- but unlike the latter, it is entirely predictive. We also suggest that local contexts can, at some cost, be computed symmetrically, taking into account information about all of S (except E; this leads to gradient predictions, whose assessment is left for future research. doi:10.3765/sp.2.3 BibTeX info

  9. Channelization in Porous Media driven by Erosion and Deposition

    CERN Document Server

    Jäger, Robin; Herrmann, Hans Jürgen

    2016-01-01

    We develop and validate a new model to study simultaneous erosion and deposition in three-dimensional porous media. We study the changes of the porous structure induced by the deposition and erosion of matter on the solid surface and find that when both processes are active, channelization in the porous structure always occurs. The channels can be stable or only temporary depending mainly on the driving mechanism. Whereas a fluid driven by a constant pressure drop in general does not form steady channels, imposing a constant flux always produces stable channels within the porous structure. Furthermore we investigate how changes of the local deposition and erosion properties affect the final state of the porous structure, finding that the larger the range of wall shear stress for which there is neither erosion nor deposition, the more steady channels are formed in the structure.

  10. Improving Virtual Channel Discrimination in a Multi-Channel Context

    OpenAIRE

    Srinivasan, Arthi G.; Shannon, Robert V.; Landsberger, David M.

    2012-01-01

    Improving spectral resolution in cochlear implants is key to improving performance in difficult listening conditions (e.g. speech in noise, music, etc.). Current focusing might reduce channel interaction, thereby increasing spectral resolution. Previous studies have shown that combining current steering and current focusing reduces spread of excitation and improves virtual channel discrimination in a single-channel context. It is unclear whether the single-channel benefits from current focusi...

  11. Coupled-channel optical calculation for positron-lithium scattering

    Institute of Scientific and Technical Information of China (English)

    Liu Fang; Cheng Yong-Jun; Zhou Ya-Jun

    2012-01-01

    Positron scattering with atomic lithium is investigated by using a coupled-channel optical method.The ionization continuum and positronium formation channels are taken into account via a complex equivalent-local optical potential.The positronium formation cross sections and the ionization cross sections,as well as the total scattering cross sections,are reported at energies above 3 eV and compared with available experimental and theoretical data.

  12. Early monitoring of the human polyomavirus BK replication and sequencing analysis in a cohort of adult kidney transplant patients treated with basiliximab

    Directory of Open Access Journals (Sweden)

    Mischitelli Monica

    2011-08-01

    Full Text Available Abstract Background Nowadays, better immunosuppressors have decreased the rates of acute rejection in kidney transplantation, but have also led to the emergence of BKV-associated nephropathy (BKVAN. Therefore, we prospectively investigated BKV load in plasma and urine samples in a cohort of kidney transplants, receiving basiliximab combined with a mycophenolate mofetil-based triple immunotherapy, to evaluate the difference between BKV replication during the first 3 months post-transplantation, characterized by the non-depleting action of basiliximab, versus the second 3 months, in which the maintenance therapy acts alone. We also performed sequencing analysis to assess whether a particular BKV subtype/subgroup or transcriptional control region (TCR variants were present. Methods We monitored BK viruria and viremia by quantitative polymerase chain reaction (Q-PCR at 12 hours (Tx, 1 (T1, 3 (T2 and 6 (T3 months post-transplantation among 60 kidney transplant patients. Sequencing analysis was performed by nested-PCR with specific primers for TCR and VP1 regions. Data were statistically analyzed using χ2 test and Student's t-test. Results BKV was detected at Tx in 4/60 urine and in 16/60 plasma, with median viral loads of 3,70 log GEq/mL and 3,79 log GEq/mL, respectively, followed by a significant increase of both BKV-positive transplants (32/60 and median values of viruria (5,78 log GEq/mL and viremia (4,52 log GEq/mL at T2. Conversely, a significantly decrease of patients with viruria and viremia (17/60 was observed at T3, together with a reduction of the median urinary and plasma viral loads (4,09 log GEq/mL and 4,00 log GEq/mL, respectively. BKV TCR sequence analysis always showed the presence of archetypal sequences, with a few single-nucleotide substitutions and one nucleotide insertion that, interestingly, were all representative of the particular subtypes/subgroups we identified by VP1 sequencing analysis: I/b-2 and IV/c-2. Conclusions Our

  13. Geysering in boiling channels

    Energy Technology Data Exchange (ETDEWEB)

    Aritomi, Masanori; Takemoto, Takatoshi [Tokyo Institute of Technology, Tokyo (Japan); Chiang, Jing-Hsien [Japan NUS Corp. Ltd., Toyko (Japan)] [and others

    1995-09-01

    A concept of natural circulation BWRs such as the SBWR has been proposed and seems to be promising in that the primary cooling system can be simplified. The authors have been investigating thermo-hydraulic instabilities which may appear during the start-up in natural circulation BWRs. In our previous works, geysering was investigated in parallel boiling channels for both natural and forced circulations, and its driving mechanism and the effect of system pressure on geysering occurrence were made clear. In this paper, geysering is investigated in a vertical column and a U-shaped vertical column heated in the lower parts. It is clarified from the results that the occurrence mechanism of geysering and the dependence of system pressure on geysering occurrence coincide between parallel boiling channels in circulation systems and vertical columns in non-circulation systems.

  14. Lipid Ion Channels

    CERN Document Server

    Heimburg, Thomas

    2010-01-01

    The interpretation electrical phenomena in biomembranes is usually based on the assumption that the experimentally found discrete ion conduction events are due to a particular class of proteins called ion channels while the lipid membrane is considered being an inert electrical insulator. The particular protein structure is thought to be related to ion specificity, specific recognition of drugs by receptors and to macroscopic phenomena as nerve pulse propagation. However, lipid membranes in their chain melting regime are known to be highly permeable to ions, water and small molecules, and are therefore not always inert. In voltage-clamp experiments one finds quantized conduction events through protein-free membranes in their melting regime similar to or even undistinguishable from those attributed to proteins. This constitutes a conceptual problem for the interpretation of electrophysiological data obtained from biological membrane preparations. Here, we review the experimental evidence for lipid ion channels...

  15. Ion Channels, Natural Nanovalves

    OpenAIRE

    Eisenberg, Bob

    2012-01-01

    Ion channels are proteins with holes down their middle that control the flow of ions and electric current across otherwise impermeable biological membranes. The flow of sodium, potassium, calcium (divalent), and chloride ions have been central issues in biology for more than a century. The flow of current is responsible for the signals of the nervous system that propagate over long distances (meters). The concentration of divalent calcium ions is a 'universal' signal that controls many differ...

  16. Proton channel models

    OpenAIRE

    Pupo, Amaury; Baez-Nieto, David; Martínez, Agustín; Latorre, Ramón; González, Carlos

    2014-01-01

    Voltage-gated proton channels are integral membrane proteins with the capacity to permeate elementary particles in a voltage and pH dependent manner. These proteins have been found in several species and are involved in various physiological processes. Although their primary topology is known, lack of details regarding their structures in the open conformation has limited analyses toward a deeper understanding of the molecular determinants of their function and regulation. Consequently, the f...

  17. Athermal channeled spectropolarimeter

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Julia Craven

    2015-12-08

    A temperature insensitive (athermal) channeled spectropolarimeter (CSP) is described. The athermal CSP includes a crystal retarder formed of a biaxial crystal. The crystal retarder has three crystal axes, wherein each axis has its own distinct index of refraction. The axes are oriented in a particular manner, causing an amplitude modulating carrier frequency induced by the crystal retarder to be thermally invariant. Accordingly, a calibration beam technique can be used over a relatively wide range of ambient temperatures, with a common calibration data set.

  18. Radar channel balancing with commutation

    Energy Technology Data Exchange (ETDEWEB)

    Doerry, Armin Walter

    2014-02-01

    When multiple channels are employed in a pulse-Doppler radar, achieving and maintaining balance between the channels is problematic. In some circumstances the channels may be commutated to achieve adequate balance. Commutation is the switching, trading, toggling, or multiplexing of the channels between signal paths. Commutation allows modulating the imbalance energy away from the balanced energy in Doppler, where it can be mitigated with filtering.

  19. Channelization of plumes beneath ice shelves

    KAUST Repository

    Dallaston, M. C.

    2015-11-11

    © 2015 Cambridge University Press. We study a simplified model of ice-ocean interaction beneath a floating ice shelf, and investigate the possibility for channels to form in the ice shelf base due to spatial variations in conditions at the grounding line. The model combines an extensional thin-film description of viscous ice flow in the shelf, with melting at its base driven by a turbulent ocean plume. Small transverse perturbations to the one-dimensional steady state are considered, driven either by ice thickness or subglacial discharge variations across the grounding line. Either forcing leads to the growth of channels downstream, with melting driven by locally enhanced ocean velocities, and thus heat transfer. Narrow channels are smoothed out due to turbulent mixing in the ocean plume, leading to a preferred wavelength for channel growth. In the absence of perturbations at the grounding line, linear stability analysis suggests that the one-dimensional state is stable to initial perturbations, chiefly due to the background ice advection.

  20. Ion channeling revisited

    Energy Technology Data Exchange (ETDEWEB)

    Doyle, Barney Lee [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Corona, Aldo [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Nguyen, Anh [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-09-01

    A MS Excel program has been written that calculates accidental, or unintentional, ion channeling in cubic bcc, fcc and diamond lattice crystals or polycrystalline materials. This becomes an important issue when simulating the creation by energetic neutrons of point displacement damage and extended defects using beams of ions. All of the tables and graphs in the three Ion Beam Analysis Handbooks that previously had to be manually looked up and read from were programed into Excel in handy lookup tables, or parameterized, for the case of the graphs, using rather simple exponential functions with different powers of the argument. The program then offers an extremely convenient way to calculate axial and planar half-angles and minimum yield or dechanneling probabilities, effects on half-angles of amorphous overlayers, accidental channeling probabilities for randomly oriented crystals or crystallites, and finally a way to automatically generate stereographic projections of axial and planar channeling half-angles. The program can generate these projections and calculate these probabilities for axes and [hkl] planes up to (555).

  1. The alpha channeling effect

    Energy Technology Data Exchange (ETDEWEB)

    Fisch, N. J.

    2015-12-10

    Alpha particles born through fusion reactions in a tokamak reactor tend to slow down on electrons, but that could take up to hundreds of milliseconds. Before that happens, the energy in these alpha particles can destabilize on collisionless timescales toroidal Alfven modes and other waves, in a way deleterious to energy confinement. However, it has been speculated that this energy might be instead be channeled into useful energy, so as to heat fuel ions or to drive current. Such a channeling needs to be catalyzed by waves Waves can produce diffusion in energy of the alpha particles in a way that is strictly coupled to diffusion in space. If these diffusion paths in energy-position space point from high energy in the center to low energy on the periphery, then alpha particles will be cooled while forced to the periphery. The energy from the alpha particles is absorbed by the wave. The amplified wave can then heat ions or drive current. This process or paradigm for extracting alpha particle energy collisionlessly has been called alpha channeling. While the effect is speculative, the upside potential for economical fusion is immense. The paradigm also operates more generally in other contexts of magnetically confined plasma.

  2. DMT of weighted Parallel Channels: Application to Broadcast Channel

    CERN Document Server

    Mroueh, Lina; Othman, Ghaya Rekaya-Ben; Belfiore, Jean-Claude

    2008-01-01

    In a broadcast channel with random packet arrival and transmission queues, the stability of the system is achieved by maximizing a weighted sum rate capacity with suitable weights that depend on the queue size. The weighted sum rate capacity using Dirty Paper Coding (DPC) and Zero Forcing (ZF) is asymptotically equivalent to the weighted sum capacity over parallel single-channels. In this paper, we study the Diversity Multiplexing Tradeoff (DMT) of the fading broadcast channel under a fixed weighted sum rate capacity constraint. The DMT of both identical and different parallel weighted MISO channels is first derived. Finally, we deduce the DMT of a broadcast channel using DPC and ZF precoders.

  3. Locals Collection

    Directory of Open Access Journals (Sweden)

    Stephen Hastings-King

    2010-03-01

    Full Text Available A locals collection is a set of parameters that are used to delimit data-mining operations. This piece uses a collection of locals from around Essex Massachusetts to shape and delimit an interrogation of post-reality in contemporary America. It explores the notion of crisis, the possibility of a crisis of empire that may or may not emerge in a media-space that does not allow crisis of empire to be mentioned and relations this maybe-crisis to the various levels of economic dysfunction that have become evident since late 2008. But mostly this piece explores ways in which particular stories about particular people do and do not link/link to these larger-scale narratives. This is the first of a potential series of locals collections that will mine the American post-real.

  4. Cascading blockages in channel bundles.

    Science.gov (United States)

    Barré, C; Talbot, J

    2015-11-01

    Flow in channel networks may involve a redistribution of flux following the blockage or failure of an individual link. Here we consider a simplified model consisting of N(c) parallel channels conveying a particulate flux. Particles enter these channels according to a homogeneous Poisson process and an individual channel blocks if more than N particles are simultaneously present. The behavior of the composite system depends strongly on how the flux of entering particles is redistributed following a blockage. We consider two cases. In the first, the intensity on each open channel remains constant while in the second the total intensity is evenly redistributed over the open channels. We obtain exact results for arbitrary N(c) and N for a system of independent channels and for arbitrary N(c) and N=1 for coupled channels. For N>1 we present approximate analytical as well as numerical results. Independent channels block at a decreasing rate due to a simple combinatorial effect, while for coupled channels the interval between successive blockages remains constant for N=1 but decreases for N>1. This accelerating cascade is due to the nonlinear dependence of the mean blocking time of a single channel on the entering particle flux that more than compensates for the decrease in the number of active channels.

  5. Micro-channel plate detector

    Energy Technology Data Exchange (ETDEWEB)

    Elam, Jeffrey W.; Lee, Seon W.; Wang, Hsien -Hau; Pellin, Michael J.; Byrum, Karen; Frisch, Henry J.

    2015-09-22

    A method and system for providing a micro-channel plate detector. An anodized aluminum oxide membrane is provided and includes a plurality of nanopores which have an Al coating and a thin layer of an emissive oxide material responsive to incident radiation, thereby providing a plurality of radiation sensitive channels for the micro-channel plate detector.

  6. Nomenclature for Ion channel Subunits

    OpenAIRE

    Bradley, Jonathan; Frings, Stephan; Yau, King-Wai; Reed, Randall

    2001-01-01

    Presents the nomenclature for ion channel subunits. Role of ion channels in the mediation of visual and olfactory signal transduction; Expression of ion channels in cell types and tissues; Assessment on the nucleotide sensitivity, ion conductance and calcium modulation in heteromers.

  7. Submarine channel evolution linked to rising salt domes, Gulf of Mexico, USA

    Science.gov (United States)

    Carter, Rachel C.; Gani, M. Royhan; Roesler, Toby; Sarwar, Abu K. M.

    2016-08-01

    An examination of halokinetics and channel evolution together in a deepwater system provides an opportunity to investigate how submarine channel morphology is locally affected by rising salt domes. The study area is located in the northern Gulf of Mexico (GOM), directly off the Louisiana continental slope in a prominent salt dome region. The influence of salt growth on submarine channel evolution is relatively understudied, particularly in the GOM. Utilizing high-resolution 3D seismic and well data and seismic geomorphology techniques, a long-lived (~ 3 Myr) Plio-Pleistocene submarine channel system has been investigated to show a relationship between variable phases of salt motion and planform morphology of preserved submarine channels. Our data suggest that local salt motion acts as a driver for submarine channel evolution. During the late Pliocene, when salt moved upward at a relatively fast rate, channels show distinct entrenchment with narrow channel belts and overall less sinuosity. When salt motion slowed down at the beginning of the Pleistocene, channels aggraded rapidly with preserved levees, and moved toward an equilibrium state with the expansion of channel belt widths. As our results indicate, the rate of salt diapirism exerted a first-order control on channel location and morphology and distribution of reservoir-prone units. This study cautions against readily invoking allogenic factors (e.g., sea level and climate) in explaining changes in submarine channel behavior and associated fan sedimentation, particularly in regions with salt tectonics.

  8. Computer modeling of self-assembly of the crystal structure of zeolite Na384[Al384Si384O1536] (H2O)422 (LTN, cF4080) from suprapolyhedral cluster precursors AB2 (A-K48, B-K24)

    International Nuclear Information System (INIS)

    Combinatorial and topological analyses and a simulation of the self-assembly of zeolite crystal structure Na384Al384Si384O1536 · 422H2O (LTN, sp. gr. Fd3 bar) have been performed using computer methods (TOPOS program package). A cubic cell with the parameters a = 36.95 Å and V = 50 449 Å3 contains 768 framework-forming AlO4- and SiO4 tetrahedra (T tetrahedra). The method of complete expansion of a 3D factor graph in nonintersecting cluster substructures in the tetrahedral T framework was used to reveal nanocluster precursors: A composed of 48 T tetrahedra (A-K48) and B composed of 24 T tetrahedra (B-K24). The nanocluster precursors A and B correspond to the polyhedral T clusters (tiles) 48T-grc and 24T-toc; they are involved in the matrix self-assembly of the crystal structure within the supracluster AB2. The centers of clusters A and B occupy the positions of Mg and Cu atoms in the Laves net AB2 = MgCu2; i.e., the zeolite structure is a suprapolyhedral analog of an intermetallic compound. The self-assembly code of a 3D structure from complementary bound nanocluster precursors is completely reconstuctured in the following form: supracluster → primary chain → microlayer → microframework → ...framework. The localization of the Na+ template cations in the 6T- and 8T rings of nanocluster precursors A and B and Na+ spacer cations in the 28T-ltn tile with the formation of tetrahedral configuration and in the center of 6-ring, which arises as a result of bonding two B nanoclusters, is established.

  9. Inhibition of voltage-gated sodium channels by sumatriptan bioisosteres

    Directory of Open Access Journals (Sweden)

    Roberta eCarbonara

    2015-07-01

    Full Text Available Voltage-gated sodium channels are known to play a pivotal role in perception and transmission of pain sensations. Gain-of-function mutations in the genes encoding the peripheral neuronal sodium channels, hNav1.7-1.9, cause human painful diseases. Thus while treatment of chronic pain remains an unmet clinical need, sodium channel blockers are considered as promising druggable targets. In a previous study, we evaluated the analgesic activity of sumatriptan, an agonist of serotonin 5HT1B/D receptors, and some new chiral bioisosteres, using the hot plate test in the mouse. Interestingly, we observed that the analgesic effectiveness was not necessarily correlated to serotonin agonism. In this study, we evaluated whether sumatriptan and its congeners may inhibit heterologously-expressed hNav1.7 sodium channels using the patch-clamp method. We show that sumatriptan blocks hNav1.7 channels only at very high, supratherapeutic concentrations. In contrast, its three analogues, namely 20b, (R-31b, and (S-22b, exert a dose and use-dependent sodium channel block. At 0.1 and 10 Hz stimulation frequencies, the most potent compound, (S-22b, was 4.4 and 1.7 fold more potent than the well-known sodium channel blocker mexiletine. The compound induces a negative shift of voltage dependence of fast inactivation, suggesting higher affinity to the inactivated channel. Accordingly, we show that (S-22b likely binds the conserved local anesthetic receptor within voltage-gated sodium channels. Combining these results with the previous ones, we hypothesize that use-dependent sodium channel blockade contributes to the analgesic activity of (R-31b and (S-22b. These later compounds represent promising lead compounds for the development of efficient analgesics, the mechanism of action of which may include a dual action on sodium channels and 5HT1D receptors.

  10. Local Volume TiNy Titans: gaseous dwarf-dwarf interactions in the Local Universe

    Science.gov (United States)

    Pearson, Sarah; Besla, Gurtina; Putman, Mary E.; Lutz, Katharina A.; Fernández, Ximena; Stierwalt, Sabrina; Patton, David R.; Kim, Jinhyub; Kallivayalil, Nitya; Johnson, Kelsey; Sung, Eon-Chang

    2016-06-01

    In this paper, we introduce the Local Volume TiNy Titans sample (LV-TNT), which is a part of a larger body of work on interacting dwarf galaxies: TNT . This LV-TNT sample consists of 10 dwarf galaxy pairs in the Local Universe (supply channel until accretion by a more massive host.

  11. Local language

    NARCIS (Netherlands)

    Monique Turkenburg

    2002-01-01

    Original title: Taal lokaal. Children of immigrants living in the Netherlands have for years had the opportunity to receive lessons in their mother tongue at primary school. Since 1998 this has been referred to as minority language teaching (OALT in Dutch), and has been the responsibility of local

  12. Localized scleroderma.

    Science.gov (United States)

    Kreuter, Alexander

    2012-01-01

    Localized scleroderma (also called morphea) is a term encompassing a spectrum of sclerotic autoimmune diseases that primarily affect the skin, but also might involve underlying structures such as the fat, fascia, muscle, and bones. Its exact pathogenesis is still unknown, but several trigger factors in genetically predisposed individuals might initially lead to an immunologically triggered release of pro-inflammatory cytokines, resulting in a profound dysregulation of the connective tissue metabolism and ultimately to induction of fibrosis. To date, there are no specific serological markers available for localized scleroderma. Within the last years, several validated clinical scores have been introduced as potential outcome measures for the disease. Given the rarity of localized scleroderma, only few evidence-based therapeutical treatment options exist. So far, the most robust data is available for ultraviolet A1 phototherapy in disease that is restricted to the skin, and methotrexate alone or in combination with systemic corticosteroids in more severe disease that additionally affects extracutaneous structures. This practical review summarizes relevant information on the epidemiology, pathogenesis, clinical subtypes and classifications, differential diagnoses, clinical scores and outcome measures, and current treatment strategies of localized scleroderma. PMID:22741933

  13. Perfect Entanglement Teleportation via Two Parallel W State Channels

    Institute of Scientific and Technical Information of China (English)

    WANG Mei-Yu; YAN Feng-Li

    2011-01-01

    We present a scheme for perfectly teleporting a two-qubit entangled state via two parallel W state channels. The scheme consists of a positive operator valued measurement (POVM), classical communication and the corresponding local unitary operation. How to realize the POVM using unitary operation and projective measurement is explicitly designed.%@@ We present a scheme for perfectly teleporting a two-qubit entangled state via two parallel W state channels.The scheme consists of a positive operator valued measurement (POVM), classical communication and the corre- sponding local unitary operation.How to realize the POVM using unitary operation and projective measurement is explicitly designed.

  14. Channel stability downstream from a dam assessed using aerial photographs and stream-gage information

    Science.gov (United States)

    Juracek, K.E.

    2000-01-01

    The stability of the Neosho River channel downstream from John Redmond Dam, in southeast Kansas, was investigated using multiple-date aerial photographs and stream-gage information. Bankfull channel width was used as the primary indicator variable to assess pre- and post-dam channel change. Five six-mile river reaches and four stream gages were used in the analysis. Results indicated that, aside from some localized channel widening, the overall channel change has been minor with little post-dam change in bankfull channel width. The lack of a pronounced postdam channel change may be attributed to a substantial reduction in the magnitude of the post-dam annual peak discharges in combination with the resistance to erosion of the bed and bank materials. Also, the channel may have been overwidened by a series of large floods that predated construction of the dam, including one with an estimated 500-year recurrence interval.

  15. Bargaining and the MISO Interference Channel

    Science.gov (United States)

    Nokleby, Matthew; Swindlehurst, A. Lee

    2009-12-01

    We examine the MISO interference channel under cooperative bargaining theory. Bargaining approaches such as the Nash and Kalai-Smorodinsky solutions have previously been used in wireless networks to strike a balance between max-sum efficiency and max-min equity in users' rates. However, cooperative bargaining for the MISO interference channel has only been studied extensively for the two-user case. We present an algorithm that finds the optimal Kalai-Smorodinsky beamformers for an arbitrary number of users. We also consider joint scheduling and beamformer selection, using gradient ascent to find a stationary point of the Kalai-Smorodinsky objective function. When interference is strong, the flexibility allowed by scheduling compensates for the performance loss due to local optimization. Finally, we explore the benefits of power control, showing that power control provides nontrivial throughput gains when the number of transmitter/receiver pairs is greater than the number of transmit antennas.

  16. Differential effects of blockade of ERG channels on gamma oscillations and excitability in rat hippocampal slices.

    Science.gov (United States)

    Fano, Silvia; Çalışkan, Gürsel; Heinemann, Uwe

    2012-12-01

    Agents such as sertindole and astemizole affect heart action by inducing long-QT syndrome, suggesting that apart from their neuronal actions through histamine receptors, 5-HT2 serotonin receptors and D2 dopamine receptors they also affect ether-a-go-go channels and particularly ether-a-go-go-related (ERG) potassium (K(+)) channels, comprising the K(v) 11.1, K(v) 11.2 and K(v) 11.3 voltage-gated potassium currents. Changes in ERG K(+) channel expression and activity have been reported and may be linked to schizophrenia [Huffaker, S.J., Chen, J., Nicodemus, K.K., Sambataro, F., Yang, F., Mattay, V., Lipska, B.K., Hyde, T.M., Song, J., Rujescu, D., Giegling, I., Mayilyan, K., Proust, M.J., Soghoyan, A., Caforio, G., Callicott, J.H., Bertolino, A., Meyer-Lindenberg, A., Chang, J., Ji, Y., Egan, M.F., Goldberg, T.E., Kleinman, J.E., Lu, B. & Weinberger DR. (2009). Nat. Med., 15, 509-518; Shepard, P.D., Canavier, C.C. & Levitan, E.S. (2007). Schizophr Bull., 33, 1263-1269]. We have previously shown that histamine H1 blockers augment gamma oscillations (γ) which are thought to be involved in cognition and storage of information. These effects were particularly pronounced for γ induced by acetylcholine. Here we have compared neuronal effects of three agents which interfere with ERG K(+) channels. We found that astemizole and sertindole, but not the K(v) 11 channel blocker E4031, augmented γ induced by acetylcholine in hippocampal slices. Kainate-induced γ were only affected by astemizole. Evoked responses induced by stratum radiatum stimulation in area CA1 revealed that only E4031 augmented stimulus-induced synaptic potentials and neuronal excitability. Our findings suggest that K(v) 11 channels are involved in neuronal excitability without clear effects on γ and that the effect of astemizole is related to actions on H1 receptors. PMID:23050739

  17. QKD Quantum Channel Authentication

    OpenAIRE

    Kosloski, J. T.

    2006-01-01

    Several simple yet secure protocols to authenticate the quantum channel of various QKD schemes, by coupling the photon sender's knowledge of a shared secret and the QBER Bob observes, are presented. It is shown that Alice can encrypt certain portions of the information needed for the QKD protocols, using a sequence whose security is based on computational-complexity, without compromising all of the sequence's entropy. It is then shown that after a Man-in-the-Middle attack on the quantum and c...

  18. Internal channel structures in trabecular bone

    Science.gov (United States)

    Scherf, Heike; Beckmann, Felix; Fischer, Jens; Witte, Frank

    2004-10-01

    Material properties of bone are crucial for studies regarding the mechanical behavior of bone. The mechanical behavior depends on the macro- and micro-architecture as well as the organic and mineral content of bone. The marco-architecture of bone is normally analyzed by plane radiographs. The micro-architecture of the trabecular bone can be imaged by high resolution CT imaging techniques using conventional x-ray tubes. However, fine structures in bone architecture cannot be sufficiently analyzed by this technique due to its limited resolution. High resolution CT imaging technique using synchrotron radiation generates images with a high spatial resolution of bone structures on a micron scale. Additionally, this imaging technique provides superior determination of local differences in the bone mineral density. Two microtomography techniques, first: based on conventional x-ray tubes and second: based on synchrotron radiation were compared in this study to detect fine bone structures such as inner trabecular channels. In two red howler monkeys (Alouatta seniculus) femora channel structures were found inside the trabecular bone by both techniques. Only synchrotron-based microtomography was able to detect layers of lower mineral density in the channel walls. The found structures in trabecular bone are normally expected in the Haversian channel walls of the cortical bone. However, the origin of the trabecular channel structure is not fully understood. We found, that synchrotron-based microtomography is a very valuable technique in the research of fine bone structures. Further research should focus on the impact of these findings on the mechanical properties of trabecular bone.

  19. Convection in a vertical channel

    Energy Technology Data Exchange (ETDEWEB)

    Tisserand, J-C; Creyssels, M; Gibert, M; Castaing, B; Chilla, F, E-mail: Francesca.Chilla@ens-lyon.f [Universite de Lyon, ENS Lyon, UMR 5672 CNRS, 46 Allee d' Italie, 69364 Lyon Cedex 7 (France)

    2010-07-15

    The flow generated by heat convection in a long, vertical channel is studied by means of particle imagery velocimetry techniques, with the help of the thermal measurements from a previous paper (Gibert et al 2009 Phys. Fluids 21 035109). We analyse the mean velocity profiles and the Reynolds stresses, and compare the present results with the previous ones obtained in a larger cell and at a larger Reynolds number. We calculate the horizontal temperature profile and the related horizontal heat flux. The pertinence of effective turbulent diffusivity and viscosity is confirmed by the low value of the associated mixing length. We study the one-point and two-point statistics of both velocity components. We show how the concept of turbulent viscosity explains the relations between the local probability density functions (pdf) of fluctuations for temperature, vertical and horizontal velocity components. Despite the low Reynolds number values explored, some conclusions can be drawn about the small scale velocity differences and the related energy cascade.

  20. Regulation of cell proliferation of human induced pluripotent stem cell-derived mesenchymal stem cells via ether-à-go-go 1 (hEAG1) potassium channel.

    Science.gov (United States)

    Zhang, Jiao; Chan, Yau-Chi; Ho, Jenny Chung-Yee; Siu, Chung-Wah; Lian, Qizhou; Tse, Hung-Fat

    2012-07-15

    The successful generation of a high yield of mesenchymal stem cells (MSCs) from human induced pluripotent stem cells (iPSCs) may represent an unlimited cell source with superior therapeutic benefits for tissue regeneration to bone marrow (BM)-derived MSCs. We investigated whether the differential expression of ion channels in iPSC-MSCs was responsible for their higher proliferation capacity than BM-MSCs. The expression of ion channels for K(+), Na(+), Ca(2+), and Cl(-) was examined by RT-PCR. The electrophysiological properties of iPSC-MSCs and BM-MSCs were then compared by patch-clamp experiments to verify their functional roles. Significant mRNA expression of ion channel genes including KCa1.1, KCa3.1, KCNH1, Kir2.1, SCN9A, CACNA1C, and Clcn3 was observed in both human iPSC-MSCs and BM-MSCs, whereas Kir2.2 and Kir2.3 were only detected in human iPSC-MSCs. Five types of currents [big-conductance Ca(2+)-activated K(+) current (BK(Ca)), delayed rectifier K(+) current (IK(DR)), inwardly rectifying K(+) current (I(Kir)), Ca(2+)-activated K(+) current (IK(Ca)), and chloride current (I(Cl))] were found in iPSC-MSCs (83%, 47%, 11%, 5%, and 4%, respectively) but only four of them (BK(Ca), IK(DR), I(Kir), and IK(Ca)) were identified in BM-MSCs (76%, 25%, 22%, and 11%, respectively). Cell proliferation was examined with MTT or bromodeoxyuridine assay, and doubling times were 2.66 and 3.72 days for iPSC-MSCs and BM-MSCs, respectively, showing a 1.4-fold discrepancy. Blockade of IK(DR) with short hairpin RNA or human ether-à-go-go 1 (hEAG1) channel blockers, 4-AP and astemizole, significantly reduced the rate of proliferation of human iPSC-MSCs. These treatments also decreased the rate of proliferation of human BM-MSCs albeit to a lesser extent. These findings demonstrate that the hEAG1 channel plays a crucial role in controlling the proliferation rate of human iPSC-MSCs and to a lesser extent in BM-MSCs. PMID:22357737

  1. Local Group

    Science.gov (United States)

    Mateo, M.; Murdin, P.

    2000-11-01

    Not long after EDWIN HUBBLE established that galaxies are `island universes' similar to our home galaxy, the MILKY WAY, he realized that a few of these external galaxies are considerably closer to us than any others. In 1936 he first coined the term `Local Group' in his famous book The Realm of the Nebulae to identify our nearest galactic neighbors. More than 60 yr later, the galaxies of the Loca...

  2. Optimization of culture conditions for producing 2-keto-D-gluconic acid by an isolated strain of Serratia sp. BK-98%产2-酮基-D-葡萄糖酸菌Serratiasp.BK-98的分离及其培养条件优化

    Institute of Scientific and Technical Information of China (English)

    张炜; 谢志鹏; 张建国

    2011-01-01

    A strain capable of producing 2-keto-D-gluconic acid (2-KDG) was isolated from soil. The phylogenetic analysis based on 16S rDNA suggested the isolate was assigned to genus Serratia and named Serratia sp. BK-98. Medium loading volume,fermentation time and initial pH were found to be most significant factors affecting 2-KDG production using Plackett-Burman (PB) design and their values were optimized to be 6.6mL in a 100mL Erlenmeyer flask of medium loading volume,57.9h of fermentation time and 5.0 of initial pH respectively with response surface methodology (RSM) based on central composite design (CCD). Under the optimized fermentation conditions,2-KDG production in a 100mL Erlenmeyer flask and in a 100L fermenter reached 187.8g/L and 192.2g/L respectively,142.6% and 148.3% increase respectively as compared with the pre-optimized conditions. A close agreement with the predicted value of 191.4g/L indicated that the proposed relationship model between the impact factors and 2-KDG production was very practical.%从土壤中分离得到一株2-酮基-D-葡萄糖酸(2-KDG)产生菌,综合16SrDNA序列和系统进化分析确定该菌属于沙雷氏菌属(Serratia),命名为Serratiasp.BK-98。采用PIackett—Burman(PB)实验设计,从影响2-酮基-D-葡萄糖酸生物合成条件的14个因素中筛选出具有显著效应的3个因子:装液量、发酵时间和初始pH。在此基础上通过中心组合设计实验(central composite design,CCD)和响应面分析(response surface methodology,RSM)确定了装液量、发酵时间和初始DH的最适值分别为6.6mL、57.9h和5.0。在优化条件下.2-KDG的100mL摇瓶发酵产量达到了187.8g/L,100L发酵罐产量达到了192.2g/L.分别较优化前提高了142.6%和148.3%.这两个实验结果均与模型的预测值191.4g/L非常接近。

  3. Improving virtual channel discrimination in a multi-channel context.

    Science.gov (United States)

    Srinivasan, Arthi G; Shannon, Robert V; Landsberger, David M

    2012-04-01

    Improving spectral resolution in cochlear implants is key to improving performance in difficult listening conditions (e.g. speech in noise, music, etc.). Current focusing might reduce channel interaction, thereby increasing spectral resolution. Previous studies have shown that combining current steering and current focusing reduces spread of excitation and improves virtual channel discrimination in a single-channel context. It is unclear whether the single-channel benefits from current focusing extend to a multi-channel context, in which the physical and perceptual interference of multiple stimulated channels might overwhelm the benefits of improved spectral resolution. In this study, signal discrimination was measured with and without current focusing, in the presence of competing stimuli on nearby electrodes. Results showed that signal discrimination was consistently better with current focusing than without, regardless of the amplitude of the competing stimuli. Therefore, combining current steering and current focusing may provide more effective spectral cues than are currently available. PMID:22616092

  4. EFFICIENT UTILIZATION OF CHANNELS USING DYNAMIC GUARD CHANNEL ALLOCATION WITH CHANNEL BORROWING STRATEGY IN HANDOFFS

    Directory of Open Access Journals (Sweden)

    Alagu S

    2012-05-01

    Full Text Available User mobility in wireless data networks is increasing because of technological advances and the desire for voice and multimedia applications. These applications, however, require fast handoffs between base stations to maintain the quality of the connections. In this paper, the authors describe the use of novel and efficient data structure which dynamically allocates guard channel for handoffs and introduces the concept of channel borrowing strategy. The proposed scheme allocates the guard channels for handoff requests dynamically, based on the traffic load for certain time period. A new originating call in the cell coverage area also uses these guard channels if they are unused. Our basic idea is to allow Guard channels to be shared between new calls and handoff calls. This approach maximizes the channel utilization. The simulation results prove that the channel borrowing scheme improves the overall throughput.

  5. Multiuser MIMO Channel Estimation

    Directory of Open Access Journals (Sweden)

    G.Indumathi

    2016-05-01

    Full Text Available In this paper, three beamforming design are considered for multi user MIMO system. First, transmit beamformers are fixed and the receive (RX beamformers are calculated. Transmit beamformer (TX-BFis projectedas a null space of appropriate channels. It reduces the interference for each user. Then the receiver beamformer is determined which maximize the SNR. This beamforming design provides less computation time. The second case is joint TX and RX beamformer for SNR maximization. In this transmitter and receiver beamformer are calculated using extended alternating optimization (EAO algorithm. The third one is joint transmitter and receiver beamforming for SNR and SINR maximization using EAO algorithm. This algorithm provides better error performance and sum rate performance. All the design cases are simulated by using standard multipath channel model. Our simulation results illustrate that compared to the least square design and zero forcing design, the joint TX and RX beamforming design using EAO algorithm provides faster beamforming and improved error performance and sum rate.

  6. 沙雷氏菌Serratia sp.BK-98发酵生产2-酮基-D-葡萄糖酸的工艺优化及动力学研究%Fermentation process optimization and kinetics studies of 2-keto-D-gluconic acid production by Serratia sp. BK-98

    Institute of Scientific and Technical Information of China (English)

    张炜; 谢志鹏; 罗玮; 张建国

    2011-01-01

    @@ 引言 2-酮基-D-葡萄糖酸(2-KDG)有着广泛的用途,它能被用作食品添加剂、水泥增塑剂、洗涤剂,是照片显影剂的重要成分[1];同时它也是除草剂[2]、D-核酮糖、D-阿拉伯糖,特别是D-异抗坏血酸合成过程中的重要前体.%Based on the optimization of culture conditions for producing 2-keto-D-gluconic acid (2-KDG)by Serratia sp. BK-98 in a Erlenmeyer flask, the factors of dissolved oxygen (DO) and pH affecting 2KDG batch fermentation in 100 L fermenter were further optimized to be 30 % and 6. 0 respectively. Under the DO-stat and pH-stat batch culture conditions, 2-KDG production reached 211.2 g · L-1. The kinetics of DO-stat and pH-stat batch fermentation were also investigated and the models for biomass, substrate consumption and product were established respectively based on the Logistic equation, Leudeking-Piret equation and Modified Leudeking-Piret equation. Curve fittings for the above models by using experimental data were performed by the non-linear least squares method with the software Origin 8.0. With the evaluated model parameters, the calculated values of the models and experimental data were in good agreement and the models could provide guidance for 2-KDG fermentation production.

  7. Quasiperiodic driving of Anderson localized waves in one dimension

    OpenAIRE

    Hatami, H.; Danieli, C.; Bodyfelt, J. D.; Flach, S

    2016-01-01

    We consider a quantum particle in a one-dimensional disordered lattice with Anderson localization, in the presence of multi-frequency perturbations of the onsite energies. Using the Floquet representation, we transform the eigenvalue problem into a Wannier-Stark basis. Each frequency component contributes either to a single channel or a multi-channel connectivity along the lattice, depending on the control parameters. The single channel regime is essentially equivalent to the undriven case. T...

  8. DMT of weighted Parallel Channels: Application to Broadcast Channel

    OpenAIRE

    Mroueh, Lina; Rouquette-Léveil, Stéphanie; Othman, Ghaya Rekaya-Ben; Belfiore, Jean-Claude

    2008-01-01

    In a broadcast channel with random packet arrival and transmission queues, the stability of the system is achieved by maximizing a weighted sum rate capacity with suitable weights that depend on the queue size. The weighted sum rate capacity using Dirty Paper Coding (DPC) and Zero Forcing (ZF) is asymptotically equivalent to the weighted sum capacity over parallel single-channels. In this paper, we study the Diversity Multiplexing Tradeoff (DMT) of the fading broadcast channel under a fixed w...

  9. A Micromechanical RF Channelizer

    Science.gov (United States)

    Akgul, Mehmet

    The power consumption of a radio generally goes as the number and strength of the RF signals it must process. In particular, a radio receiver would consume much less power if the signal presented to its electronics contained only the desired signal in a tiny percent bandwidth frequency channel, rather than the typical mix of signals containing unwanted energy outside the desired channel. Unfortunately, a lack of filters capable of selecting single channel bandwidths at RF forces the front-ends of contemporary receivers to accept unwanted signals, and thus, to operate with sub-optimal efficiency. This dissertation focuses on the degree to which capacitive-gap transduced micromechanical resonators can achieve the aforementioned RF channel-selecting filters. It aims to first show theoretically that with appropriate scaling capacitive-gap transducers are strong enough to meet the needed coupling requirements; and second, to fully detail an architecture and design procedure needed to realize said filters. Finally, this dissertation provides an actual experimentally demonstrated RF channel-select filter designed using the developed procedures and confirming theoretical predictions. Specifically, this dissertation introduces four methods that make possible the design and fabrication of RF channel-select filters. The first of these introduces a small-signal equivalent circuit for parallel-plate capacitive-gap transduced micromechanical resonators that employs negative capacitance to model the dependence of resonance frequency on electrical stiffness in a way that facilitates the analysis of micromechanical circuits loaded with arbitrary electrical impedances. The new circuit model not only correctly predicts the dependence of electrical stiffness on the impedances loading the input and output electrodes of parallel-plate capacitive-gap transduced micromechanical device, but does so in a visually intuitive way that identifies current drive as most appropriate for

  10. Cloning, expression in Pichia pastoris, and characterization of a thermostable GH5 mannan endo-1,4-β-mannosidase from Aspergillus niger BK01

    Directory of Open Access Journals (Sweden)

    Sigoillot Jean-Claude

    2009-11-01

    Full Text Available Abstract Background Mannans are key components of lignocellulose present in the hemicellulosic fraction of plant primary cell walls. Mannan endo-1,4-β-mannosidases (1,4-β-D-mannanases catalyze the random hydrolysis of β-1,4-mannosidic linkages in the main chain of β-mannans. Biodegradation of β-mannans by the action of thermostable mannan endo-1,4-β-mannosidase offers significant technical advantages in biotechnological industrial applications, i.e. delignification of kraft pulps or the pretreatment of lignocellulosic biomass rich in mannan for the production of second generation biofuels, as well as for applications in oil and gas well stimulation, extraction of vegetable oils and coffee beans, and the production of value-added products such as prebiotic manno-oligosaccharides (MOS. Results A gene encoding mannan endo-1,4-β-mannosidase or 1,4-β-D-mannan mannanohydrolase (E.C. 3.2.1.78, commonly termed β-mannanase, from Aspergillus niger BK01, which belongs to glycosyl hydrolase family 5 (GH5, was cloned and successfully expressed heterologously (up to 243 μg of active recombinant protein per mL in Pichia pastoris. The enzyme was secreted by P. pastoris and could be collected from the culture supernatant. The purified enzyme appeared glycosylated as a single band on SDS-PAGE with a molecular mass of approximately 53 kDa. The recombinant β-mannanase is highly thermostable with a half-life time of approximately 56 h at 70°C and pH 4.0. The optimal temperature (10-min assay and pH value for activity are 80°C and pH 4.5, respectively. The enzyme is not only active towards structurally different mannans but also exhibits low activity towards birchwood xylan. Apparent Km values of the enzyme for konjac glucomannan (low viscosity, locust bean gum galactomannan, carob galactomannan (low viscosity, and 1,4-β-D-mannan (from carob are 0.6 mg mL-1, 2.0 mg mL-1, 2.2 mg mL-1 and 1.5 mg mL-1, respectively, while the kcat values for these

  11. Quantum communication using a multiqubit entangled channel

    International Nuclear Information System (INIS)

    We describe a protocol in which two senders each teleport a qubit to a receiver using a multiqubit entangled state. The multiqubit channel used for teleportation is genuinely 4-qubit entangled and is not equivalent to a product of maximally entangled Bell pairs under local unitary operations. We discuss a scenario in which both senders must participate for the qubits to be successfully teleported. Such an all-or-nothing scheme cannot be implemented with standard two-qubit entangled Bell pairs and can be useful for different communication and computing tasks

  12. Quantum communication using a multiqubit entangled channel

    Energy Technology Data Exchange (ETDEWEB)

    Ghose, Shohini, E-mail: sghose@wlu.ca [Department of Physics and Computer Science, Wilfrid Laurier University, Waterloo, Ontario (Canada); Institute for Quantum Computing, University of Waterloo, Ontario (Canada); Hamel, Angele [Department of Physics and Computer Science, Wilfrid Laurier University, Waterloo, Ontario (Canada)

    2015-12-31

    We describe a protocol in which two senders each teleport a qubit to a receiver using a multiqubit entangled state. The multiqubit channel used for teleportation is genuinely 4-qubit entangled and is not equivalent to a product of maximally entangled Bell pairs under local unitary operations. We discuss a scenario in which both senders must participate for the qubits to be successfully teleported. Such an all-or-nothing scheme cannot be implemented with standard two-qubit entangled Bell pairs and can be useful for different communication and computing tasks.

  13. Soft cooperative spectrum sensing performance under imperfect and non identical reporting channels

    KAUST Repository

    Ben Ghorbel, Mahdi

    2015-02-01

    Cooperation among cognitive radio users improves the spectrum sensing performance by combining local decisions measured over independent sensing channels, allowing reduction of miss-detection and false alarm probabilities. While most of the works in cooperative spectrum sensing techniques assume perfect channels between the cooperating users, this paper studies the effect of imperfect channels when local users report their sensed information to the fusion center. Cooperative detection and false-alarm probabilities are derived for a general scheme of imperfect reporting channels under non necessarily identical sensing and reporting channels. Numerical simulations show that imperfect reporting channels should be considered to optimize the cooperative sensing in terms of consumed energy and probability of error.

  14. Spatial Stationarity of Ultrawideband and Millimeter Wave Radio Channels

    DEFF Research Database (Denmark)

    Yi, Tan; Nielsen, Jesper Ødum; Pedersen, Gert F.

    2016-01-01

    For radio channels with broad bandwidth resource, such as those often used for ultrawideband (UWB) and millimeter wave (mmwave) systems, the Wide-Sense Stationary Uncorrelated Scattering (WSSUS) and spatial stationary assumptions are more critical than typical cellular channels with very limited...... bandwidth resource. This paper studies spatial stationarity and bandwidth dependency of the Multipath Component (MPC) parameters, and the concept of local region of stationarity (LRS) is used as the measure of the physical stationarity region. LRS calculation results based on channel measurements show...... that the size of LRS is bandwidth dependent in all measured bands, 2–4 GHz, 14–16 GHz, and 28–30 GHz. The results in this paper point out that an inappropriate choice of bandwidth in channel parameter estimation could violate spatial stationary assumptions. The paper indicates LRS sizes for different bandwidths...

  15. Turbulent mixed convection in asymmetrically heated vertical channel

    Directory of Open Access Journals (Sweden)

    Mokni Ameni

    2012-01-01

    Full Text Available In this paper an investigation of mixed convection from vertical heated channel is undertaken. The aim is to explore the heat transfer obtained by adding a forced flow, issued from a flat nozzle located in the entry section of a channel, to the up-going fluid along its walls. Forced and free convection are combined studied in order to increase the cooling requirements. The study deals with both symmetrically and asymmetrically heated channel. The Reynolds number based on the nozzle width and the jet velocity is assumed to be 3 103 and 2.104; whereas, the Rayleigh number based on the channel length and the wall temperature difference varies from 2.57 1010 to 5.15 1012. The heating asymmetry effect on the flow development including the mean velocity and temperature the local Nusselt number, the mass flow rate and heat transfer are examined.

  16. Turbulent natural convection in vertical parallel-plate channels

    Energy Technology Data Exchange (ETDEWEB)

    Badr, H.M.; Habib, M.A.; Anwar, S.; Ben-Mansour, R.; Said, S.A.M. [King Fahd University of Petroleum and Minerals, Mechanical Engineering Department, Dhahran (Saudi Arabia)

    2006-11-15

    The problem of buoyancy driven turbulent flow in parallel-plate channels is investigated. The investigation is limited to vertical channels of uniform cross-section with different modes of heating. The details of the flow and thermal fields are obtained from the solution of the conservation equations of mass, momentum, and energy in addition to equations of the low Reynolds number turbulence model. The study covers Rayleigh number ranging from 10{sup 5} to 10{sup 7} and focuses on the effect of channel geometry on the characteristic of the flow and thermal fields as well as the local and average Nusselt number variation. A Nusselt number correlation has been developed in terms of a modified Rayleigh number and channel aspect ratio for the cases of symmetrically heated isothermal and isoflux conditions. (orig.)

  17. Calcium signals and calcium channels in osteoblastic cells

    Science.gov (United States)

    Duncan, R. L.; Akanbi, K. A.; Farach-Carson, M. C.

    1998-01-01

    Calcium (Ca2+) channels are present in non-excitable as well as in excitable cells. In bone cells of the osteoblast lineage, Ca2+ channels play fundamental roles in cellular responses to external stimuli including both mechanical forces and hormonal signals. They are also proposed to modulate paracrine signaling between bone-forming osteoblasts and bone-resorbing osteoclasts at local sites of bone remodeling. Calcium signals are characterized by transient increases in intracellular Ca2+ levels that are associated with activation of intracellular signaling pathways that control cell behavior and phenotype, including patterns of gene expression. Development of Ca2+ signals is a tightly regulated cellular process that involves the concerted actions of plasma membrane and intracellular Ca2+ channels, along with Ca2+ pumps and exchangers. This review summarizes the current state of knowledge concerning the structure, function, and role of Ca2+ channels and Ca2+ signals in bone cells, focusing on the osteoblast.

  18. Capacities of lossy bosonic channel with correlated noise

    Science.gov (United States)

    Lupo, Cosmo; Pilyavets, Oleg V.; Mancini, Stefano

    2009-06-01

    We evaluate the information capacities of a lossy bosonic channel with correlated noise. The model generalizes the one recently discussed by Pilyavets et al (2008 Phys. Rev. A 77 052324), where memory effects come from the interaction with correlated environments. Environmental correlations are quantified by a multimode squeezing parameter, which vanishes in the memoryless limit. We show that a global encoding/decoding scheme, which involves input-entangled states among different channel uses, is always preferable with respect to a local one in the presence of memory. Moreover, in a certain range of the parameters, we provide an analytical expression for the classical capacity of the channel showing that a global encoding/decoding scheme allows it to be attained. All the results can be applied to a broad class of bosonic Gaussian channels.

  19. Atmospheric Channel Characteristics for Quantum Communication with Continuous Polarization Variables

    CERN Document Server

    Heim, Bettina; Bartley, Tim; Sabuncu, Metin; Wittmann, Christoffer; Sych, Denis; Marquardt, Christoph; Leuchs, Gerd

    2009-01-01

    We investigate the properties of an atmospheric channel for free space quantum communication with continuous polarization variables. In our prepare-and-measure setup, coherent polarization states are transmitted through an atmospheric quantum channel of 100m length on the roof of our institute's building. The signal states are measured by homodyne detection with the help of a local oscillator (LO) which propagates in the same spatial mode as the signal, orthogonally polarized to it. Thus the interference of signal and LO is excellent and atmospheric fluctuations are autocompensated. The LO also acts as spatial and spectral filter, which allows for unrestrained daylight operation. Important characteristics for our system are atmospheric channel influences that could cause polarization, intensity and position excess noise. Therefore we study these influences in detail. Our results indicate that the channel is suitable for our quantum communication system in most weather conditions.

  20. A non-perturbative approach to relativistic quantum communication channels

    CERN Document Server

    Landulfo, Andre G S

    2016-01-01

    We investigate the transmission of both classical and quantum information between two arbitrary observers in globally hyperbolic spacetimes using a quantum field as a communication channel. The field is supposed to be in some arbitrary quasifree state and no choice of representation of its canonical commutation relations is made. Both sender and receiver posses some localized two-level quantum system with which they can interact with the quantum field to prepare the input and receive the output of the channel, respectively. The interaction between the two-level systems and the quantum field is such that one can trace out the field degrees of freedom exactly and thus obtain the quantum channel in a non-perturbative way. We end the paper determining the unassisted as well as the entanglement-assisted classical and quantum channel capacities.