WorldWideScience

Sample records for bitis gabonica rhinoceros

  1. Evolutionary analysis of novel serine proteases in the venom gland transcriptome of Bitis gabonica rhinoceros.

    Directory of Open Access Journals (Sweden)

    Sakthivel Vaiyapuri

    Full Text Available BACKGROUND: Serine proteases are major components of viper venom and target various stages of the blood coagulation system in victims and prey. A better understanding of the diversity of serine proteases and other enzymes present in snake venom will help to understand how the complexity of snake venom has evolved and will aid the development of novel therapeutics for treating snake bites. METHODOLOGY AND PRINCIPAL FINDINGS: Four serine protease-encoding genes from the venom gland transcriptome of Bitis gabonica rhinoceros were amplified and sequenced. Mass spectrometry suggests the four enzymes corresponding to these genes are present in the venom of B. g. rhinoceros. Two of the enzymes, rhinocerases 2 and 3 have substitutions to two of the serine protease catalytic triad residues and are thus unlikely to be catalytically active, though they may have evolved other toxic functions. The other two enzymes, rhinocerases 4 and 5, have classical serine protease catalytic triad residues and thus are likely to be catalytically active, however they have glycine rather than the more typical aspartic acid at the base of the primary specificity pocket (position 189. Based on a detailed analysis of these sequences we suggest that alternative splicing together with individual amino acid mutations may have been involved in their evolution. Changes within amino acid segments which were previously proposed to undergo accelerated change in venom serine proteases have also been observed. CONCLUSIONS AND SIGNIFICANCE: Our study provides further insight into the diversity of serine protease isoforms present within snake venom and discusses their possible functions and how they may have evolved. These multiple serine protease isoforms with different substrate specificities may enhance the envenomation effects and help the snake to adapt to new habitats and diets. Our findings have potential for helping the future development of improved therapeutics for snake bites.

  2. Purification and functional characterisation of rhiminopeptidase A, a novel aminopeptidase from the venom of Bitis gabonica rhinoceros.

    Directory of Open Access Journals (Sweden)

    Sakthivel Vaiyapuri

    Full Text Available BACKGROUND: Snake bite is a major neglected public health issue within poor communities living in the rural areas of several countries throughout the world. An estimated 2.5 million people are bitten by snakes each year and the cost and lack of efficacy of current anti-venom therapy, together with the lack of detailed knowledge about toxic components of venom and their modes of action, and the unavailability of treatments in rural areas mean that annually there are around 125,000 deaths worldwide. In order to develop cheaper and more effective therapeutics, the toxic components of snake venom and their modes of action need to be clearly understood. One particularly poorly understood component of snake venom is aminopeptidases. These are exo-metalloproteases, which, in mammals, are involved in important physiological functions such as the maintenance of blood pressure and brain function. Although aminopeptidase activities have been reported in some snake venoms, no detailed analysis of any individual snake venom aminopeptidases has been performed so far. As is the case for mammals, snake venom aminopeptidases may also play important roles in altering the physiological functions of victims during envenomation. In order to further understand this important group of snake venom enzymes we have isolated, functionally characterised and analysed the sequence-structure relationships of an aminopeptidase from the venom of the large, highly venomous West African gaboon viper, Bitis gabonica rhinoceros. METHODOLOGY AND PRINCIPAL FINDINGS: The venom of B. g. rhinoceros was fractionated by size exclusion chromatography and fractions with aminopeptidase activities were isolated. Fractions with aminopeptidase activities showed a pure protein with a molecular weight of 150 kDa on SDS-PAGE. In the absence of calcium, this purified protein had broad aminopeptidase activities against acidic, basic and neutral amino acids but in the presence of calcium, it had only

  3. African adders: partial characterization of snake venoms from three Bitis species of medical importance and their neutralization by experimental equine antivenoms.

    Directory of Open Access Journals (Sweden)

    Danielle Paixão-Cavalcante

    2015-02-01

    Full Text Available An alarming number of fatal accidents involving snakes are annually reported in Africa and most of the victims suffer from permanent local tissue damage and chronic disabilities. Envenomation by snakes belonging to the genus Bitis, Viperidae family, are common in Sub-Saharan Africa. The accidents are severe and the victims often have a poor prognosis due to the lack of effective specific therapies. In this study we have biochemically characterized venoms from three different species of Bitis, i.e., Bitis arietans, Bitis gabonica rhinoceros and Bitis nasicornis, involved in the majority of the human accidents in Africa, and analyzed the in vitro neutralizing ability of two experimental antivenoms.The data indicate that all venoms presented phospholipase, hyaluronidase and fibrinogenolytic activities and cleaved efficiently the FRET substrate Abz-RPPGFSPFRQ-EDDnp and angiotensin I, generating angiotensin 1-7. Gelatinolytic activity was only observed in the venoms of B. arietans and B. nasicornis. The treatment of the venoms with protease inhibitors indicated that Bitis venoms possess metallo and serinoproteases enzymes, which may be involved in the different biological activities here evaluated. Experimental antivenoms produced against B. arietans venom or Bitis g. rhinoceros plus B. nasicornis venoms cross-reacted with the venoms from the three species and blocked, in different degrees, all the enzymatic activities in which they were tested.These results suggest that the venoms of the three Bitis species, involved in accidents with humans in the Sub-Saharan Africa, contain a mixture of various enzymes that may act in the generation and development of some of the clinical manifestations of the envenomations. We also demonstrated that horse antivenoms produced against B. arietans or B. g. rhinoceros plus B. nasicornis venoms can blocked some of the toxic activities of these venoms.

  4. Biti pastir mladih danas

    OpenAIRE

    Attard, Fabio

    2009-01-01

    Autor razmišlja kao odgajatelj koji, slijedeći svoga učitelja don Bosca, u središte stavlja odgajanika kao osobu u potrazi za smislom. Svjestan da je čovjek Božje stvorenje koje Bog ljubi, autor slijedi don Boscovu metodu i želi biti blizu mladima. To znači potaknuti u njima volju za rastom, s odvažnošću gledati prema gore i život doživljavati kao dar. Stoga pastir mladih koji odgovara na Kristov poziv i djeluje po don Boscovoj metodi, nastoji slušati pripovijedanje mladih i njihove povijesti...

  5. Parasites of rhinoceros

    OpenAIRE

    Kettnerová, Lucie

    2013-01-01

    This thesis is focuses on parasites of rhinoceros. Thesis is in form a literary review, and is focused of parasites both in captivity and wildness. The aim of mine work was to describe the different kinds of parasites, their morphology, life cycles, and especially diseases that cause to the rhinoceros. Rhinoceros are endangered species, some of them are on the verge of extinction therefore they are in order to be saved often moved to reservations or zoos. In the new environment, they meet ...

  6. Strukturelle erforschung von wortbedeutungen am beispiel des zeitwortes biti 'sein'

    Directory of Open Access Journals (Sweden)

    Jože Toporišič

    2015-10-01

    Full Text Available Strukturell ist für mich eine solche Erforschung der Wortbedeutung, deren Befunde durch die Sprachstruktur selbst kontroliert und bestätigt werden und nicht etwa durch log(izistische oder sonstige Erwägen, die in die Sprache hineingetragen werden, statt in ihr enthalten zu sein. In diesem Sinne sei der WöSrterbuchartikel über das Zeitwort biti 'sein' im Slovar slovenskega knjižnega jezika I, Ljubljana 1970, einer formalen Kritik unterzogen.Hauptbefunde dieser Kritik sind folgende: Das Zeitwort biti sollte nur in 2, nicht in 5 Problemkreisen (der 6. ist das sog.Nestbehandelt werden.Unter I. tritt es in 3 gegenstandsbezogenen Grundbedeutungen auf, unter II.ist es reine Kopula (die aber aufgrund der Objektspräpositionen besondere Bedeutungen gewinnt.Unter I.werden unterschieden: 1. die Bedeutung des Vorhandenseins oder des Bestehens, 2. des sich Befindens, 3. des Stattfindens.Das kann mit folgenden Beispielen veranschaulicht werden: 1. ali je kak izhod 'gibt es da einen Ausgang', 2.hiša je na polju 'das Haus befindet sich auf dem Feld', 3. v Kamniku je bil semenj  'in Kamnik wurde Markttag abgehalten'. Gemeinsam haben diese Bedeutungen die Versetzungsmöglichkeit des Subjektsnominativs in inen Zustands­ genitiv, wennn biti negiert wird: 1.ali ni nobenega izhoda, 2. hiše ni sredi polja, 3.v Kamniku ni bilo semnja. Diese Ver­ setzung ist bei 2. in 3. unter gewissen Bedingungen unverbind­ lichs sredi polja ni hiša, ampak drevo (neben sredi polja ni hiše, ampak je drevo bzw. v Kamniku ni bil semenj, ampak raz­ stava (neben v Kamniku ni bilo semnja, ampak je bila razstava, was auf die syntaktische Attraktion in Bezug auf den Nominativ im zweiten Glied der Konjunktionsverbindung zurückzuführen ist. In Slovar slovenskega knjižnega jezika (ferner: SSKJ werden diese 3 Bedeutungen unpassend nur als 2 wiedergegeben, und zwar unter der Periphrase "materielles oder geistiges Vorhandensein in der Wirklichkeit" bzw."Vorhandensein in Raum und

  7. Biti bibliotekar

    OpenAIRE

    Kaljanac, Maja

    2003-01-01

    Perspective of profession by senior library science student. Who is librarian and what are the tasks. Comparison with Divine commedy - Vergilius as Librarian and User as Dante. Principles of Librarianship.

  8. Tannin-binding salivary proteins in three captive rhinoceros species.

    Science.gov (United States)

    Clauss, Marcus; Gehrke, Janin; Hatt, Jean-Michel; Dierenfeld, Ellen S; Flach, Edmund J; Hermes, Robert; Castell, Johanna; Streich, W Juergen; Fickel, Joerns

    2005-01-01

    Tannin-binding salivary proteins (TBSP) are considered to be counter-defences acquired in the course of evolution by animals whose natural forage contains such tannins. As tannins mostly occur in browse material but not in grasses, it is assumed that grazers do not have a need for TBSP. Whereas it has been shown in several non-ungulate species that TBSP can be induced by dietary tannins, their presence or absence in ungulates has, so far, been shown to be a species-specific characteristic independent of dietary manipulations. We investigated saliva from three rhinoceros species from zoological gardens fed comparable, conventional zoo diets. As expected, saliva from white rhinoceroses (Ceratotherum simum, grazer) had lower tannin-binding capacities than that from black rhinoceroses (Diceros bicornis, browser). Surprisingly, however, Indian rhinoceroses (Rhinoceros unicornis), commonly regarded as grazers as well, displayed the highest tannin-binding capacities of the three species investigated. It is speculated that this discrepancy might be a result of an evolutionarily recent switch to a grass-dominated diet in Indian rhinoceroses, and that the black rhinoceros, which is closer related to the white rhinoceros than the Indian species, has evolved an inducible mechanism of TBSP production. In separate trials during which the tannin content of the diets of black rhinoceroses was increased by the addition of either tannic acid or quebracho, the tannin-binding capacity of black rhinoceros saliva was increased to levels within the same range as that of Indian rhinoceroses on the conventional diets. While induction trials in white and Indian rhinoceroses remain to be performed for a full understanding of salivary anti-tannin defence in rhinoceroses, these results are the first report of an induced salivary response to increased dietary tannin levels in an ungulate species. PMID:15664314

  9. Kajian Kemampuan Menyebar Kumbang Tanduk (Oryctes rhinoceros L.) pada Musim Hujan di Kebun Rambutan PTPN III

    OpenAIRE

    Anugrah, Ryan

    2015-01-01

    Ryan anugrah, Study of Spreading Ability of Oryctes rhinoceros beetle on Raining season at Kebun Rambutan PTPN III, with the conseling Ir. Marheni, MP and Ir. Fatimah Zahara. Spreading of Oryctes rhinoceros is influenced by environment factor. Researched aimed to know the spreading ability of oryctes rhinoceros on raining season at kebun Rambutan PTPN III. This research was held in Afdeling VII, Kebun Rambutan PTPN III Tebing Tinggi, Since July to September 2011. The research using Linier reg...

  10. Putative filariosis outbreak in white and black rhinoceros at Meru National Park in Kenya.

    OpenAIRE

    Mutinda Matthew; Otiende Moses; Gakuya Francis; Kariuki Linus; Obanda Vincent; Ndeere David; Ndambiri Ephantus; Kariuki Edward; Lekolool Isaac; Soriguer Ramón C; Rossi Luca; Alasaad Samer

    2012-01-01

    Abstract Background Habitat and food supply loss and disruption, together with man’s pursuit of the animal’s unique horn pose significant threats to the charismatic rhinoceros. Filarial worms have been thought to cause cutaneous lesions in black rhinoceros (Diceros bicornis) in Kenya and South Africa, but never in white rhinoceros (Ceratotherium simum) in the wild, despite the fact that the two species live often in close proximity. Stephanofilaria dinniki has been implicated in the past as t...

  11. Anthropogenic Influences on Conservation Values of White Rhinoceros

    OpenAIRE

    Ferreira, Sam M.; Botha, Judith M.; Emmett, Megan C.

    2012-01-01

    White rhinoceros (rhinos) is a keystone conservation species and also provides revenue for protection agencies. Restoring or mimicking the outcomes of impeded ecological processes allows reconciliation of biodiversity and financial objectives. We evaluate the consequences of white rhino management removal, and in recent times, poaching, on population persistence, regional conservation outcomes and opportunities for revenue generation. In Kruger National Park, white rhinos increased from 1998 ...

  12. Castration of a Black Rhinoceros Diceros Bicornis Minor

    Directory of Open Access Journals (Sweden)

    V de Vos

    1980-01-01

    Full Text Available A black rhinoceros (Diceros bicornis minor in the Addo Elephant National Park was castrated in order to prevent the possibility of an aotic inducing gene to be introduced into the Addo population. The classic castration technique was used. It was subsequently found that the rhino showed a drastic change in behaviour, and is at this stage predictably timid, which is not the case with his testis carrying compeers.

  13. Population densities of eastern black rhinoceros : unravelling the controls

    OpenAIRE

    Ouma, B.O.

    2014-01-01

    Key words: black rhinoceros, browser, corticosterone, diet, density dependence, minerals, moisture, physiological stress, savanna, soil nutrients, woody cover.   Understanding the forces that cause variability in population sizes is a central theme in ecology. The limiting factor in populations of large mammals which are not controlled top‐down by predation is food, i.e., such populations are controlled by bottom‐up processes. However, there is little evidence of density dependence in la...

  14. Conjunctival habronemiasis in a square-lipped rhinoceros (Ceratotherium simum).

    Science.gov (United States)

    Horowitz, Igal H; Dubielzig, Richard R; Botero-Anug, Ana-Maria; Lucio-Forster, Araceli; Bowman, Dwight D; Rosenzweig, Ariella B; Frenkel, Shahar; Ofri, Ron

    2016-03-01

    A captive female square-lipped rhinoceros born in 1993 had been showing intermittent signs of bilateral conjunctivitis and conjunctival proliferation since 1998. Periodic improvement was noted, especially in winter, but overall the condition had deteriorated over the years. Treatment with various topical, intralesional, and systemic antibiotics and glucocorticosteroids was largely ineffective, as were repeated dewormings. No primary cause for these lesions was found in biopsies taken in 2000 and 2006, although a severe infiltrate of numerous eosinophils was observed in the latter. As the condition worsened, secondary corneal changes were noted, and eventually vision was lost due to proliferative conjunctival tissue. Aggressive resection of the proliferating tissue in 2013 restored vision and submitted biopsies yielded a diagnosis of severe allergic conjunctivitis, eosinophilic granuloma, and habronematid (Habronema or Draschia) larval infection. As no other rhinoceros in the herd was affected, including two calves born to the patient who were in close contact with their mother, it was concluded the presentation was most likely due to a hypersensitivity reaction to the dead or dying larvae. Fly repellent is now regularly applied around the eye of this rhinoceros, and a protective face mask has been fitted. Ongoing periodic relapses are treated with oral ivermectin, topical antibiotics, and steroids. PMID:25818990

  15. Investigation of acoustic sensors to detect coconut rhinoceros beetle in Guam

    Science.gov (United States)

    The coconut rhinoceros beetle, Oryctes rhinoceros, was accidentally introduced into Guam last year and now threatens the Island’s forests and tourist industry. These large insects can be detected easily with acoustic sensors, and procedures are being developed to incorporate acoustic technology int...

  16. An ambusher's arsenal: chemical crypsis in the puff adder (Bitis arietans).

    Science.gov (United States)

    Miller, Ashadee Kay; Maritz, Bryan; McKay, Shannon; Glaudas, Xavier; Alexander, Graham J

    2015-12-22

    Ambush foragers use a hunting strategy that places them at risk of predation by both visual and olfaction-oriented predators. Resulting selective pressures have driven the evolution of impressive visual crypsis in many ambushing species, and may have led to the development of chemical crypsis. However, unlike for visual crypsis, few studies have attempted to demonstrate chemical crypsis. Field observations of puff adders (Bitis arietans) going undetected by several scent-orientated predator and prey species led us to investigate chemical crypsis in this ambushing species. We trained dogs (Canis familiaris) and meerkats (Suricata suricatta) to test whether a canid and a herpestid predator could detect B. arietans using olfaction. We also tested for chemical crypsis in five species of active foraging snakes, predicted to be easily detectable. Dogs and meerkats unambiguously indicated active foraging species, but failed to correctly indicate puff adder, confirming that B. arietans employs chemical crypsis. This is the first demonstration of chemical crypsis anti-predatory behaviour, though the phenomenon may be widespread among ambushers, especially those that experience high mortality rates owing to predation. Our study provides additional evidence for the existence of an ongoing chemically mediated arms race between predator and prey species. PMID:26674950

  17. Histological Study of the Adrenal Gland of African White Rhinoceros

    Directory of Open Access Journals (Sweden)

    Ke-mei Peng§*, Hui Song§, Hua-zhen Liu, Jian-bin Zhang1, Zhi-qiang Lu, Zhi-wei Liu and Yin-xue Liu

    2012-06-01

    Full Text Available The microstructures of adrenal gland of white rhinoceros (Ceratotherium simum were observed by light microscopy. The results showed that the surface envelope of adrenal gland was covered with developed connective tissues whose average thickness was up to 210 μm. A large number of sinusoids were distributed between the neighboring cells. The zona glomerulosa of adrenal cortex was thin and composed of columnar and cubic cells. The columnar cells were close to the edge and the cubic cells were found in the deep zone. The two kinds of cells were arranged in irregular groups. The thickness of zona fasiculata was about 3 times as much as that of zona glomerulosa, and the boundary was not obvious. Cells were arranged in irregular cords. Some small lipid droplets were in the shape of small vacuolation, and distributed in the cytoplasm. The cells of zona reticularis were adjacent to medulla with which they formed a jagged boundary. Cells were in network or in enclose acini. Medullae were darkly stained and clearly distinct from the cortex. Cells were large with elliptical nuclei whose nucleoli were significant. Cytoplasm was basophilic and stained to give blue violet appearance. A small amount of sympathetic ganglion cells were distributed in the medulla. The above results suggested that the adrenal gland structures of African white rhinoceros compared with other animals have similarities. . The rich sinusoids in capsule suggested that its blood supply was abundant, full of metabolism and endocrine activity.

  18. Biologi Hama Kumbang Penggerek Pucuk Kelapa Sawit (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) Di Rumah Kassa

    OpenAIRE

    Sejahtra, Ahmad

    2011-01-01

    Ahmad Sejahtra, "BIOLOGY SHOOT BORERS BEETLE PEST OF COCONUT PALM (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) AT KASSA HOUSE", Under supervised by Ms Marheni and Ms Fatima Zahara. This study aims to determine biological pest of oil palm bud weevil (Oryctes rhinoceros L.) (Coleoptera: Scarabaeidae) at home kassa. The experiment was conducted on people's plantations in PERUMNAS Simalingkar starting from September 2010 until April 2011. Research using observational methods for this resear...

  19. Radio transmitter implants in the horns of both the white and the black rhinoceros in the Kruger National Park

    OpenAIRE

    D.J. Pienaar; A.J. Hall-Martin

    1991-01-01

    The procedure for implanting radio transmitters into the horns of white and black rhinoceroses is described. Mean transmitter life in the white rhinoceros was 13,9 months which is significantly longer than the 9,7 months in black rhinoceros. In the white rhinoceros a significant sex-related difference in transmitter life was found with the transmitters in males lasting a mean of 12,1 months compared to the 15,3 months in females.

  20. Radio transmitter implants in the horns of both the white and the black rhinoceros in the Kruger National Park

    Directory of Open Access Journals (Sweden)

    D.J. Pienaar

    1991-09-01

    Full Text Available The procedure for implanting radio transmitters into the horns of white and black rhinoceroses is described. Mean transmitter life in the white rhinoceros was 13,9 months which is significantly longer than the 9,7 months in black rhinoceros. In the white rhinoceros a significant sex-related difference in transmitter life was found with the transmitters in males lasting a mean of 12,1 months compared to the 15,3 months in females.

  1. Unique Locality of Wooly Rhinoceros in Arctic Siberia

    Science.gov (United States)

    Davydov, S.; Sher, A.; Boeskorov, G.; Lazarev, P.; Binladen, J.; Willerslev, E.; Tikhonov, A.

    2009-12-01

    A permafrost goldfield area in northeastern Yakutia, Russia turns out to be the richest locality of extinct woolly rhinoceros in the world. It has yielded fossil horns of about 50 rhino individuals, and recently the most complete mummified body of this extinct giant. The age of fossils is about 40-50 thousand years before present, but permafrost helped to preserve them in perfect condition. The fossils, and especially mummies, present a perfect material for genetic studies. Woolly rhinoceros, Coelodonta antiquitatis (Blum.), is one of the symbols of the Ice Age and one of few large mammal species that disappeared from Eurasia about 14 000 years ago. Recently, a substantially complete mummy of woolly rhinoceros was found in permafrost at the Rodinka site near Cherskiy, northeastern Yakutia, Russia (68.76°N, 161.63°E). It is the body of an adult female, weighing almost 900 kg, with the preserved skull, two horns, lower jaw, one ear, and tail. The length of the carcass is about 2 m, the live length of the animal is estimated as more than 3 m. The right legs are partly preserved and the chest and belly cavities are partly empty; almost all hair has been lost. Despite these defects, it is the most complete mummy of woolly rhino ever found in permafrost. A fragment of rib from the body has been AMS dated to 39140±390 BP (OxA-18755). In recent years the Rodinka site has yielded an unprecedented number of woolly rhino fossils and is so far the richest locality for this extinct species. The woolly rhino had a very wide distribution in the Late Pleistocene - from France to the Bering Strait and from China to the high-arctic islands. It was perfectly adapted to the variety of severe periglacial (tundra-steppe) environments. Intriguingly, it was the only large Siberian mammal that never crossed the Bering Land Bridge to Alaska. In the vast lowlands of Arctic Siberia Coelodonta fossils are common, but much less abundant (below 1%) compared to those of other large Ice Age

  2. Putative filariosis outbreak in white and black rhinoceros at Meru National Park in Kenya

    Directory of Open Access Journals (Sweden)

    Mutinda Matthew

    2012-09-01

    Full Text Available Abstract Background Habitat and food supply loss and disruption, together with man’s pursuit of the animal’s unique horn pose significant threats to the charismatic rhinoceros. Filarial worms have been thought to cause cutaneous lesions in black rhinoceros (Diceros bicornis in Kenya and South Africa, but never in white rhinoceros (Ceratotherium simum in the wild, despite the fact that the two species live often in close proximity. Stephanofilaria dinniki has been implicated in the past as the causal agents for such lesions. Findings In this paper we report a putative filariosis outbreak in both black and white rhinos at Meru National Park in Kenya. Four black and five white rhinos were affected by various degrees of filarioid-like lesions, while apparently all sympatric wild and domestic animals were filarial worm-free. Affected rhinos were captured and successfully treated. Comparison between the epidemiological aspects of white and black rhinoceros filariosis, and the possible relations between this outbreak and annual seasons, the presence of oxpeckers and other host species are discussed. Conclusions Our study highlights (i that filarial infection is not restricted to black rhinos, but it affects both rhinoceros species, and (ii the importance of the earlier detection and immediate treatment (capture-treat and release of filarioid infections, which is of pivotal interest for wildlife conservation, and especially the endangered and isolated white and black rhinoceros populations.

  3. Three Novel Haplotypes of Theileria bicornis in Black and White Rhinoceros in Kenya.

    Science.gov (United States)

    Otiende, M Y; Kivata, M W; Jowers, M J; Makumi, J N; Runo, S; Obanda, V; Gakuya, F; Mutinda, M; Kariuki, L; Alasaad, S

    2016-02-01

    Piroplasms, especially those in the genera Babesia and Theileria, have been found to naturally infect rhinoceros. Due to natural or human-induced stress factors such as capture and translocations, animals often develop fatal clinical piroplasmosis, which causes death if not treated. This study examines the genetic diversity and occurrence of novel Theileria species infecting both black and white rhinoceros in Kenya. Samples collected opportunistically during routine translocations and clinical interventions from 15 rhinoceros were analysed by polymerase chain reaction (PCR) using a nested amplification of the small subunit ribosomal RNA (18S rRNA) gene fragments of Babesia and Theileria. Our study revealed for the first time in Kenya the presence of Theileria bicornis in white (Ceratotherium simum simum) and black (Diceros bicornis michaeli) rhinoceros and the existence of three new haplotypes: haplotypes H1 and H3 were present in white rhinoceros, while H2 was present in black rhinoceros. No specific haplotype was correlated to any specific geographical location. The Bayesian inference 50% consensus phylogram recovered the three haplotypes monophyleticly, and Theileria bicornis had very high support (BPP: 0.98). Furthermore, the genetic p-uncorrected distances and substitutions between T. bicornis and the three haplotypes were the same in all three haplotypes, indicating a very close genetic affinity. This is the first report of the occurrence of Theileria species in white and black rhinoceros from Kenya. The three new haplotypes reported here for the first time have important ecological and conservational implications, especially for population management and translocation programs and as a means of avoiding the transport of infected animals into non-affected areas. PMID:24906113

  4. Songlike vocalizations from a Sumatran rhinoceros calf (Dicerorhinus sumatrensis)

    Science.gov (United States)

    von Muggenthaler, Elizabeth; Reinhart, Paul

    2003-04-01

    Within the last ten years the Sumatran rhino population has dropped 50%, and only 200-300 individuals exist, with five in captivity. Their native habitat is dense tropical forest and they are solitary, therefore much of their behavior remains unknown. Sumatrans are the smallest living rhino, standing 0.9-1.5 m tall, and are covered in coarse, reddish-brown hair. The first Sumatran rhinoceros born in captivity in 112 years, and the first calf ever recorded, is 17 months old and weighs 448 kg. At the Cincinnati Zoo this male calf was recorded from 1-3 m, using two Statham radio microphones, and one TCD-D8 Sony DAT recorder (9 Hz-22 kHz). Analysis, including power spectrums, spectrographic functions, and cross correlations were performed using National Instrument's Polynesia. Preliminary analysis indicates that the calf's vocalizations are similar in structure to adult Sumatran vocalizations, although there are some distinctions. ``Eeps'' and ``whales'' that are found in adult repertoires are produced by the calf. However, signals from the calf are higher in frequency, and the calf does not vocalize as consistently as the adults. The calf has yet to produce a ``whistle blow,'' which is an adult vocalization that has a strong infrasonic component.

  5. Kepadatan Jumlah Kumbang Badak (Oryctes rhinoceros L.) Pada Tanaman Kelapa Sawit (Elaeis guineensis jacq.) Di Lapangan

    OpenAIRE

    Harahap, Rudini

    2010-01-01

    Rudini Harahap "TOTAL BEETLE density rhinos (Oryctes rhinoceros L.) PLANTATION IN OIL PALM (Elaeis guineensis Jacq.) Field." With the commission supervising Mother Ir. Marheni, MP as chairman and Mr. Ir. Syahrial Oemry, MS, as members.This research was carried out in the garden and the garden Rambutan Padang Huta PTPN III, North Sumatra from April to May 2010.The aim study is to investigate the density of O.rhinoceros in Immature (TBM) diareal using Mucuna and to determine the density of O.rh...

  6. Black rhinoceros Diceros bicomis capture, transportation and boma management by the Natal Parks Board

    Directory of Open Access Journals (Sweden)

    R.R. Henwood

    1989-10-01

    Full Text Available Selected Papers from the Rhinoceros Conservation Workshop, Skukuza, Kruger National Park,31 August – 4 September 1988 The procedure used by the Natal Parks Board in the capture of black rhinoceros Diceros bicomis minor (Drummond, 1876 is outlined. It is emphasised that a successful capture operation requires careful planning and should not be attempted by the uninitiated or by parties who have little or no experience. Dosages of drugs are given, the darting and actual capture procedures highlighted, and aspects of transport and practical boma management are described.

  7. Genetika Populasi dan Strategi Konservasi Badak Jawa (Rhinoceros sondaicus Desmarest 1822) (Population Genetics of Javan Rhino (Rhinoceros sondaicus Desmarest 1822) and It’s Conservation Strategy)

    OpenAIRE

    U Mamat Rahmat

    2011-01-01

    Javan rhino (Rhinoceros sondaicus Desmarest 1822) of which spread is limited in Indonesia and Vietnam is the rarest species among 5 species of rhino in the world. Without appropriate and long-term well organized management action, the population of javan rhino will be in extinction. This research studies about the usage potential of  javan rhino population genetics data in designing  javan rhino conservation program. The application of genetics study in conservation problem is based on the po...

  8. Anthropogenic influences on conservation values of white rhinoceros.

    Science.gov (United States)

    Ferreira, Sam M; Botha, Judith M; Emmett, Megan C

    2012-01-01

    White rhinoceros (rhinos) is a keystone conservation species and also provides revenue for protection agencies. Restoring or mimicking the outcomes of impeded ecological processes allows reconciliation of biodiversity and financial objectives. We evaluate the consequences of white rhino management removal, and in recent times, poaching, on population persistence, regional conservation outcomes and opportunities for revenue generation. In Kruger National Park, white rhinos increased from 1998 to 2008. Since then the population may vary non-directionally. In 2010, we estimated 10,621 (95% CI: 8,767-12,682) white rhinos using three different population estimation methods. The desired management effect of a varying population was detectable after 2008. Age and sex structures in sink areas (focal rhino capture areas) were different from elsewhere. This comes from relatively more sub-adults being removed by managers than what the standing age distribution defined. Poachers in turn focused on more adults in 2011. Although the effect of poaching was not detectable at the population level given the confidence intervals of estimates, managers accommodated expected poaching annually and adapted management removals. The present poaching trend predicts that 432 white rhinos may be poached in Kruger during 2012. The white rhino management model mimicking outcomes of impeded ecological processes predicts 397 rhino management removals are required. At present poachers may be doing "management removals," but conservationists have no opportunity left to contribute to regional rhino conservation strategies or generate revenue through white rhino sales. In addition, continued trends in poaching predict detectable white rhino declines in Kruger National Park by 2016. Our results suggest that conservationists need innovative approaches that reduce financial incentives to curb the threats that poaching poses to several conservation values of natural resources such as white rhinos. PMID

  9. Anthropogenic influences on conservation values of white rhinoceros.

    Directory of Open Access Journals (Sweden)

    Sam M Ferreira

    Full Text Available White rhinoceros (rhinos is a keystone conservation species and also provides revenue for protection agencies. Restoring or mimicking the outcomes of impeded ecological processes allows reconciliation of biodiversity and financial objectives. We evaluate the consequences of white rhino management removal, and in recent times, poaching, on population persistence, regional conservation outcomes and opportunities for revenue generation. In Kruger National Park, white rhinos increased from 1998 to 2008. Since then the population may vary non-directionally. In 2010, we estimated 10,621 (95% CI: 8,767-12,682 white rhinos using three different population estimation methods. The desired management effect of a varying population was detectable after 2008. Age and sex structures in sink areas (focal rhino capture areas were different from elsewhere. This comes from relatively more sub-adults being removed by managers than what the standing age distribution defined. Poachers in turn focused on more adults in 2011. Although the effect of poaching was not detectable at the population level given the confidence intervals of estimates, managers accommodated expected poaching annually and adapted management removals. The present poaching trend predicts that 432 white rhinos may be poached in Kruger during 2012. The white rhino management model mimicking outcomes of impeded ecological processes predicts 397 rhino management removals are required. At present poachers may be doing "management removals," but conservationists have no opportunity left to contribute to regional rhino conservation strategies or generate revenue through white rhino sales. In addition, continued trends in poaching predict detectable white rhino declines in Kruger National Park by 2016. Our results suggest that conservationists need innovative approaches that reduce financial incentives to curb the threats that poaching poses to several conservation values of natural resources such as

  10. Proposed conservation plan for the black rhinoceros Diceros bicomis in South Africa, the TBVC* states and Namibia

    Directory of Open Access Journals (Sweden)

    P.M. Brooks

    1989-10-01

    Full Text Available Selected Papers from the Rhinoceros Conservation Workshop, Skukuza, Kruger National Park,31 August – 4 September 1988 The conservation plan for the black rhinoceros presents specific aims and management guidelines for the conservation of the African black rhinoceros Diceros bicomis in the Republic of South Africa, the TBVC states and Namibia. The adoption of this plan, and the application of the strategies described therein (managing existing populations, establishing new populations and aspects of captive breeding by the relevant conservation authorities should enhance the survival prospects of this species, both in the region and globally.

  11. Southern dispersal and Palaeoecological implications of woolly rhinoceros ( Coelodonta antiquitatis): review of the Iberian occurrences

    Science.gov (United States)

    Álvarez-Lao, Diego J.; García, Nuria

    2011-07-01

    Cold-adapted large mammal populations spread southward during the coldest and driest phases of the Late Pleistocene reaching the Iberian Peninsula. Presence of woolly rhinoceros ( Coelodonta antiquitatis) can be identified from 23 Iberian sites, which is compiled and analyzed herein, and the fossil specimens from seven of these sites are described here for first time. Morphological and biometrical analyses demonstrate that the Iberian woolly rhinoceros did not significantly differ from individuals of other European populations, but represent the westernmost part of a continuous Eurasian belt of distribution. The first presence of woolly rhino in the Iberian Peninsula has been identified during the late Middle Pleistocene and early Late Pleistocene. However, the highest abundance of this species is recorded during MIS 3 and 2. The latest Iberian occurrences can be dated around 20 ka BP. The presence of woolly rhinoceros in the Iberian Peninsula correlates with periods of extreme dry and cold climatic conditions documented in Iberian terrestrial and marine sediment sequences. From a palaeobiogeographic point of view, the maximum southern spread of C. antiquitatis on the Iberian Peninsula was registered during the late Middle Pleistocene or early Late Pleistocene, reaching the latitude of Madrid (about 40°N). Subsequently, during MIS 3 and 2, all Iberian finds were restricted to the Northern regions of Iberia (Cantabrian area and Catalonia). The southern expansion of C. antiquitatis during the Late Pleistocene in the Iberian Peninsula reached similar latitudes to other Eurasian regions. The ecological composition of fossil assemblages with presence of woolly rhinoceros was statistically analyzed. Results show that temperate ungulate species are predominant at Iberian assemblages, resulting in a particular mixture of temperate and cold elements different of the typical Eurasian cold-adapted faunal associations. This particular situation suggests two possible

  12. Shift in black rhinoceros diet in the presence of elephant: evidence for competition?

    Science.gov (United States)

    Landman, Marietjie; Schoeman, David S; Kerley, Graham I H

    2013-01-01

    In African large herbivore assemblages, megaherbivores dominate the biomass and utilise the greatest share of available resources. Consequently, they are considered a separate trophic guild that structures the food niches of coexisting large herbivores. However, there exists little empirical evidence on how food resources are shared within this guild, and none for direct competition for food between megaherbivores. Using the histological analysis of faeces, we explore this phenomenon for African elephant Loxodonta africana and black rhinoceros Diceros bicornis in the Addo Elephant National Park, South Africa, where the accumulated impacts of elephant have reduced browse availability. Despite being unable to generalise beyond our study sites, our observations support the predictions of competition theory (as opposed to optimality theory) by showing (1) a clear seasonal separation in resource use between these megaherbivores that increased as resource availability declined, and (2) rhinoceros changed their selectivity in the absence of elephant (using an adjacent site) by expanding and shifting their diet along the grass-browse continuum, and in relation to availability. Although black rhinoceros are generally considered strict browsers, the most significant shift in diet occurred as rhinoceros increased their preferences for grasses in the presence of elephant. We speculate that the lack of specialised grazing adaptations may increase foraging costs in rhinoceros, through reduced harvest- and handling-efficiencies of grasses. In the short-term, this may be off-set by an enhanced tolerance for low quality food and by seasonally mobilising fat reserves; however, the long-term fitness consequences require further study. Our data suggest that managing elephant at high densities may compromise the foraging opportunities of coexisting browsers. This may be particularly important in small, fenced areas and overlapping preferred habitats where impacts intensify. PMID

  13. Tooth wear in captive rhinoceroses (Diceros, Rhinoceros, Ceratotherium: Perissodactyla) differs from that of free-ranging conspecifics

    OpenAIRE

    L. A. Taylor; Müller, D.W.H.; Schwitzer, C.; Kaiser, T.M.; Codron, D.; Schulz, E; Clauss, M

    2014-01-01

    Tooth wear can affect body condition, reproductive success and life expectancy. Poor dental health is frequently reported in the zoo literature, and abrasion-dominated tooth wear, which is typical for grazers, has been reported in captive browsing ruminants. The aim of this study was to test if a similar effect is evident in captive rhinoceros species. Dental casts of maxillary cheek teeth of museum specimens of captive black (Diceros bicornis; browser), greater one-horned (Rhinoceros unicorn...

  14. The Microbial Community in the Feces of the White Rhinoceros (Ceratotherium simum) as Determined by Barcoded Pyrosequencing Analysis

    OpenAIRE

    Bian, Gaorui; Ma, Li; Su, Yong; Zhu, Weiyun

    2013-01-01

    As a non-ruminant herbivore, the white rhinoceros has the ability to utilize fibrous plant matter through microbial fermentation in the hindgut. So far, there has been no report using molecular techniques to study the gut microbiota of the white rhinoceros. We used barcoded pyrosequencing to characterize 105,651 sequences of 16S rRNA genes obtained from fecal samples from five white rhinoceroses. Results showed that Firmicutes and Bacteroidetes were the predominant phyla in the samples, which...

  15. Will current conservation responses save the Critically Endangered Sumatran rhinoceros Dicerorhinus sumatrensis?

    DEFF Research Database (Denmark)

    Havmøller, Rasmus Gren; Payne, Junaidi; Ramono, Widodo; Ellis, Susie; Yoganand, K.; Long, Barney; Dinerstein, Eric; Williams, A. Christy; Putra, Rudi H.; Gawi, Jamal; Talukdar, Bibhab Kumar; Burgess, Neil David

    2016-01-01

    The Critically Endangered Sumatran rhinoceros Dicerorhinus sumatrensis formerly ranged across South-east Asia. Hunting and habitat loss have made it one of the rarest large mammals and the species faces extinction despite decades of conservation efforts. The number of individuals remaining is unk...... develop advanced reproductive techniques as a matter of urgency. Intensive census efforts are ongoing in Bukit Barisan Selatan but elsewhere similar efforts remain at the planning stage....

  16. Factors impacting the success of post-mortem sperm rescue in the rhinoceros.

    Science.gov (United States)

    Roth, T L; Stoops, M A; Robeck, T R; O'Brien, J K

    2016-04-01

    The goal of this study was to identify factors that influenced the ability to successfully rescue sperm post-mortem from rhinoceroses maintained in North American zoos. Factors considered included procedural technicalities, individual rhinoceros characteristics and timing. Gross testicular pathology was noted in 17.4% of males (4/23) but did not impact sperm recovery except in one case of azoospermia (4.3%). Of the males in which sperm recovery was attempted (n=21), 62% yielded quality samples considered adequate for cryopreservation (≥30% motility with ≥2.0 forward progressive status). A high percentage of males (70.6%; 12/17) from which reproductive tissue was removed and cooled ≤4h after death yielded quality sperm samples, whereas only 25% (1/4) of males from which tissue was removed>4h after death yielded quality samples. Quality samples were recovered 1-51h post-mortem from rhinoceroses 8 to 36 years old. Neither type of illness (prolonged or acute), or method of death (euthanasia or natural) affected the ability to harvest quality samples (P>0.05). The Indian rhinoceros yielded significantly more sperm on average (40×10(9)) than the African black rhinoceros (3.6×10(9); Ppost-thaw sperm motility (41%), was only 15% less than pre-freeze motility (56%) and only decreased to 22% during the 6h post-thaw assessment period. Rhinoceros sperm rescue post-mortem is relatively successful across a wide range of variables, especially when tissues are removed and cooled promptly after death, and should be considered standard practice among zoos. PMID:26879096

  17. Habitat Suitability Modeling of Javan Rhino (Rhinoceros sondaicus Desmarest 1822) Ujung Kulon National Park

    OpenAIRE

    U Mamat Rahmat; Yanto Santosa; Lilik Budi Prasetyo; Agus Priyono Kartono

    2012-01-01

    Javan rhino (Rhinoceros sondaicus Desmarest 1822) is the rarest species among 5 species of rhinos in the world. Its distribution is currently limited only in Ujung Kulon National Park (UKNP), Indonesia.  Due to the small population size and its limited distribution, it is listed as critically endangered species in the IUCN Redlist. The main objectives of this research were: 1) to identify the dominant habitat components that determine the presence of javan rhino in UKNP; 2) to analyze habitat...

  18. Remotely piloted aircraft systems as a rhinoceros anti-poaching tool in Africa.

    Directory of Open Access Journals (Sweden)

    Margarita Mulero-Pázmány

    Full Text Available Over the last years there has been a massive increase in rhinoceros poaching incidents, with more than two individuals killed per day in South Africa in the first months of 2013. Immediate actions are needed to preserve current populations and the agents involved in their protection are demanding new technologies to increase their efficiency in the field. We assessed the use of remotely piloted aircraft systems (RPAS to monitor for poaching activities. We performed 20 flights with 3 types of cameras: visual photo, HD video and thermal video, to test the ability of the systems to detect (a rhinoceros, (b people acting as poachers and (c to do fence surveillance. The study area consisted of several large game farms in KwaZulu-Natal province, South Africa. The targets were better detected at the lowest altitudes, but to operate the plane safely and in a discreet way, altitudes between 100 and 180 m were the most convenient. Open areas facilitated target detection, while forest habitats complicated it. Detectability using visual cameras was higher at morning and midday, but the thermal camera provided the best images in the morning and at night. Considering not only the technical capabilities of the systems but also the poacherś modus operandi and the current control methods, we propose RPAS usage as a tool for surveillance of sensitive areas, for supporting field anti-poaching operations, as a deterrent tool for poachers and as a complementary method for rhinoceros ecology research. Here, we demonstrate that low cost RPAS can be useful for rhinoceros stakeholders for field control procedures. There are, however, important practical limitations that should be considered for their successful and realistic integration in the anti-poaching battle.

  19. Remotely piloted aircraft systems as a rhinoceros anti-poaching tool in Africa.

    Science.gov (United States)

    Mulero-Pázmány, Margarita; Stolper, Roel; van Essen, L D; Negro, Juan J; Sassen, Tyrell

    2014-01-01

    Over the last years there has been a massive increase in rhinoceros poaching incidents, with more than two individuals killed per day in South Africa in the first months of 2013. Immediate actions are needed to preserve current populations and the agents involved in their protection are demanding new technologies to increase their efficiency in the field. We assessed the use of remotely piloted aircraft systems (RPAS) to monitor for poaching activities. We performed 20 flights with 3 types of cameras: visual photo, HD video and thermal video, to test the ability of the systems to detect (a) rhinoceros, (b) people acting as poachers and (c) to do fence surveillance. The study area consisted of several large game farms in KwaZulu-Natal province, South Africa. The targets were better detected at the lowest altitudes, but to operate the plane safely and in a discreet way, altitudes between 100 and 180 m were the most convenient. Open areas facilitated target detection, while forest habitats complicated it. Detectability using visual cameras was higher at morning and midday, but the thermal camera provided the best images in the morning and at night. Considering not only the technical capabilities of the systems but also the poacherś modus operandi and the current control methods, we propose RPAS usage as a tool for surveillance of sensitive areas, for supporting field anti-poaching operations, as a deterrent tool for poachers and as a complementary method for rhinoceros ecology research. Here, we demonstrate that low cost RPAS can be useful for rhinoceros stakeholders for field control procedures. There are, however, important practical limitations that should be considered for their successful and realistic integration in the anti-poaching battle. PMID:24416177

  20. Captive breeding of the white rhinoceros, Ceratotherium simum, and the Cape buffalo, Syncerus caffer : research communication

    Directory of Open Access Journals (Sweden)

    J.D. Skinner

    2006-09-01

    Full Text Available Breeding records of 40 white rhinoceros and 155 Cape buffalo were analysed. Three rhinoceros cows bred in captivity, themselves conceived for the first time at 84, 87 and 95 months of age, respectively. Rhinoceros cows breed throughout the year. There is no evidence of a relationship between calving interval and month of birth. Calving intervals were normally distributed about the mean of 34 months and there were no significant differences between bulls, cows or sex of calf. There was no difference in the sex ratio of calves born to young cows nor older cows. The male:female ratio of the calves was Younger cows did not have shorter birth intervals. Although captive Cape buffaloes breed throughout the year, there is a preponderance of births in midsummer. There was some evidence that larger cows produce heavier calves and that season of birth may influence birth weight. Male calves weighed 41.20 + 0.68 kg vs 39.00 + 0.73 kg (range 24-60 kg for female calves but this difference was not significant. Calving intervals were normally distributed about the mean of 395 days and the male:female ratio of the calves was 1:1.2.

  1. The microbial community in the feces of the white rhinoceros (Ceratotherium simum as determined by barcoded pyrosequencing analysis.

    Directory of Open Access Journals (Sweden)

    Gaorui Bian

    Full Text Available As a non-ruminant herbivore, the white rhinoceros has the ability to utilize fibrous plant matter through microbial fermentation in the hindgut. So far, there has been no report using molecular techniques to study the gut microbiota of the white rhinoceros. We used barcoded pyrosequencing to characterize 105,651 sequences of 16S rRNA genes obtained from fecal samples from five white rhinoceroses. Results showed that Firmicutes and Bacteroidetes were the predominant phyla in the samples, which were comprised largely of unclassified bacteria. The microbiota of one animal treated with drug therapy differed from those in other healthy animals, and was dominated by Aerococcus -related bacteria. The core microbiota in the healthy rhinoceros were dominated by phyla Firmicutes and Bacteroidetes, represented by the Ruminococcaceae, Lachnospiraceae, Rikenellaceae and Prevotellaceae families. The present work provides a phylogenetic framework for understanding the complex microbial community of the rhinoceros; however, further studies are required to link the distinctive microbiota with their digestive role in the hindgut of the white rhinoceros.

  2. Japanese Interest in "Hotaru" (Fireflies) and "Kabuto-Mushi" (Japanese Rhinoceros Beetles) Corresponds with Seasonality in Visible Abundance.

    Science.gov (United States)

    Takada, Kenta

    2012-01-01

    Seasonal changes in the popularity of fireflies [usually Genji-fireflies (Luciola cruciata Motschulsky) in Japan] and Japanese rhinoceros beetles [Allomyrina dichotoma (Linne)] were investigated to examine whether contemporary Japanese are interested in visible emergence of these insects as seasonal events. The popularity of fireflies and Japanese rhinoceros beetles was assessed by the Google search volume of their Japanese names, "Hotaru" and "Kabuto-mushi" in Japanese Katakana script using Google Trends. The search volume index for fireflies and Japanese rhinoceros beetles was distributed across seasons with a clear peak in only particular times of each year from 2004 to 2011. In addition, the seasonal peak of popularity for fireflies occurred at the beginning of June, whereas that for Japanese rhinoceros beetles occurred from the middle of July to the beginning of August. Thus seasonal peak of each species coincided with the peak period of the emergence of each adult stage. These findings indicated that the Japanese are interested in these insects primarily during the time when the two species are most visibly abundant. Although untested, this could suggest that fireflies and Japanese rhinoceros beetles are perceived by the general public as indicators or symbols of summer in Japan. PMID:26466535

  3. Isonychia spp. and macroinvertebrate community responses to stressors in streams utilizing the benthic in situ toxicity identification evaluation (BiTIE) method

    International Nuclear Information System (INIS)

    Exposures of caged organisms in situ have proven to be a useful way to improve exposure realism and link to stressor effects in aquatic assessments of hazard or risk. A novel cage system, the benthic in situ toxicity identification evaluation (BiTIE), was developed for benthic macroinvertebrates (surrogate species, resident populations and communities) to separate low and high flow effects, and major chemical classes of stressors in streams. Three resin types were used to separate the chemical stressors in the streams Honey Creek and Little Beavercreek, Ohio, USA: DowexTM OptiporeTM (non-polar organics), zeolite (ammonia), and polywool (control). Isonychia spp. sensitivity was compared to Chironomus tentans, and no significant differences were found (p > 0.05). Isonychia spp. growth (length) showed a stressor response in the zeolite treatments, and community testing revealed improved metric responses in the DowexTM treatments. The BiTIE chamber system demonstrated stressor-response relationships using sublethal and multimetric endpoints. - Use of an indigenous aquatic insect and benthic macroinvertebrate communities allows for discerning the stressors in low and high flows with an in situ TIE approach

  4. Javan Rhino (Rhinoceros sondaicus Desmarest 1822) Utilization Distribution and Habitat Selection in Ujung Kulon National Park

    OpenAIRE

    Yanto Santosa; U Mamat Rahmat; Lilik Budi Prasetyo; Agus Priyono Kartono

    2013-01-01

    Javan rhino (Rhinoceros sondaicus Desmarest 1822) is one of world's rarest endangered species (IUCN 2008). Currently,  their distribution  is  limited  to Ujung Kulon National Park  (UKNP) of  Indonesia. Natural disasters, disease, poaching, encroachment, and competition are threats  facing Javan rhino's population, hence creating pockets of habitats outside  the UKNP was necessary and  should be based on  scientific  studies of  javan  rhino utilization distribution and habitat selection in ...

  5. Whole-genome sequence of Clostridium lituseburense L74, isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus

    OpenAIRE

    Yookyung Lee; Sooyeon Lim; Moon-Soo Rhee; Dong-Ho Chang; Byoung-Chan Kim

    2016-01-01

    Clostridium lituseburense L74 was isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus collected in Yeong-dong, Chuncheongbuk-do, South Korea and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession NZ_LITJ00000000.

  6. Whole-genome sequence of Clostridium lituseburense L74, isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus.

    Science.gov (United States)

    Lee, Yookyung; Lim, Sooyeon; Rhee, Moon-Soo; Chang, Dong-Ho; Kim, Byoung-Chan

    2016-03-01

    Clostridium lituseburense L74 was isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus collected in Yeong-dong, Chuncheongbuk-do, South Korea and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession NZ_LITJ00000000. PMID:26981432

  7. Sex and species recognition by wild male southern white rhinoceros using contact pant calls.

    Science.gov (United States)

    Cinková, Ivana; Policht, Richard

    2016-03-01

    Recognition of information from acoustic signals is crucial in many animals, and individuals are under selection pressure to discriminate between the signals of conspecifics and heterospecifics or males and females. Here, we first report that rhinos use information encoded in their calls to assess conspecifics and individuals of closely related species. The southern (Ceratotherium simum) and critically endangered northern (C. cottoni) white rhinos are the most social out of all the rhinoceros species and use a contact call pant. We found that southern white rhino pant calls provide reliable information about the caller's sex, age class and social situation. Playback experiments on wild territorial southern white rhinoceros males revealed that they responded more strongly to the pant calls of conspecific females compared to the calls of other territorial males. This suggests that pant calls are more important form of communication between males and females than between territorial males. Territorial southern males also discriminated between female and territorial male calls of northern species and reacted more intensively to the calls of northern than southern males. This might be caused by a novelty effect since both species naturally live in allopatry. We conclude that white rhinos can directly benefit from assessing individuals at long distances using vocal cues especially because their eyesight is poor. Pant calls thus likely play a significant role in their social relationships and spatial organization. In addition, better understanding of vocal communication in white rhinos might be helpful in conservation management particularly because of their low reproduction in captivity. PMID:26577089

  8. Temporal and sex-specific variability in Rhinoceros Auklet diet in the central California Current system

    Science.gov (United States)

    Carle, Ryan D.; Beck, Jessie N.; Calleri, David M.; Hester, Michelle M.

    2015-06-01

    We used stable isotopes (δ15N and δ13C) and compared prey provided to chicks by each sex to evaluate seasonal and sex-specific diets in Rhinoceros Auklets (Cerorhinca monocerata) in the central California Current system during 2012-2013. Mixing models indicated northern anchovy (Engraulis mordax) were important prey for adults during fall/winter and juvenile rockfishes (Sebastes spp.) were important prey during incubation both years. Adult trophic level increased between incubation and chick-rearing periods in both years. During 2012, δ15N and δ13C of chick-rearing males and females differed significantly; mixing models indicated that females ate more Pacific saury (Cololabis saira) and less market squid (Doryteuthis opalescens) than males. Likewise, females delivered significantly more Pacific saury and less market squid to chicks than males during 2012. Chick growth (g d- 1) and chick survival to fledging were significantly lower during 2012 than 2013, likely because chicks were fed lesser quality prey or fed less frequently in 2012. Lesser body mass of females during incubation in 2012 indicated sex-specific diet differences may have been related to female energetic constraints. The observed variability in Rhinoceros Auklet diet underscores the importance of managing multiple prey populations in this system so that generalist predators have sufficient resources through changing conditions.

  9. Japanese Interest in “Hotaru” (Fireflies) and “Kabuto-Mushi” (Japanese Rhinoceros Beetles) Corresponds with Seasonality in Visible Abundance

    OpenAIRE

    Kenta Takada

    2012-01-01

    Seasonal changes in the popularity of fireflies [usually Genji-fireflies (Luciola cruciata Motschulsky) in Japan] and Japanese rhinoceros beetles [Allomyrina dichotoma (Linne)] were investigated to examine whether contemporary Japanese are interested in visible emergence of these insects as seasonal events. The popularity of fireflies and Japanese rhinoceros beetles was assessed by the Google search volume of their Japanese names, “Hotaru” and “Kabuto-mushi” in Japanese Katakana script using ...

  10. How healthy are the rhinoceros populations in the Hluhluwe-iMfolosi Park?

    Directory of Open Access Journals (Sweden)

    LP Fatti

    2013-06-01

    Full Text Available Arising from a study conducted in the Hluhluwe-iMfolosi Park by the author in the late nineties, a method is proposed for improving the estimate of the size of a wildlife population by combining data from current and past surveys. The method is based on a simple state space model which takes into account the (unknown birth rate in the population and all known losses (mortalities and relocations and gains (introductions in the population between successive surveys, as well as the errors in the survey estimates. The method is applied to the White- and Black Rhinoceros populations in the Hluhluwe-iMfolosi Park and tentative conclusions are drawn on the health of these two populations.

  11. Blood meal analysis of tabanid fly after it biting the rare Sumatran rhinoceros

    Institute of Scientific and Technical Information of China (English)

    Jeffrine Japning Rovie-Ryan; Zainal Zahari Zainuddin; Wahap Marni; Abdul Hamid Ahmad; Laurentius N Ambu; Junaidi Payne

    2013-01-01

    Objective: To demonstrate a noninvasive large mammalian genetic sampling method using blood meal obtained from a tabanid fly. Methods: Blood meal was recovered from the abdomen of an engorged tabanid fly (Haematopota sp.) which was captured immediately after biting a Sumatran rhino in captivity. The blood was applied on to a Whatman FTA®blood card. Subsequent laboratory work was conducted to extract, amplify and sequence the DNA from the sample. Validation was done by sampling the hair follicles and blood samples from the rhinoceros and subjecting it to the same laboratory process. Results: BLAST search and constructed phylogenetic trees confirmed the blood meal samples were indeed from the rhino. Conclusions: This method could be used in the field application to noninvasively collect genetic samples. Collection of tabanids and other haematophagous arthropods (e.g. mosquitoes and ticks) and other blood-sucking parasites (e.g. leeches and worms) could also provide information on vector-borne diseases.

  12. Electron microscopy of a spiral-shaped bacterium in the blood and bone marrow of a rhinoceros iguana.

    OpenAIRE

    Simpson, C F; Jacobson, E R; Harvey, J.W.

    1981-01-01

    Spiral shaped bacteria present in blood smears and bone marrow of a sick rhinoceros iguana were examined by light and electron microscopy. The organisms averaged 10 micron in length and had at least three spiral turns. The cell contained nuclear areas, vacuoles and ribosomes, except at the poles where there was a virtual absence of organelles. The bacterium was found by a cell membrane, cell wall and enveloping sheath. "Blebs" were present with regularity on the cell surface. About 14 flagell...

  13. Whole-genome sequence of Clostridium lituseburense L74, isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus

    Directory of Open Access Journals (Sweden)

    Yookyung Lee

    2016-03-01

    Full Text Available Clostridium lituseburense L74 was isolated from the larval gut of the rhinoceros beetle, Trypoxylus dichotomus collected in Yeong-dong, Chuncheongbuk-do, South Korea and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession NZ_LITJ00000000.

  14. Japanese Interest in “Hotaru” (Fireflies and “Kabuto-Mushi” (Japanese Rhinoceros Beetles Corresponds with Seasonality in Visible Abundance

    Directory of Open Access Journals (Sweden)

    Kenta Takada

    2012-04-01

    Full Text Available Seasonal changes in the popularity of fireflies [usually Genji-fireflies (Luciola cruciata Motschulsky in Japan] and Japanese rhinoceros beetles [Allomyrina dichotoma (Linne] were investigated to examine whether contemporary Japanese are interested in visible emergence of these insects as seasonal events. The popularity of fireflies and Japanese rhinoceros beetles was assessed by the Google search volume of their Japanese names, “Hotaru” and “Kabuto-mushi” in Japanese Katakana script using Google Trends. The search volume index for fireflies and Japanese rhinoceros beetles was distributed across seasons with a clear peak in only particular times of each year from 2004 to 2011. In addition, the seasonal peak of popularity for fireflies occurred at the beginning of June, whereas that for Japanese rhinoceros beetles occurred from the middle of July to the beginning of August. Thus seasonal peak of each species coincided with the peak period of the emergence of each adult stage. These findings indicated that the Japanese are interested in these insects primarily during the time when the two species are most visibly abundant. Although untested, this could suggest that fireflies and Japanese rhinoceros beetles are perceived by the general public as indicators or symbols of summer in Japan.

  15. A comparison of woody browse selection by hand-raised, boma-adapted and wild black rhinoceros, Diceros bicornis, L. in Matusadona National Park, Zimbabwe

    Directory of Open Access Journals (Sweden)

    G. Matipano

    2003-12-01

    Full Text Available Differences in woody browse selection between hand-raised (and subsequently released, boma-adapted and wild black rhinoceros, Diceros bicornis, L. were studied in Matusadona National Park between December 1999 and July 2000. Boma-adapted rhinoceros were animals that were subjected to hand-raising and were kept in bomas (enclosures over night. The feeding behaviour was different between the three rhinoceros groups. All rhinoceros groups utilised and selected for a few browse species in common, at different preference levels in the same habitat types according to season. Wild rhinoceroses browsed most in Colophospermum-Terminalia-Combretum woodland in the wet season and in thicket in the dry season. Hand-raised rhinoceroses browsed most in Colophospermum-Terminalia-Combretum woodland and boma-adated rhinos in thickets in both the wet and the early dry seasons. Hand-raised and bomaadapted rhinos changed their habitats less for browse selection than wild rhinos. This can be ascribed to a relative restriction of home range in the hand-raised group and a herding effect for the boma-adapted animals. These situations might have accounted for differences in seasonal browse selection by the rhinoceros groups.

  16. Identification of policies for a sustainable legal trade in rhinoceros horn based on population projection and socioeconomic models

    Science.gov (United States)

    Di Minin, Enrico; Laitila, Jussi; Montesino-Pouzols, Federico; Leader-Williams, Nigel; Slotow, Rob; Goodman, Peter S; Conway, Anthony J; Moilanen, Atte

    2015-01-01

    Between 1990 and 2007, 15 southern white (Ceratotherium simum simum) and black (Diceros bicornis) rhinoceroses on average were killed illegally every year in South Africa. Since 2007 illegal killing of southern white rhinoceros for their horn has escalated to >950 individuals/year in 2013. We conducted an ecological–economic analysis to determine whether a legal trade in southern white rhinoceros horn could facilitate rhinoceros protection. Generalized linear models were used to examine the socioeconomic drivers of poaching, based on data collected from 1990 to 2013, and to project the total number of rhinoceroses likely to be illegally killed from 2014 to 2023. Rhinoceros population dynamics were then modeled under 8 different policy scenarios that could be implemented to control poaching. We also estimated the economic costs and benefits of each scenario under enhanced enforcement only and a legal trade in rhinoceros horn and used a decision support framework to rank the scenarios with the objective of maintaining the rhinoceros population above its current size while generating profit for local stakeholders. The southern white rhinoceros population was predicted to go extinct in the wild Datos de Costo Económico con Referencia Espacial y de Beneficio a la Biodiversidad y la Efectividad de una Estrategia de Determinación de Costos Resumen Entre 1990 y 2007, en promedio fueron cazados ilegalmente cada año 15 rinocerontes sureños blancos (Ceratotherium simum simum) y negros (Diceros bicornis) en Sudáfrica. Desde 2007 la caza ilegal de rinocerontes sureños blancos por su cuerno ha escalado a más de 950 individuos al año en 2013. Llevamos a cabo un análisis ecológico-económico para determinar si el comercio legal de cuerno de rinoceronte sureño blanco podría facilitar la protección del rinoceronte. Se usaron modelos lineales generalizados para examinar a los conductores socio-económicos de la caza furtiva, con base en datos colectados desde 1990

  17. The impact of the Krakatoa eruption in 1883 on the population of Rhinoceros sondaicus in Ujung Kulon, with details of rhino observations from 1857 to 1949

    Directory of Open Access Journals (Sweden)

    N.J.van. Strien

    2010-01-01

    Full Text Available A recent suggestion that the entire population of the Javan Rhinoceros in Ujung Kulon National Park was annihilated by the effects of the eruption of the Krakatoa in 1883 is investigated. Based on a review of contemporary reports, it is shown that people survived the waves and remained settled in one village until 1906 when it was evacuated during a plague of tigers. The first report of a rhinoceros in the peninsula of Ujung Kulon dates from 1857 and the animals were occasionally reported from the area afterwards. There is no indication from the available estimates and sightings that rhinos were exterminated in the area. Ujung Kulon has been a protected area since 1921. Rhino numbers ranged upwards to about 40 or 50 for most of the period until 1949. The population of Rhinoceros sondaicus is not a new founder population established after the eruption of the Krakatoa in 1883.

  18. Rectal prolapse associated with a healed pelvic fracture in a pregnant free-ranging African black rhinoceros (Diceros bicornis. Part 2 : surgery and necropsy : case report

    Directory of Open Access Journals (Sweden)

    A. Olivier

    2001-07-01

    Full Text Available The oedematous and traumatised protruding section of the rectal tissue of an adult free-ranging female African black rhinoceros (Diceros bicornis was surgically amputated. Immediately before completion of surgery, the rhinoceros died of anaesthetic-related cardiac arrest. At necropsy a deformed pelvis and sacrum associated with a healed fracture of the left ileal wing were noted. New bone formation in and around the left ventral sacral foramina may have resulted in neuropathy of particularly the 3rd and 4th left ventral sacral nerves, which (in the horse supply the majority of the nerve fibres innervating the caudal rectum and anus. The cause of the injury is not known, although back injuries, presumably sustained during mating by bulls, have been recorded in white rhinoceros. An encounter with elephants could also have been responsible for the injury in this case.

  19. Applicability of the doubly labelled water method to the rhinoceros auklet, Cerorhinca monocerata

    Directory of Open Access Journals (Sweden)

    Masaki Shirai

    2012-09-01

    The doubly labelled water (DLW method is an isotope-based technique that is used to measure the metabolic rates of free-living animals. We validated the DLW method for measuring metabolic rates in five rhinoceros auklets (Cerorhinca monocerata compared with simultaneous measurements using the respirometric method. We calculated the CO2 production rate of four auklets (mean initial body mass: 552 g±36 s.d. injected with DLW, using the one- and two-pool models. The metabolic rate during the 24-h measurements in a respirometric chamber for resting auklets averaged 16.30±1.66 kJ h−1 (n = 4. The metabolic rates determined using the one- and two-pool models in the DLW method for the same period as the respirometric measurement averaged 16.61±2.13 kJ h−1 (n = 4 and 16.16±2.10 kJ h−1 (n = 4, respectively. The mean absolute percent error between the DLW and respirometric methods was 8.04% using the one-pool model and was slightly better than that with the two-pool model. The differences in value between the DLW and respirometric methods are probably due to oxygen isotope turnover, which eliminated only 10–14% of the initial enrichment excess.

  20. Feasibility Study of NMR Based Serum Metabolomic Profiling to Animal Health Monitoring: A Case Study on Iron Storage Disease in Captive Sumatran Rhinoceros (Dicerorhinus sumatrensis).

    Science.gov (United States)

    Watanabe, Miki; Roth, Terri L; Bauer, Stuart J; Lane, Adam; Romick-Rosendale, Lindsey E

    2016-01-01

    A variety of wildlife species maintained in captivity are susceptible to iron storage disease (ISD), or hemochromatosis, a disease resulting from the deposition of excess iron into insoluble iron clusters in soft tissue. Sumatran rhinoceros (Dicerorhinus sumatrensis) is one of the rhinoceros species that has evolutionarily adapted to a low-iron diet and is susceptible to iron overload. Hemosiderosis is reported at necropsy in many African black and Sumatran rhinoceroses but only a small number of animals reportedly die from hemochromatosis. The underlying cause and reasons for differences in susceptibility to hemochromatosis within the taxon remains unclear. Although serum ferritin concentrations have been useful in monitoring the progression of ISD in many species, there is some question regarding their value in diagnosing hemochromatosis in the Sumatran rhino. To investigate the metabolic changes during the development of hemochromatosis and possibly increase our understanding of its progression and individual susceptibility differences, the serum metabolome from a Sumatran rhinoceros was investigated by nuclear magnetic resonance (NMR)-based metabolomics. The study involved samples from female rhinoceros at the Cincinnati Zoo (n = 3), including two animals that died from liver failure caused by ISD, and the Sungai Dusun Rhinoceros Conservation Centre in Peninsular Malaysia (n = 4). Principal component analysis was performed to visually and statistically compare the metabolic profiles of the healthy animals. The results indicated that significant differences were present between the animals at the zoo and the animals in the conservation center. A comparison of the 43 serum metabolomes of three zoo rhinoceros showed two distinct groupings, healthy (n = 30) and unhealthy (n = 13). A total of eighteen altered metabolites were identified in healthy versus unhealthy samples. Results strongly suggest that NMR-based metabolomics is a valuable tool for animal health

  1. Research into the Application of the Sterile-Male Release Technique to the Rhinoceros Beetle (Coleoptera:Scarabaeidae)

    International Nuclear Information System (INIS)

    The control of the Rhinoceros beetle, which causes considerable damage in palm and coconut plantations in the tropical regions of the world, meets with difficulties resulting from the habits of the insects. Chemical and biological control methods have not yet produced economically worthwhile results. It was therefore proposed, under the Joint Project established by the UN Special Fund and the South Pacific Commission for devising a method of controlling the main pest in this group, Oryctes rhinoceros, that the possibility be investigated of using against these coleoptera the technique of releasing males sterilized by radiation. Studies have been made involving the two most important species O. monoceros Ol. and O. rhinoceros L. The first stage was the development of a continuous breeding method, which had not hitherto been possible because of the large-scale slaughter arising from fungus attacks by Metarrhizium anisopliae Metsch. For the larvae the technique used involved first individual rearing, followed by group rearing tests with 100 or so insects in tanks. The average temperature in both cases was close to 30°C and the insects were fed on a mixture of rotten wood and leaf mould mixed with the faeces of domestic animals. The adults, fed on banana slices, are placed in troughs or tanks containing sieved-earth. It was thus possible to rear Oryctes in several successive cycles, avoiding the epizooic stage of Metarrhizium, with a multiplication rate from one generation to the next of close on 10, Tests on radiation sterilization procedures taking as variables the gamma-ray dose, the stage of the insect and the physiological state of the imago, showed that O. monoceros adults were sterilized by a single application of 4000 rad, with a slight reduction in their length of life. The same was true of O. rhinoceros, which however required a dose greater than 6000 rad to sterilize it. The mating urge and sexual vigour of the irradiated insects are, however, reduced

  2. Evaluation of Habitat Suitability for Rhino (Rhinoceros unicornis) in Orang National Park Using Geo-Spatial Tools

    OpenAIRE

    Sarma, Pranjit Kumar; B. S. Mipun; Talukdar, Bibhab Kumar; Kumar, Rajeev; Basumatary, Ajit Kumar

    2011-01-01

    Orang National Park (Orang NP) is one of the important conservation areas in the Brahmaputra valley within North East India biogeographic zone covering an area of 78.8 km2. It is one of the prime habitats of one horned rhino (Rhinoceros unicornis) in its distribution range in south Asia. Satellite imagery of November 2008 was used to evaluate the rhino habitat pattern in the park. A habitat suitability model for one horned rhino was prepared using primary and secondary sources. Result indicat...

  3. Enhancing captive Indian rhinoceros genetics via artificial insemination of cryopreserved sperm.

    Science.gov (United States)

    Stoops, Monica A; Campbell, Mark K; DeChant, Christopher J; Hauser, Joe; Kottwitz, Jack; Pairan, Randal D; Shaffstall, Wendy; Volle, Kurt; Roth, Terri L

    2016-09-01

    The objective of this study was to design an artificial insemination (AI) protocol using cryopreserved spermatozoa to obtain pregnancies in captive Indian rhinoceroses (Rhinoceros unicornis). Four methods developed varied by timing and approach, as follows; Method 1: females (n=2) were inseminated pre- and post-ovulation under general anesthesia, Method 2: females (n=2) were inseminated pre-ovulation without anesthetic via endoscopy, Method 3: females (n=1) were inseminated pre-ovulation without anesthetic via manual insertion of an insemination catheter, Method 4: females (n=2) were inseminated same as Method 3 with the addition of standing sedation. Semen deposition site varied as a result of changes in AI technology and experience. All females conceived following intrauterine AI using three methods. Four pregnancies (n=3 females) produced via Method 3 and 4 resulted in term births (n=2 male calves, n=2 female calves) at 481.8±12.8days post-AI. Unfortunately, two early pregnancy losses were documented in a fourth female conceiving via Method 2. Pregnancy rates were 0%, 22%, 17%, and 50% for Method 1-4, respectively. Method 3 and 4 rates improved to 29% and 67%, respectively when accounting for AI's conducted only on ovulatory estrous cycles. Spermatozoa (n=5 males) were cryopreserved 0.3-9.3 y prior to successful AI procedures. The lowest dose of frozen-thawed sperm resulting in conception was 500×10(6) motile sperm. Mean time from AI to ovulation in conceptive and non-conceptive cycles was 26±11.8h and 66±80.7h, respectively. PMID:27449405

  4. Flight behavior of the rhinoceros beetle Trypoxylus dichotomus during electrical nerve stimulation

    International Nuclear Information System (INIS)

    Neuronal stimulation is an intricate part of understanding insect flight behavior and control insect itself. In this study, we investigated the effects of electrical pulses applied to the brain and basalar muscle of the rhinoceros beetle (Trypoxylus dichotomus). To understand specific neuronal stimulation mechanisms, responses and flight behavior of the beetle, four electrodes were implanted into the two optic lobes, the brain's central complex and the ventral nerve cord in the posterior pronotum. We demonstrated flight initiation, turning and cessation by stimulating the brain. The change undergone by the wing flapping in response to the electrical signal was analyzed from a sequence of images captured by a high-speed camera. Here, we provide evidence to distinguish the important differences between neuronal and muscular flight stimulations in beetles. We found that in the neural potential stimulation, both the hind wing and the elytron were suppressed. Interestingly, the beetle stopped flying whenever a stimulus potential was applied between the pronotum and one side of the optic lobe, or between the ventral nerve cord in the posterior pronotum and the central complex. In-depth experimentation demonstrated the effective of neural stimulation over muscle stimulation for flight control. During electrical stimulation of the optic lobes, the beetle performed unstable flight, resulting in alternating left and right turns. By applying the electrical signal into both the optic lobes and the central complex of the brain, we could precisely control the direction of the beetle flight. This work provides an insight into insect flight behavior for future development of insect-micro air vehicle. (paper)

  5. Standardising Home Range Studies for Improved Management of the Critically Endangered Black Rhinoceros

    Science.gov (United States)

    Plotz, Roan D.; Grecian, W. James; Kerley, Graham I.H.; Linklater, Wayne L.

    2016-01-01

    Comparisons of recent estimations of home range sizes for the critically endangered black rhinoceros in Hluhluwe-iMfolozi Park (HiP), South Africa, with historical estimates led reports of a substantial (54%) increase, attributed to over-stocking and habitat deterioration that has far-reaching implications for rhino conservation. Other reports, however, suggest the increase is more likely an artefact caused by applying various home range estimators to non-standardised datasets. We collected 1939 locations of 25 black rhino over six years (2004–2009) to estimate annual home ranges and evaluate the hypothesis that they have increased in size. A minimum of 30 and 25 locations were required for accurate 95% MCP estimation of home range of adult rhinos, during the dry and wet seasons respectively. Forty and 55 locations were required for adult female and male annual MCP home ranges, respectively, and 30 locations were necessary for estimating 90% bivariate kernel home ranges accurately. Average annual 95% bivariate kernel home ranges were 20.4 ± 1.2 km2, 53 ±1.9% larger than 95% MCP ranges (9.8 km2 ± 0.9). When home range techniques used during the late-1960s in HiP were applied to our dataset, estimates were similar, indicating that ranges have not changed substantially in 50 years. Inaccurate, non-standardised, home range estimates and their comparison have the potential to mislead black rhino population management. We recommend that more care be taken to collect adequate numbers of rhino locations within standardized time periods (i.e., season or year) and that the comparison of home ranges estimated using dissimilar procedures be avoided. Home range studies of black rhino have been data deficient and procedurally inconsistent. Standardisation of methods is required. PMID:27028728

  6. The sixth rhino: a taxonomic re-assessment of the critically endangered northern white rhinoceros.

    Directory of Open Access Journals (Sweden)

    Colin P Groves

    Full Text Available BACKGROUND: The two forms of white rhinoceros; northern and southern, have had contrasting conservation histories. The Northern form, once fairly numerous is now critically endangered, while the southern form has recovered from a few individuals to a population of a few thousand. Since their last taxonomic assessment over three decades ago, new material and analytical techniques have become available, necessitating a review of available information and re-assessment of the taxonomy. RESULTS: Dental morphology and cranial anatomy clearly diagnosed the southern and northern forms. The differentiation was well supported by dental metrics, cranial growth and craniometry, and corresponded with differences in post-cranial skeleton, external measurements and external features. No distinctive differences were found in the limited descriptions of their behavior and ecology. Fossil history indicated the antiquity of the genus, dating back at least to early Pliocene and evolution into a number of diagnosable forms. The fossil skulls examined fell outside the two extant forms in the craniometric analysis. Genetic divergence between the two forms was consistent across both nuclear and mitochondrial genomes, and indicated a separation of over a million years. CONCLUSIONS: On re-assessing the taxonomy of the two forms we find them to be morphologically and genetically distinct, warranting the recognition of the taxa formerly designated as subspecies; Ceratotherium simum simum the southern form and Ceratotherium simum cottoni the northern form, as two distinct species Ceratotherium simum and Ceratotherium cottoni respectively. The recognition of the northern form as a distinct species has profound implications for its conservation.

  7. The influence of dietary tannin supplementation on digestive performance in captive black rhinoceros (Diceros bicornis).

    Science.gov (United States)

    Clauss, M; Castell, J C; Kienzle, E; Dierenfeld, E S; Flach, E J; Behlert, O; Ortmann, S; Streich, W J; Hummel, J; Hatt, J-M

    2007-12-01

    Free-ranging browsers such as the black rhinoceros (Diceros bicornis) consume a diet that contains tannins, whereas the diets offered to them in captivity consist mostly of items known to contain hardly any such secondary plant compounds. Tannins could have potentially beneficial effects, including the chelation of dietary iron (iron storage disease is a common problem in black rhinos). Here, we tested the acceptance, and the consequences on digestion variables, of a low-dose tannin supplementation in captive animals. Eight black rhinoceroses from three zoological institutions were used. Faecal output was quantified by total faecal collection. Diets fed were regular zoo diets supplemented with either tannic acid (T, hydrolysable tannin) or quebracho (Q, condensed tannins); overall tannin source intake increased at 5-15 g/kg dry matter (DM) in relation to regular zoo diets. Adaptation periods to the new diets were >2 months. Additional data were taken from one hitherto unpublished study. Data were compared to measurements in the same animals on their regular zoo diets. All animals accepted the new diets without hesitation. There was no influence of tannin supplementation on digestion coefficients of DM and its constituents, or faecal concentrations of short-chain fatty acids or lactate. Water intake did not increase during tannin supplementation. Should the inclusion of dietary tannin sources be an objective in the development of diets for captive rhinoceroses, moderate doses such as used in this study are unlikely to cause relevant depressions of digestive efficiency and will not interfere with bacterial fermentation in a relevant way. PMID:17988348

  8. The incidence and use of Oryctes virus for control of rhinoceros beetle in oil palm plantations in Malaysia.

    Science.gov (United States)

    Ramle, M; Wahid, M B; Norman, K; Glare, T R; Jackson, T A

    2005-05-01

    The rhinoceros beetle, Oryctes rhinoceros, has emerged as a serious pest of oil palm since the prohibition of burning as a method for maintaining estate hygiene in the 1990s. The abundance of beetles is surprising given that the Malay peninsula was the site of first discovery of the Oryctes virus, which has been used to effect good as a biological control agent in other regions. A survey of adult beetles was carried out throughout Malaysia using pheromone traps. Captured beetles were examined for presence of virus using both visual/microscopic examination and PCR detection methods. The survey indicated that Oryctes virus was common in Malaysia among the adult beetles. Viral DNA analysis was carried out after restriction with HindIII enzyme and indicated at least three distinct viral genotypes. Bioassays were used to compare the viral strains and demonstrate that one strain (type B) is the most virulent against both larvae and adults of the beetle. Virus type B has been cultured and released into healthy populations where another strain (type A) forms the natural background. Capture and examination of beetles from the release site and surrounding area has shown that the spread and persistence of the applied virus strain is accompanied by a reduction in palm frond damage. PMID:16039309

  9. Butorphanol with oxygen insufflation improves cardiorespiratory function in field-immobilised white rhinoceros (Ceratotherium simum

    Directory of Open Access Journals (Sweden)

    Anna Haw

    2015-03-01

    Full Text Available Opioid-induced immobilisation results in severe respiratory compromise in the white rhinoceros (Ceratotherium simum. The effectiveness of oxygen insufflation combined with butorphanol in alleviating respiratory depression in free-ranging chemically immobilised white rhinoceroses was investigated. In this prospective intervention study 14 freeranging white rhinoceroses were immobilised with a combination of etorphine, azaperone and hyaluronidase. Six minutes (min after the animals became recumbent, intravenous butorphanol was administered and oxygen insufflation was initiated. Previous boma trial results were used for comparison, using repeated measures two-way analysis of variance. The initial immobilisation-induced hypoxaemia in free-ranging rhinoceroses (arterial partial pressure of oxygen [PaO2] 35.4 mmHg ± 6.6 mmHg was similar to that observed in bomaconfined rhinoceroses (PaO2 31 mmHg ± 6 mmHg, n = 8. Although the initial hypercapnia (PaCO2 63.0 mmHg ± 7.5 mmHg was not as severe as that in animals in the boma trial (79 mmHg ± 7 mmHg, the field-immobilised rhinoceroses were more acidaemic (pH 7.10 ± 0.14 at the beginning of the immobilisation compared with boma-immobilised rhinoceroses (pH 7.28 ± 0.04. Compared with pre-intervention values, butorphanol with oxygen insufflation improved the PaO2 (81.2 mmHg ± 23.7 mmHg, p < 0.001, 5 min vs 20 min, arterial partial pressure of carbon dioxide (55.3 mmHg ± 5.2 mmHg, p < 0.01, 5 min vs 20 min, pH (7.17 ± 0.11, p < 0.001, 5 min vs 20 min, heart rate (78 breaths/min ± 20 breaths/min, p < 0.001, 5 min vs 20 min and mean arterial blood pressure (105 mmHg ± 14 mmHg, p < 0.01, 5 min vs 20 min. Oxygen insufflation combined with a single intravenous dose of butorphanol improved oxygenation and reduced hypercapnia and acidaemia in immobilised free-ranging white rhinoceroses.

  10. Feasibility of sex-sorting sperm from the white and the black rhinoceros (Ceratotherium simum, Diceros bicornis).

    Science.gov (United States)

    Behr, B; Rath, D; Mueller, P; Hildebrandt, T B; Goeritz, F; Braun, B C; Leahy, T; de Graaf, S P; Maxwell, W M C; Hermes, R

    2009-08-01

    The objective of these studies was to investigate the practicality of flow cytometric sex-sorting for spermatozoa from the white and the black rhinoceros (Ceratotherium simum, Diceros bicornis). In Experiment 1, four semen extenders were tested regarding their suitability for liquid preservation of spermatozoa before sorting. Dilution in MES-HEPES-based semen extender followed by incubation generated best sperm quality parameters (motility, viability, and acrosome integrity). In Experiment 2, the effect of staining method (15 degrees C for 4 to 6h during transport or 37 degrees C for 1 to 1.5h) on sort efficiency and sperm quality was investigated. Staining at 15 degrees C during transport resulted in a higher percentage of sperm samples showing a resolution of X- and Y-chromosome-bearing populations (60%) compared with that for staining at 37 degrees C after transport (33%) and resulted in superior sperm integrity after staining (43.8+/-11.3% vs. 19.6+/-12.1%). Sort rate was 300 to 700 cells/sec and sort purity, determined for one sorted sample, was 94% for X-chromosome-bearing spermatozoa. In Experiment 3, the highly viscous component of rhinoceros seminal plasma, which complicates the process of sperm sorting, was examined by gel electrophoresis and mass spectrometry. Results suggested a 250-kDa glycoprotein (most likely originating from the bulbourethral gland) to be responsible for the characteristic viscosity of ejaculates. In Experiment 4, viscosity of seminal plasma, as measured by electron spin resonance spectroscopy, was significantly decreased after addition of alpha-amylase or collagenase (0.5 and 3IU per 100 microL seminal plasma, respectively) by 28% and 21%, respectively, with no negative effect on sperm characteristics. The results of this study demonstrate for the first time that rhinoceros spermatozoa can be successfully sorted into high-purity X- and Y-chromosome-bearing populations. Furthermore, the successful liquefaction of viscous ejaculates

  11. Measurement and characterization of a soundscape of captive southern white rhinoceros (Ceratotherium simum simum) at a wildlife park conservation center

    Science.gov (United States)

    Wiseman, Susan M.

    Many animals, including the myopic rhinoceros, depend on hearing and smell for navigation and to interpret their environment. For them, the "soundscape" and "scentscape" are equivalent to our landscape. Noise damages humans physiologically, including reproductively, and likely damages other mammals. Rhinos vocalize sonically and infrasonically but audiograms are unavailable. Infrasonic noise tends to be chronic in urban areas, which frequently surround city zoos. Rhinos' biological and social management have been studied but little attention, if any, has been paid to their soundscapes. This project develops a standard by which such soundscapes may be measured, documented, and compared, so that once a wide range of rhino facilities have been similarly investigated, correlations could be sought between their sound metrics and the health and well-being of their animals. The interests of geographers overlap many disciplines, but the questions raised by, and the approaches of geographers frequently differ from those addressed by the original specialists, so a broader understanding of the soundscape and ways to record it may well add value to acoustic studies while simultaneously deepening geographic knowledge. This research asks: How can a soundscape of captive southern white rhinoceros (Ceratotherium simum simum) be comprehensively measured and characterized? What does doing so inform about their environment of captivity? How can this method be employed to understand the contrasts of the soundscapes of captivity and natural habitats? To begin to answer these questions, the following goals are addressed: 1. To develop a series of procedures to comprehensively record, measure, analyze, and characterize a broadband white rhino soundscape; 2. To note their vocalizations, and to roughly estimate the bandwidth used by these particular animals; 3. By demonstrating that techniques and language not normally used in the discipline of Geography could broaden its scope and expand

  12. Abundance of food plant species and food habits of Rhinoceros unicorns Linn. in Pobitora Wildlife Sanctuary, Assam, India

    OpenAIRE

    P. Konwar; M.K. Saikia; P.K. Saikia

    2009-01-01

    Food habits and abundance of food plant species of Rhinoceros unicornis in Pobitora Wildlife Sanctuary were studied from January 1999 through December 2001. Totally 32 numbers of Rhino food plants were identified, of which 15 were grasses, four shrubs, five aquatic hydrophytes and eight tree species (21 terrestrial and 11 aquatic). During the dry season, the Rhino feeds on almost 90% food items from Hemarthria compressa, Arundo donax, Phragmites karka, Cerex rubro-brumee etc. The other shor...

  13. Abundance of food plant species and food habits of Rhinoceros unicorns Linn. in Pobitora Wildlife Sanctuary, Assam, India

    Directory of Open Access Journals (Sweden)

    P. Konwar

    2009-09-01

    Full Text Available Food habits and abundance of food plant species of Rhinoceros unicornis in Pobitora Wildlife Sanctuary were studied from January 1999 through December 2001. Totally 32 numbers of Rhino food plants were identified, of which 15 were grasses, four shrubs, five aquatic hydrophytes and eight tree species (21 terrestrial and 11 aquatic. During the dry season, the Rhino feeds on almost 90% food items from Hemarthria compressa, Arundo donax, Phragmites karka, Cerex rubro-brumee etc. The other short grasses such as Cynodon dactylon, Andropogon ssp., Cenchrus ciliaris, Chrysopogon aciculatus and tender and young shoots and twigs of Schelristechya fuesche, Saccharum spontaneum, Lagerstroemia flosreginae etc. are consumed in limited portions. The rhino consumes 11 cultivated crops and vegetables, viz., Ricinus communis, Oryza sativa, Solanum melongena, Lycopersicon esculentum, Solanum tuberosum, Brassica nigra, Luffa cylindrica, Luffa acutangula, Cucurbita moschata, Cucumis sativus and Ipomoea batatas etc. Highest density of food plant species observed in the study area were Cynodon dactylon (167.5/m2, Hemarthria compressa (73.75/m2, Vetiveria zizanioides (56/m2, Saccharum ravannae (51.5/m2, Pharagmites karka (50.75/m2, Leersia hexandra (46.75/m2, Brachiarea pseudointerrupta (40/m2 and Eichhornia crassipes (35/m2.

  14. Applying COI gene for the authentication of the rhinoceros horn and its products%基于COI基因对犀角工艺品真伪的鉴别

    Institute of Scientific and Technical Information of China (English)

    赵竹; 宋云; 许瑾; 何增磊; 李明福

    2013-01-01

    犀角及其制品在市场上价格昂贵,准确鉴定其真伪对于维护市场秩序,打击走私,保护珍稀濒危野生动物具有重要意义.采用磁珠法提取疑似犀角工艺品A和市售仿伪工艺品B的总DNA,并选用COI基因,进行扩增、测序,在NCBI中BLAST比对,并构建系统进化树,结果表明被检测的疑似犀角工艺品A的COI基因序列与非洲黑犀的同源性高达99%,聚为一类,而市售仿伪工艺品B与家牛同源性高达100%,因此该疑似犀角工艺品A应属于非洲黑犀,市售仿伪工艺品B属于家牛.本研究首次建立了应用COI基因鉴定犀角及其制品的分子生物学方法,有利于鉴别犀角及犀角制品的真伪.%The cost of the rhinoceros hom and its products is very expensive in the market. It' s very clear that the authenticity testing of the rhinoceros horn and its products will help to keep the market order, combat smug-gling and protect the rare and endangered wild animals. The magnetic bead method was used to extract the total DNA from the potential artificial of rhinoceros horn and the artificial products in the market,the COI gene was selected to be amplified and sequenced. its sequences were Blasted in GenBank,and then the phylogenetic tree was built. The results showed that the homology of the sequence of COI gene between the potential artificial of rhinoceros horn and Diceros bicornis is 99% , and the homology of the sequence of COI gene between the ox horn and the artificial products in the market is 100% . It suggested the potential artificial of rhinoceros horn should be from Diceros bicornis, and the artificial products in the market should be from Bos taunts. This research established a new molecular biology method which was accurately reliable and utility with the COI gene to identification the rhinoceros horn and its products firstly. It can be used for the authenticity testing of rhinoceros horn to prevent poaching or smuggling the rhinoceros horn and its

  15. Stable isotope ((13)C/(12)C and (15)N/(14)N) composition of the woolly rhinoceros Coelodonta antiquitatis horn suggests seasonal changes in the diet.

    Science.gov (United States)

    Tiunov, Alexei V; Kirillova, Irina V

    2010-11-15

    The extinct woolly rhinoceros Coelodonta antiquitatis is a prominent member of the Mammuthus-Coelodonta faunal complex, but its biology is poorly known, partly because very few specimens with well-preserved soft tissues have been discovered to date. However, the permafrost-preserved horns of the woolly rhinoceros are recording structures which contain isotopic records of the diet, environmental conditions and physiological status of the animal during most of its life. In this study we report the first data on the pattern of carbon ((13)C/(12)C) and nitrogen ((15)N/(14)N) isotopic composition along the nasal horn of woolly rhinoceros. We found systematic variations in δ(13)C and δ(15)N values associated with morphologically expressed transverse banding of the horn. The comparative analysis of isotopic variation in keratinous tissues of extant and extinct herbivores suggests that the oscillation in isotopic composition of the horn was induced by seasonal changes in the diet. Although the compiled evidence is in part contradictory, we suggest that more positive δ(13)C and δ(15)N values associated with dark-colored and less dense zones of the horn indicate a summer diet. More dense and light-colored zones of the horn have lower δ(13)C and δ(15)N values possibly indicating a larger proportion of woody and shrub vegetation in the winter diet. The validity of these conclusions has to be proven in further investigations, but our data underline the potential of isotopic analysis for studies on diet and habitat use by extinct members of Pleistocene fauna. PMID:20941761

  16. Extinction chronology of the woolly rhinoceros Coelodonta antiquitatis in the context of late Quaternary megafaunal extinctions in northern Eurasia

    Science.gov (United States)

    Stuart, Anthony J.; Lister, Adrian M.

    2012-09-01

    Megafaunal extinctions in northern Eurasia (excluding Mediterranean islands) since the Last Interglacial claimed about 37% of species with body weights >44 kg. Here we review the dating evidence for the timings of these extinctions, which were staggered over tens of millennia. Moreover, individual species disappeared at different times in different geographical areas. For example, cave bear probably disappeared ca. 30.5-28.5 ka, at approximately the onset of GS-3 (beginning of 'LGM'), whereas cave lion survived until the Lateglacial ca 14 ka. Others survived into the Holocene: woolly mammoth until ca 10.7 ka in the New Siberian Islands and ca 4 ka on Wrangel Island, giant deer to at least 7.7 ka in western Siberia and European Russia. It is evident that climatic and vegetational changes had major impacts on species' ranges, and moreover the contrasting chronologies and geographical range contractions are consistent with environmental drivers relating to their differing ecologies. However, the possible role of humans in this process has still to be satisfactorily explored. We present a detailed review of the radiocarbon record and extinction chronology of an exclusively northern Eurasian species, the woolly rhinoceros Coelodonta antiquitatis, an animal adapted to feeding on low-growing herbaceous vegetation and a dry climate with minimal snowfall. During the Last Glacial the overall (time-averaged) range of C. antiquitatis extended across most of northern Eurasia, but the species failed to reach North America. On the basis of 233 ultrafiltered AMS radiocarbon dates, together with 50 others which pass our auditing criteria, we reconstruct a detailed chronology for this species. C. antiquitatis was widespread over most of the time span covered by radiocarbon dating, but from ca 35 ka (calibrated) it apparently contracted towards the east, culminating in its probable extinction ca 14 ka, with the latest dates from north-eastern Siberia. It disappeared from Britain, at

  17. Rhinos in the Parks: An Island-Wide Survey of the Last Wild Population of the Sumatran Rhinoceros.

    Directory of Open Access Journals (Sweden)

    Wulan Pusparini

    Full Text Available In the 200 years since the Sumatran rhinoceros was first scientifically described (Fisher 1814, the range of the species has contracted from a broad region in Southeast Asia to three areas on the island of Sumatra and one in Kalimantan, Indonesia. Assessing population and spatial distribution of this very rare species is challenging because of their elusiveness and very low population number. Using an occupancy model with spatial dependency, we assessed the fraction of the total landscape occupied by Sumatran rhinos over a 30,345-km2 survey area and the effects of covariates in the areas where they are known to occur. In the Leuser Landscape (surveyed in 2007, the model averaging result of conditional occupancy estimate was ψ(SE[ψ] = 0.151(0.109 or 2,371.47 km2, and the model averaging result of replicated level detection probability p(SE[p] = 0.252(0.267; in Way Kambas National Park--2008: ψ(SE[ψ] = 0.468(0.165 or 634.18 km2, and p(SE[p] = 0.138(0.571; and in Bukit Barisan Selatan National Park--2010: ψ(SE[ψ] = 0.322(0.049 or 819.67 km2, and p(SE[p] = 0.365(0.42. In the Leuser Landscape, rhino occurrence was positively associated with primary dry land forest and rivers, and negatively associated with the presence of a road. In Way Kambas, occurrence was negatively associated with the presence of a road. In Bukit Barisan Selatan, occurrence was negatively associated with presence of primary dryland forest and rivers. Using the probabilities of site occupancy, we developed spatially explicit maps that can be used to outline intensive protection zones for in-situ conservation efforts, and provide a detailed assessment of conserving Sumatran rhinos in the wild. We summarize our core recommendation in four points: consolidate small population, strong protection, determine the percentage of breeding females, and recognize the cost of doing nothing. To reduce the probability of poaching, here we present only the randomized location of site level

  18. Evaluating the virulence of Metarhizium anisopliae (Deuteromycotina: Hyphomycetes and Beauveria bassiana (Ascomycota: Hypocreales isolates to Arabian rhinoceros beetle, Oryctes agamemnon arabicus

    Directory of Open Access Journals (Sweden)

    M.W. Khudhair

    2015-12-01

    Full Text Available Virulence of entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were tested against Arabian Rhinoceros Beetle, Oryctes agamemnon arabicus larvae. Four concentrations (1×105, 1×107, 1×109 and 1×1011 conidia/mL–1 of two locally isolated entomopathogenic fungi spore suspensions were used in this study via larval direct spraying. Results revealed that both isolates can cause high mortality rate reaching 100% after 29 days. However, Beauveria bassiana scored higher mortality rate in short time especially at the concentration of 1×1011 conidia/ mL–1 with lethal time (LT50 12.75 and LT90 20.00; while, Metarhizium anisopliae caused the higher percentage of malformed adults. Moreover, both isolates affected insect’s life cycle particularly in the pupal stage which was reduced remarkably by almost 50% in comparison with the control treatment.

  19. Sperm sex-sorting and preservation for managing the sex ratio and genetic diversity of the southern white rhinoceros (Ceratotherium simum simum).

    Science.gov (United States)

    O'Brien, J K; Roth, T L; Stoops, M A; Ball, R L; Steinman, K J; Montano, G A; Love, C C; Robeck, T R

    2015-01-01

    White rhinoceros ejaculates (n=9) collected by electroejaculation from four males were shipped (10°C, 12h) to develop procedures for the production of chilled and frozen-thawed sex-sorted spermatozoa of adequate quality for artificial insemination (AI). Of all electroejaculate fractions, 39.7% (31/78) exhibited high quality post-collection (≥70% total motility and membrane integrity) and of those, 54.8% (17/31) presented reduced in vitro quality after transport and were retrospectively determined to exhibit urine-contamination (≥21.0μg creatinine/ml). Of fractions analyzed for creatinine concentration, 69% (44/64) were classified as urine-contaminated. For high quality non-contaminated fractions, in vitro parameters (motility, velocity, membrane, acrosome and DNA integrity) of chilled non-sorted and sorted spermatozoa were well-maintained at 5°C up to 54h post-collection, whereby >70% of post-transport (non-sorted) or post-sort (sorted) values were retained. By 54h post-collection, some motility parameters were higher (Pelectroejaculates indicate acceptable fertility potential for use in AI. PMID:25497423

  20. Surgical amputation of a digit and vacuum-assisted-closure (V.A.C.) management in a case of osteomyelitis and wound care in an eastern black rhinoceros (Diceros bicornis michaeli).

    Science.gov (United States)

    Harrison, Tara M; Stanley, Bryden J; Sikarskie, James G; Bohart, George; Ames, N Kent; Tomlian, Janice; Marquardt, Mark; Marcum, Annabel; Kiupel, Matti; Sledge, Dodd; Agnew, Dalen

    2011-06-01

    A 14-yr-old female eastern black rhinoceros (Diceros bicornis michaeli) presented with progressive suppurative osteomyelitis in her left hind lateral toe. beta-Hemolytic Streptococcus sp. was isolated. The animal was treated with multiple systemic antibiotics, and topical wound cleansing. Repeated debridements and nail trimmings were performed for 5 mo prior to electing amputation. The toe was surgically amputated under general anesthesia between the first and second phalanges. Analgesia was diffused into the wound topically via a catheter and elastomeric pump. The open amputation site was covered with adherent drapes and a negative-pressure wound therapy device provided vacuum-assisted closure (V.A.C.) for 72 hr. Three months later this animal developed a deep dermal ulcer on the lateral aspect of the right hind limb, at the level of the stifle. Methicillin-resistant Staphylococcus aureus was isolated. The wound was managed by initial daily lavage, followed by 1 mo of V.A.C. therapy, with 72 hr between dressing changes. Clinically, this therapy expedited the formation of healthy granulation tissue and overall healing was accelerated. The animal tolerated the machine and bandage changes well via operant conditioning. The use of negative-pressure wound therapy appeared to shorten time to resolution of slow-healing wounds in black rhinoceros. PMID:22946413

  1. A study on the behavior and colonization of translocated Greater One-horned Rhinos Rhinoceros unicornis (Mammalia: Perissodactyla: Rhinocerotidae during 90 days from their release at Manas National Park, Assam India

    Directory of Open Access Journals (Sweden)

    Deba Kumar Dutta

    2015-02-01

    Full Text Available Under the Indian Rhino Vision 2020, 18 wild Greater One-horned Rhinos Rhinoceros unicornis were translocated from two rhino bearing areas, Kaziranga National Park and Pobitora Wildlife Sanctuary to Manas National Park within the state of Assam, from 2008 to 2012. Following the release, the rhinos were closely monitored through radio tracking and direct observation to record their colonization pattern and behavioral adaptation to the new environment. Out of the 18 rhinos released at Manas, 16 (89% rhinos dispersed in approximately the same direction from the release sites. The rhinos released from Pobitora Wildlife Sanctuary strayed more when compared to the rhinos from Kaziranga National Park. This paper describes the behavior patterns observed in Manas National Park, which may provide a useful alternative approach for future rhino translocation.

  2. Zakaj in kako biti družbeno odgovoren?

    Directory of Open Access Journals (Sweden)

    Milan Simončič

    2015-09-01

    Full Text Available Research Question (RQ: Modern society is critical more and more to social irresponsible actions. Organizations are aware of that fact, in the strategy of its operations want to include the implementation of socially responsibleprinciples. We are interested in how various authors perceive the concept of social responsibility of organizations, what they are benefits of socially responsible organization, how organizations implement its mission, including itsexternal stakeholders involvement and how that activities affects the diversity of cultural environments. Purpose: Study and summary a portion of the available references, in which the authors for different purposes research the social responsibility of organizations. We confronted and compareddifferent viewpoints. Method: We used the method of description (description of facts and method of compilation (summary of known results of scientific research. Results: The collected references are categorized by selected areas presented the classification of the authors, which address particular areas of social responsibility, the resources classified by years of posts and articles by scientific journals. Organization: Organizations will summarize the findings and use it as a starting point for further research, evaluation and eventual optimization of existing models of the concept of corporate social responsibility. Society: Findings will be used as a keystone for further research, society will be aware of the importance of implementing the principles of social responsibility, they will meet the challenges of coexistence with the social responsible organizations. Originality: Groups, which will use the results for further empirical research, are the wider society and organizations who want to improve their image and carry out socially responsible actions. Review of articles highlights various views, which in other articles did not found. Limitations/Future Research: Review of articles was limited to some journals and includes only some of the areas of importance for understanding the problems of deployment and implementation, and the motives for corporate social responsibility. Articles, order than 15 years,not included due to lack of interest in the present circumstances. In further research it would be welcome to increase the number of analyzed articles and take focus to some more specific areas (for instance: consider implementing social responsibility of specific organizations, such as nuclear power plants, chemical industry, evaluate possible further ethical dilemmas in health care, genetic research, cybernetics, etc.

  3. İlkokuma Yazma Öğretimi Sürecinde Bitişik Eğik Yazı Ve Dik Temel Harflerle Yapılan Eğitimin Öğretmen Görüşlerine Göre Karşılaştırılması A Comparison Of Cursive Italic Writing And Basic Vertical Letters While Teaching Basal Reading And Writing Based On Teachers’ Views

    Directory of Open Access Journals (Sweden)

    Fatma SUSAR KIRMIZI

    2013-09-01

    Full Text Available This study aimed to identify teachers’ views with regard toteaching basal reading and writing with cursive italic writing and basicvertical letters. Action research that is one of the qualitative researchmethods was employed. The population of the study was consisted ofelementary 1st and 2nd graders’ teachers working in Denizli and itsdistricts. Using criterion sampling, 68 elementary teachers were askedfor their opinions. As for the data gathering instrument a survey ofopen-ended six questions developed by the researchers were used in thestudy. Open-coding method was used for data analysis. As a result ofthe analysis, it was seen that the teachers found teaching with basicvertical letters easier both in preparing students for reading and writingand in teaching writing. Furthermore, they argued that with basicvertical letters, students write more beautiful and legible. Most of theteachers participated in the study preferred basic vertical letters justbecause they found cursive italic writing more difficult in teaching basalreading and writing. A comprehensive training related to cursive italicwriting should be provided to teachers. Wider scale studies focusing onwhether teachers prefer cursive italic writing or basic vertical letters inteaching basal reading and writing. Bu araştırma ile öğretmenlerin ilkokuma yazma öğretimi sürecinde bitişik eğik yazı ve dik temel harflerle yapılan eğitim hakkındaki görüşlerinin belirlenmesi amaçlanmıştır. Çalışma sürecinde nitel araştırma yöntemlerinden olan durum çalışması deseni benimsenmiştir. Çalışmanın evreni Denizli il ve ilçelerindeki ilkokullarda görev yapan 1. ve 2. sınıf öğretmenlerinden oluşmaktadır. Araştırmada ölçüt örnekleme yöntemi ile belirlenen 63 kişiden oluşan 1. ve 2. sınıf öğretmeninin görüşüne başvurulmuştur. Veri toplama aracı olarak araştırmacılar tarafından geliştirilen kişisel bilgiler formu ve 6 açık u

  4. Environ: E00588 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00588 Rhinoceros bicornis, Rhinoceros simus, Rhinoceros sumatrensis horn Crude dru...g Tyrosine [CPD:C01536], Cystine [CPD:C01420], Thiolactic acid Rhinoceros bicornis [TAX:9805], Rhinoceros simus, Rhinoceros... sumatrensis, Rhinoceros [TAX:9808] Rhinocerotidae Rhinoceros bicornis, Rhinoceros simus, Rhinoceros... sumatrensis horn Crude drugs [BR:br08305] Animals Mammals E00588 Rhinoceros bicornis, Rhinoceros simus, Rhinoceros sumatrensis horn ...

  5. Taxonomy Icon Data: white rhinoceros [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available g http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Ceratotherium+simum&t=L http://biosciencedbc.jp/taxonomy_...icon/icon.cgi?i=Ceratotherium+simum&t=NL http://biosciencedbc.jp/taxonomy_icon/ic...on.cgi?i=Ceratotherium+simum&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Ceratotherium+simum&t=NS ...

  6. MOGU LI DRVNI PEPEO I BIOGNOJIVO BITI ZNAČAJNI U EKOLOŠKOJ POLJOPRIVREDI?

    OpenAIRE

    LÉVAI, László; Veres, Szilvia; Bákonyi, Nóra; Gajdos, Éva

    2008-01-01

    Poznato je da zbog iznošenja i ispiranja kationa, intenzivno korištenje tla u poljoprivredi uzrokuje zakiseljavanje. Za popravak tla, uz vapno preporuća se i drvni pepeo. Svrha provedenog ispitivanja bila je testiranje potencijala drvnog pepela za povrat kationa u tlo bez porasta toksičnosti tla, te ispitivanje učinka biofertilizatora Phylazonita MC®. Kukuruz (Zea mays L.) i krastavci (Cucumis sativus L.) uzgajani su u hranjivoj otopini u kontroliranim uvjetima. Promjene sadržaja elemenata u ...

  7. Mortality following snake bite envenomation by Bitis arietans in an HIV positive child: A case report.

    Science.gov (United States)

    Firth, Gregory B; Street, Matthew; Ramguthy, Yammesh; Doedens, Linda

    2016-07-01

    Snake bites occur commonly in the rural areas of South Africa. Hospitals where snake bites are uncommon should always have protocols on standby in the event of such cases presenting. This is the first reported case documenting the effect of human immunodeficiency virus (HIV) on snake bite in South African children.A case report and review of relevant information about the case was undertaken.We present a case of a 1-year-old child referred from a peripheral hospital following a snake bite to the left upper limb with a compartment syndrome and features of cytotoxic envenomation. The patient presented late with a wide area of necrotic skin on the arm requiring extensive debridement. The underlying muscle was not necrotic. Polyvalent antivenom (South African Institute of Medical Research Polyvalent Snakebite Antiserum) administration was delayed by 4 days after the snake bite. The patient was also diagnosed with HIV and a persistent thrombocytopenia possibly due to both HIV infection and the snake bite venom. Lower respiratory tract infections with subsequent overwhelming sepsis ultimately resulted in the child's death.The case highlights the challenge of treating a snake bite in a young child with HIV and the detrimental outcome of delayed treatment. A protocol is essential in the management of snake bites in all hospitals.Level IV, Case report.This case highlights the interaction of snake bite envenomation and HIV infection on thrombocytopenia. PMID:27399076

  8. Flow Visualization of Rhinoceros Beetle (Trypoxylus dichotomus) in Free Flight

    Institute of Scientific and Technical Information of China (English)

    Tien Van Truong; Tuyen Quang Le; Hieu Trung Tran; Hoon Cheol Park; Kwang Joon Yoon; Doyoung Byun

    2012-01-01

    Aerodynamic characteristics of the beetle,Trypoxylus dichotomus,which has a pair of elytra (forewings) and flexible hind wings,are investigated.Visualization experiments were conducted for various flight conditions of a beetle,Trypoxylus dichotomus:free,tethered,hovering,forward and climbing flights.Leading edge,trailing edge and tip vortices on both wings were observed clearly.The leading edge vortex was stable and remained on the top surface of the elytron for a wide interval during the downstroke of free forward flight.Hence,the elytron may have a considerable role in lift force generation of the beetle.In addition,we reveal a suction phenomenon between the gaps of the hind wing and the elytron in upstroke that may improve the positive lift force on the hind wing.We also found the reverse clap-fling mechanism of the T.dichotomus beetle in hovering flight.The hind wings touch together at the beginning of the upstroke.The vortex generation,shedding and interaction give a better understanding of the detailed aerodynamic mechanism of beetle flight.

  9. Creating a Theatrical World: Scenic Design for Rhinoceros

    OpenAIRE

    Zhao, Mingshuo

    2016-01-01

    Unlike painting and sculpting and other traditional artistic mediums, scenic design can help create the dramatic space or environment for story telling. This invented space can be regarded as an “installation” for a specific text with a clear cultural message. Some of them are plays, musicals, operas or interpretive movement and dances. The shape, the material, the color and the texture bring about a tangible identity defining the space where the story takes place.Theatre, as opposed to movie...

  10. Environ: E00336 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00336 Rhinoceros unicornis, Rhinoceros sondaicus horn Crude drug Tyrosine [CPD:C01...536], Cystine [CPD:C01420], Thiolactic acid Rhinoceros unicornis [TAX:9809], Rhinoceros sondaicus [TAX:10223...3] Rhinocerotidae Rhinoceros unicornis, Rhinoceros sondaicus horn Crude drugs [BR:br08305] Animals Mammals E00336 Rhinoceros unicornis, Rhinoceros sondaicus horn ...

  11. Fatty acid analyses may provide insight into the progression of starvation among squamate reptiles.

    Science.gov (United States)

    McCue, Marshall D

    2008-10-01

    Fasting-induced changes in fatty acid composition have been reported to occur within the body lipids of several types of animals; however, little is known about the changes in fatty acid profiles exhibited by reptiles subjected to prolonged fasting. This study characterizes the fatty acid profiles of six reptile species subjected to sublethal periods of fasting lasting 0, 56, 112, and 168 days. Analyses of fatty acid methyl esters (FAMEs) conducted on the total body lipids of rattlesnakes (Crotalus atrox), ratsnakes (Elaphe obsoleta), pythons (Python regius), boas (Boa constrictor), true vipers (Bitis gabonica), and monitor lizards (Varanus exanthematicus) revealed that all of the species exhibited similar characteristic changes in their fatty acid profiles during starvation stress. According to ANOVAs, the four most effective indicators of the onset of starvation were significant increases in the [1] fatty acid unsaturation index as well as ratios of [2] linoleic to palmitoleic acid, [3] oleic to palmitic, and [4] arachidonic to total fatty acid concentrations. The results of this study suggest that FAME analyses might be useful for identifying nutritional stress and/or starvation among squamate reptiles; however, forthcoming studies will be required to validate the generality of these responses. I also review the potential limitations of this approach, and suggest experiments that will be important for future applications of FAME analyses. Ultimately, it is hoped that FAME analyses can be used in conjunction with current practices as an additional tool to characterize the prevalence of starvation experienced by free-living reptiles. PMID:18657629

  12. Stable isotopes may provide evidence for starvation in reptiles.

    Science.gov (United States)

    McCue, Marshall D; Pollock, Erik D

    2008-08-01

    Previous studies have attempted to correlate stable isotope signatures of tissues with the nutritional condition of birds, mammals, fishes, and invertebrates. Unfortunately, very little is known about the relationship between food limitation and the isotopic composition of reptiles. We examined the effects that starvation has on delta13C and delta15N signatures in the tissues (excreta, carcass, scales, and claws) of six, distantly related squamate reptiles (gaboon vipers, Bitis gabonica; ball pythons, Python regius; ratsnakes, Elaphe obsoleta; boa constrictors, Boa constrictor; western diamondback rattlesnakes, Crotalus atrox, and savannah monitor lizards, Varanus exanthematicus). Analyses revealed that the isotopic composition of reptile carcasses did not change significantly in response to bouts of starvation lasting up to 168 days. In contrast, the isotopic signatures of reptile excreta became significantly enriched in 15N and depleted in 13C during starvation. The isotopic signatures of reptile scales and lizard claws were less indicative of starvation time than those of excreta. We discuss the physiological mechanisms that might be responsible for the starvation-induced changes in 13C and 15N signatures in the excreta, and present a mixing model to describe the shift in excreted nitrogen source pools (i.e. from a labile source pool to a nonlabile source pool) that apparently occurs during starvation in these animals. The results of this study suggest that naturally occurring stable isotopes might ultimately have some utility for characterizing nitrogen and carbon stress among free-living reptiles. PMID:18613003

  13. Debljina je bolest – hrana može biti i lijek; provođenje pilot-projekta

    OpenAIRE

    Dabo, Jagoda; Malatestinić, Đulija; Janković, Suzana; Benčević Striehl, Henrietta; GLIBOTIĆ KRESINA, HELENA; Dragaš Zubalj, Nataša

    2009-01-01

    Cilj: Analizom postojeće situacije na terenu, prehrambenih navika, stilova života, familijarne anamneze, te rezultatima posebnih ciljanih pregleda koji nisu u programu obveznih mjera, dati ocjenu stanja uhranjenosti učenika šestih razreda osnovne škole i predložiti interventne programe prevencije. Metode: Istraživanje prehrambenih navika i tjelesne aktivnosti provedeno je 2008. godine u sedam osnovnih škola grada Rijeke, na uzorku od 496 učenika u dobi od 12 godina. Poseban ciljani pregled...

  14. Tko želi biti medijski pismen? Metode medijskih istraživanja i njihova primjena na koncept “medijske pismenosti”

    OpenAIRE

    Volčić, Zala

    2003-01-01

    Područje medijskih istraživanja bavi se pitanjima koja uključuju složeni proces konzumacije masovnih medija i njegov odnos s praksama stvaranja značenja u publici. Jedna od trajnih tema medijskih istraživanja jest pitanje moći masovnih medija, njihovih učinaka i uloge kao sredstava kulture. U nekim se pristupima masovne medije analizira tek kao propagandna sredstva s izravnim medijskim učincima. U istančanijim inačicama smatraju se snagom koja oblikuja svijest javnosti određivanjem što je vij...

  15. Polymorphisms of chemokine receptors and its ligand alleles influencing genetic suscepti-bity to HIV-1 infection in eight ethnic groups in Chinese mainland

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Limited genetic information is available concerning the polymorphisms of HIV-1 resistant genes in indigenous Chinese populations. The aim of this study is to identify the allelic frequencies of the chemokine and chemokine receptor genes in the Chinese mainland. Genomic DNA samples extracted from whole blood of 2318 subjects were analyzed by using PCR or PCR/restriction fragment length polymorphism (RFLP) assays, and further confirmed by direct DNA sequencing. Higher frequencies of mutant CCR2-64I (19.15%-28.79%) and SDF1-3'A (19.10%-29.86%) alleles were found in subjects of 8 ethnic groups in the Chi-nese mainland. In contrast, the △32 mutation in CCR5 gene occurs at a very low frequency (0.0016, n=1287) in Han population. A relatively high frequency of CCR5- wt/D32 heterozygotes was observed in Uygurian and Mongolian populations. No △32 mutation allele was detected in Ti-betan and other 4 ethnic groups in Yunnan Province. There was no CCR5-m303 mutation in subjects of any ethnic group in the Chinese mainland. Our results suggest that the CCR5-△32 mutation is not a major resistant factor against HIV-1 infection and disease progression in Han, Tibetan and other ethnic groups in Yunnan Province. Whether higher frequen-cies of CCR2-64I and SDF1-3′A alleles constitute major genetic resistant factors or not remains to be clarified.

  16. Antioxidant status of faeces of captive black rhinoceros (Diceros bicornis) in relation to dietary tannin supplementation.

    Science.gov (United States)

    Clauss, M; Pellegrini, N; Castell, J C; Kienzle, E; Dierenfeld, E S; Hummel, J; Flach, E J; Streich, W J; Hatt, J-M

    2006-08-01

    In context with the frequent observations of excessive iron (Fe) storage in captive black rhinoceroses (Diceros bicornis), it has been suggested that both an excessive dietary Fe content and a lack of dietary Fe-chelating substances, such as tannins, is the underlying cause. Therefore, studies on the effects of tannin supplementation to captive diet are warranted. Six captive rhinoceroses were fed their normal zoo diet (N), and a similar diet supplemented with either tannic acid (T, hydrolysable tannin) or quebracho (Q, condensed tannins), and the total antioxidant capacity (TAC) was measured as mmol Trolox equivalents per kg fresh faeces. The TAC values on diets N (1.24 +/- 0.39 mmol/kg fresh faeces) and T (1.34 +/- 0.33 mmol/kg fresh faeces) were similar, but significantly higher on diet Q (2.32 +/- 0.61 mmol/kg fresh faeces). In contrast to expectations, faecal TAC increased with increasing faecal Fe, possibly as a result of the fact that the faecal Fe content was positively correlated to the proportion of concentrate feeds in the diet, which also contain antioxidants, such as vitamin E, in addition to Fe. Increased antioxidant status caused by the use of tannin substances could have a beneficial effect on animal health, but if tannins should be incorporated in designed diets, other tannin sources, such as grape pomace should be tested. PMID:16901277

  17. Eavesdropping on coconut rhinoceros beetles, red palm weevils, Asian longhorned beetles, and other invasive travelers

    Science.gov (United States)

    As global trade increases, invasive insects inflict increasing economic damage to agriculture and urban landscapes in the United States yearly, despite a sophisticated array of interception methods and quarantine programs designed to exclude their entry. Insects that are hidden inside soil, wood, or...

  18. Washington Maritime NWRC: Initial Survey Instructions for Rhinoceros Auklet Population Monitoring

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Partners from Washington Department of Fish and Wildlife and Puget Sound University designed and manage this cooperative monitoring effort under an SUP. Design and...

  19. Tooth wear in captive rhinoceroses (Diceros, Rhinoceros, Ceratotherium: Perissodactyla) differs from that of free-ranging conspecifics

    NARCIS (Netherlands)

    Taylor, L.A.; Müller, D.W.H.; Schwitzer, C.; Kaiser, T.M.; Codron, D.; Schulz, E.; Clauss, M.

    2014-01-01

    Tooth wear can affect body condition, reproductive success and life expectancy. Poor dental health is frequently reported in the zoo literature, and abrasion-dominated tooth wear, which is typical for grazers, has been reported in captive browsing ruminants. The aim of this study was to test if a si

  20. Towards establishing a rhinoceros-specific interferon-gamma (IFN-y) assay for diagnosis of tuberculosis

    NARCIS (Netherlands)

    Morar, D.; Schreuder, J.; Meny, M.; Kooten, P.J.; Tijhaar, E.; Michel, A.L.; Rutten, V.P.M.G.

    2013-01-01

    Mycobacterium bovis is the causal agent of bovine tuberculosis (BTB), with a diverse host range, extending from livestock to domestic and captive wild animals as well as free-ranging wildlife species. In South Africa, BTB is endemic in the Kruger National Park (KNP) and the Hluluwe iMfolozi National

  1. Interaction of the elytra and hind wing of a rhinoceros beetle (Trypoxylus dichotomus) during a take-off mode

    Science.gov (United States)

    Oh, Seungyoung; Oh, Sehyeong; Choi, Haecheon; Lee, Boogeon; Park, Hyungmin; Kim, Sun-Tae

    2015-11-01

    The elytra are a pair of hardened wings that cover the abdomen of a beetle to protect beetle's hind wings. During the take-off, these elytra open and flap in phase with the hind wings. We investigate the effect of the elytra flapping on beetle's aerodynamic performance. Numerical simulations are performed at Re=10,000 (based on the wingtip mean velocity and mean chord length of the hind wing) using an immersed boundary method. The simulations are focused on a take-off, and the wing kinematics used is directly obtained from the experimental observations using high speed cameras. The simulation result shows three-dimensional vortical structures generated by the hind wing of the beetle and their interaction with the elytra. The presence of elytra has a negative effect on the lift generation by the hind wings, but the lift force on the elytra themselves is negligible. Further discussions on the elytra - hind wing interaction will be provided during the presentation. Supported by UD130070ID.

  2. Quantification of Enterobacteriaceae in faeces of captive black rhinoceros (Diceros bicornis) in relation to dietary tannin supplementation.

    Science.gov (United States)

    Clauss, M; Wittenbrink, M M; Castell, J C; Kienzle, E; Dierenfeld, E S; Flach, E J; Macgregor, S K; Hoppe, T; Hummel, J; Streich, W J; Hatt, J-M

    2008-02-01

    Free-ranging browsing herbivores ingest a range of secondary plant compounds, such as tannins, with their natural diet. As many of these substances have been shown to have antibacterial properties, it could be speculated that a lack of such compounds in captive zoo diets could favour the growth of potentially pathogenic intestinal bacteria. The effect of a supplementation of a conventional diet (N, consisting mainly of grass hay and/or lucerne hay and pelleted compound feeds) fed to eight captive black rhinoceroses (Diceros bicornis) from three zoological institutions with either tannic acid (T), a source of hydrolysable tannins, or quebracho (Q), a source of condensed tannins, was investigated. The number of faecal colony forming units (CFU) of Enterobactericeae was determined by colony count of dilution series from fresh faeces applied to MacConkey agar plates. Tannins were added to the diets at approximately 5-15 g/kg dry matter, depending on the varying intake of roughage and compound feeds by the animals. There was no difference in the number of CFU between diets N (95.0 x 10(5) +/- 225.3 x 10(5)/g fresh faeces) and T (164.3 x 10(5) +/- 225.1 x 10(5)/g fresh faeces); in contrast, diet Q led to a significant reduction in CFU (4.3 x 10(5) +/- 6.5 x 10(5)/g fresh faeces) compared with the other diets. These findings suggest that condensed tannins could have the potential to reduce the number of potentially pathogenic intestinal bacteria, and that the deliberate inclusion of tannin sources in the diets of captive wild animals should be further investigated. The fact that tannic acid, shown to have antibacterial effects in various in vitro studies, did not have an effect in this study, emphasizes that the relevance of tannin supplementation for intestinal health must be verified in vivo. PMID:18184377

  3. Unusual mortalities of the eastern black rhinoceros (Diceros bicornis michaeli) due to clostridial enterotoxaemia in Ol Jogi Pyramid Sanctuary, Kenya

    NARCIS (Netherlands)

    Ndeereh, D.; Ouma, B.O.; Gaymer, J.; Mutinda, M.; Gakuya, F.

    2012-01-01

    Nine eastern black rhinoceroses (Diceros bicornis michaeli) developed clinical clostridial enterotoxaemia between May and July 2010 in the Pyramid Black Rhino Sanctuary within the Ol Jogi Conservancy, Laikipia, Kenya. The rhinos presented with a peracute syndrome characterised by severe abdominal pa

  4. Oral, nasal, and cutaneous eosinophilic granulomas in the black rhinoceros (Diceros bicornis): a lesion distinct from superficial necrolytic dermatitis.

    Science.gov (United States)

    Pessier, Allan P; Munson, Linda; Miller, R Eric

    2004-03-01

    Oral, nasal, and cutaneous lesions resembling eosinophilic granulomas (EGs) were observed in eight captive black rhinoceroses (Diceros bicornis). Oral lesions were observed in all affected animals and occurred most often behind the prehensile lip. The typical clinical history of affected animals included oral bleeding or epistaxis from multilobulated, fungating, proliferative masses with areas of ulceration. Histologically, lesions were characterized by prominent infiltrates of eosinophils and rare foci of collagen degeneration on a background of marked submucosal or dermal neovascularization. Mucosal or epidermal hyperplasia was also present sometimes in association with distinctive epithelial degenerative changes consistent with superficial necrolytic dermatopathy of black rhinoceroses. Lesions of EG and superficial necrolytic dermatopathy were interpreted as being concurrently manifested in these cases. EG lesions spontaneously resolved over periods of 30 days-7 mo and were recurrent in three animals. Lesions were responsive to treatment with corticosteroids or to local cryotherapy with liquid nitrogen. Two animals treated with systemic corticosteroids died of disseminated fungal infections, emphasizing that corticosteroids should be used cautiously in black rhinoceroses. PMID:15193066

  5. After the End: Rebuilding Post-Imperial Societies/// Bitiş‟ten Sonrası: İmpatorluk Sonrası Toplumlarını Oluşturmak

    Directory of Open Access Journals (Sweden)

    Dr. Thomas SMEDLEY

    2012-10-01

    Full Text Available This article examines the construction of two post-imperial societies comparatively by analyzing the leadership of a twentieth century Turk, Mustafa Kemal Atatürk, and a fifth century Christian, Augustine of Hippo. Both leaders offered credible alternative vision for their people. This article argues that both leaders provided feasible answers to a handful of basic questions that underlie any viable social order, using similar rhetorical strategies to powerfully reshape the hopes, dreams, and expectations of those they influenced.

  6. Rhinoceros feet step out of a rule-of-thumb: a wildlife imaging pioneering approach of synchronized computed tomography-digital radiography.

    Science.gov (United States)

    Galateanu, Gabriela; Hermes, Robert; Saragusty, Joseph; Göritz, Frank; Potier, Romain; Mulot, Baptiste; Maillot, Alexis; Etienne, Pascal; Bernardino, Rui; Fernandes, Teresa; Mews, Jurgen; Hildebrandt, Thomas Bernd

    2014-01-01

    Currently, radiography is the only imaging technique used to diagnose bone pathology in wild animals situated under "field conditions". Nevertheless, while chronic foot disease in captive mega-herbivores is widely reported, foot radiographic imaging is confronted with scarcity of studies. Numerous hindrances lead to such limited numbers and it became very clear that the traditional perspective on bone imaging in domestic animals based on extensive studies and elaborated statistical evaluations cannot be extrapolated to their non-domestic relatives. For these reasons, the authors initiated a multi-modality imaging study and established a pioneering approach of synchronized computed tomography (CT) and digital radiography (DR), based on X-ray projections derived from three-dimensional CT reconstructed images. Whereas this approach can be applied in any clinical field, as a case of outstanding importance and great concern for zoological institutions, we selected foot bone pathologies in captive rhinoceroses to demonstrate the manifold applications of the method. Several advances were achieved, endowing the wildlife clinician with all-important tools: prototype DR exposure protocols and a modus operandi for foot positioning, advancing both traditional projections and, for the first-time, species-related radiographic views; assessment of radiographic diagnostic value for the whole foot and, in premiere, for each autopodial bone; together with additional insights into radiographic appearance of bone anatomy and pathology with a unique, simultaneous CT-DR correlation. Based on its main advantages in availing a wide range of keystone data in wildlife imaging from a limited number of examined subjects and combining advantages of CT as the golden standard method for bone diseases' diagnostic with DR's clinical feasibility under field conditions, synchronized CT-DR presents a new perspective on wildlife's health management. With this we hope to provide veterinary clinicians with concrete imaging techniques and substantial diagnostic tools, which facilitate straightforward attainment and interpretation of field radiography images taken worldwide. PMID:24963807

  7. Rhinoceros Feet Step Out of a Rule-of-Thumb: A Wildlife Imaging Pioneering Approach of Synchronized Computed Tomography-Digital Radiography

    OpenAIRE

    Galateanu, Gabriela; Hermes, Robert; Saragusty, Joseph; Göritz, Frank; Potier, Romain; Mulot, Baptiste; Maillot, Alexis; Etienne, Pascal; Bernardino, Rui; Fernandes, Teresa; Mews, Jurgen; Hildebrandt, Thomas Bernd

    2014-01-01

    Currently, radiography is the only imaging technique used to diagnose bone pathology in wild animals situated under “field conditions”. Nevertheless, while chronic foot disease in captive mega-herbivores is widely reported, foot radiographic imaging is confronted with scarcity of studies. Numerous hindrances lead to such limited numbers and it became very clear that the traditional perspective on bone imaging in domestic animals based on extensive studies and elaborated statistical evaluation...

  8. Giant rhinoceros Paraceratherium and other vertebrates from Oligocene and middle Miocene deposits of the Kağızman-Tuzluca Basin, Eastern Turkey

    Science.gov (United States)

    Sen, Sevket; Antoine, Pierre-Olivier; Varol, Baki; Ayyildiz, Turhan; Sözeri, Koray

    2011-05-01

    A recent fieldwork in the Kağızman-Tuzluca Basin in northeastern Turkey led us to the discovery of three vertebrate localities which yielded some limb bones of the giant rhino Paraceratherium, a crocodile tooth, and some small mammals, respectively. These discoveries allowed, for the first time to date some parts of the sedimentary units of this basin. This study also shows that the dispersal area of Paraceratherium is wider than it was known before. Eastern Turkey has several Cenozoic sedimentary basins formed during the collision of the Arabian and Eurasian plates. They are poorly documented for vertebrate paleontology. Consequently, the timing of tectonic activities, which led to the formation of the East Anatolian accretionary complex, is not constrained enough with a solid chronological framework. This study provides the first biostratigraphic evidences for the infill under the control of the compressive tectonic regime, which built the East Anatolian Plateau.

  9. Babesia bicornis sp. nov. and Theileria bicornis sp. nov.: Tick-Borne Parasites Associated with Mortality in the Black Rhinoceros (Diceros bicornis)

    OpenAIRE

    Nijhof, Ard M; Banie L. Penzhorn; Lynen, Godelieve; Mollel, Johnson O.; Morkel, Pete; Bekker, Cornelis P.J.; Jongejan, Frans

    2003-01-01

    A novel Babesia species, designated Babesia bicornis sp. nov., was identified in three black rhinoceroses (Diceros bicornis) that died in wildlife areas in Tanzania and South Africa. Screening of black rhinoceroses in South Africa revealed, in addition to B. bicornis, a second parasite, designated Theileria bicornis sp. nov.

  10. “Ovo je trebalo biti smiješno – zašto se ne smijete!” – izvođenje povijesti i turističke šetnje u Budimpešti (Sažetak)

    OpenAIRE

    Uzelac, Kristina; Nasar, Saifullah; Lacbawan jr., Macario B.

    2015-01-01

    Performativni obrat u društvenim znanostima obuhvatio je i studije o turizmu koji se u tom kontekstu promatra kao izvedbeni process. Dosadašnje studije ukazuju na određena ograničenja ovoga pristupa. Fundamentalna kritika dramaturškog pogleda jest da izvedbenost ne promatra kao niz pojavnih društvenih procesa. Na primjeru besplatnih turističkih šetnji (free walking tours) u Budimpešti, u članku se analizira turizam kao izvedbeni čin koji se realizira kombiniranjem dominantnih kulturnih kodova...

  11. Dejavniki in kriteriji psihofizičnih sposobnosti v selekcijskih postopkih na področju varstvoslovja : diplomsko delo visokošolskega strokovnega študija Varnost in policijsko delo

    OpenAIRE

    Šekoranja, Simon

    2012-01-01

    V sedanjem času, ob hitrem življenjskem tempu, se vse manj zavedamo in pozabljamo, kako pomembna je dobra telesna pripravljenost. Biti »fit«, biti čil, oziroma biti v dobri telesni pripravljenosti je trend, moda in ne nazadnje nuja, saj je hiter način življenja vse prej kot zdrav za človeka. Biti čil pomeni, da človek svoje delovne in druge obveznosti opravlja z manjšim naporom – lažje, kar se navsezadnje v varstvoslovju od kandidatov in zaposlenih tudi pričakuje. Narava tovrstnega dela od za...

  12. Analysis of complete mitochondrial genomes from extinct and extant rhinoceroses reveals lack of phylogenetic resolution

    DEFF Research Database (Denmark)

    Willerslev, Eske; Gilbert, Tom; Binladen, Jonas; Ho, Simon Y W; Campos, Paula F; Ratan, Aakrosh; Tomsho, Lynn P; da Fonseca, Rute R; Sher, Andrei; Kuznetsova, Tatanya V; Nowak-Kemp, Malgosia; Roth, Terri L; Miller, Webb; Schuster, Stephan C

    2009-01-01

    reconstruction of the rhinoceros phylogeny. While the six species cluster into three strongly supported sister-pairings: (i) The black/white, (ii) the woolly/Sumatran, and (iii) the Javan/Indian, resolution of the higher-level relationships has no statistical support. The phylogenetic signal from individual...... Javan (Rhinoceros sondaicus), Sumatran (Dicerorhinus sumatrensis), and black (Diceros bicornis) rhinoceroses. In combination with the previously published mitochondrial genomes of the white (Ceratotherium simum) and Indian (Rhinoceros unicornis) rhinoceroses, this data set putatively enables...

  13. Dry season diets of sympatric ungulates in lowland Nepal: competition and facilitation in alluvial tall grasslands

    NARCIS (Netherlands)

    Wegge, P.; Shrestha, A.K.; Moe, S.R.

    2006-01-01

    Based on microhistological analyses of faecal material, we compared the early dry season diets of greater one-horned rhinoceros Rhinoceros unicornis, swamp deer Cervus duvauceli and hog deer Axis porcinus, which inhabit the same alluvial grassland habitat complex in lowland Nepal. Their diets were q

  14. The Boilerplate Rhino: Nature as Concocted, Nature as Found.

    Science.gov (United States)

    Quammen, David

    1993-01-01

    Argues that media representations of the animal kingdom can be erroneous. Illustrates that point using Albrecht Durer's drawing of a rhinoceros in 1515 that depicted the animal in a suit of medieval armor. Recants the argument after learning that the depiction is a fairly accurate account of the Indian rhinoceros. (MDH)

  15. İlkokuma Yazma Öğretimi Sürecinde Bitişik Eğik Yazı Ve Dik Temel Harflerle Yapılan Eğitimin Öğretmen Görüşlerine Göre Karşılaştırılması
    A Comparison Of Cursive Italic Writing And Basic Vertical Letters While Teaching Basal Reading And Writing Based On Teachers’ Views

    OpenAIRE

    Fatma SUSAR KIRMIZI; Demet KASAP

    2013-01-01

    This study aimed to identify teachers’ views with regard toteaching basal reading and writing with cursive italic writing and basicvertical letters. Action research that is one of the qualitative researchmethods was employed. The population of the study was consisted ofelementary 1st and 2nd graders’ teachers working in Denizli and itsdistricts. Using criterion sampling, 68 elementary teachers were askedfor their opinions. As for the data gathering instrument a survey ofopen-ended six questio...

  16. Navještaj evanđelja mladima danas

    OpenAIRE

    Chávez Villanueva, Pascual

    2011-01-01

    U članku je riječ o evangelizaciji i navještaju evanđelja mladima danas. Da bi netko bio evangelizator, prvo mora biti pozvan i poslan. Za kršćane to znači i biti s Isusom, biti njegov učenik, a potom i apostol. Poput prvih učenika, i današnji apostoli pozvani su pokazivati Isusa onima koji ga žele vidjeti. Valja biti i hodati zajedno s mladima kako bi im se pomoglo da požele vidjeti Isusa i susretnu se s njim u zajednici njegovih učenika, Crkvi. Središnje mjesto u evangelizaciji pripada osob...

  17. POPs and stable isotopes in bird and forage fish tissues - Persistent organic pollutant levels in juvenile salmonids, forage fish and their avian predators from Puget Sound and the outer WA coast

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is examining contaminant loads of fish prey species of a resident marine bird (Rhinoceros Auklet) breeding in inland waters (Puget Sound) and in the...

  18. Rhinocerotidae from the Upper Miocene deposits of the Western Pannonian Basin (Hungary): implications for migration routes and biogeography

    Science.gov (United States)

    Pandolfi, Luca; Gasparik, Mihály; Magyar, Imre

    2016-02-01

    Although the rhinoceros remains have high biochronological significance, they are poorly known or scarcely documented in the uppermost Miocene deposits of Europe. Several specimens collected from the Upper Miocene (around 7.0 Ma, Turolian) deposits of Kávás (Pannonian Basin, Western Hungary), previously determined as Rhinoceros sp., are revised and described in this paper. The postcranial remains of these specimens belong to "Dihoplus" megarhinus (de Christol) on the basis of the morphological and morphometric characters of humerus, radii, metacarpal and metatarsal elements. An overview of rhinoceros remains from several uppermost Miocene localities and the revision of the rhinoceros material from the Pannonian Basin suggest that "D." megarhinus spread during the latest Miocene from the Pannonian Basin towards Italy. The occurrences of this species in Western Hungary and Italy during the latest Miocene further imply that Rhinocerotini species were biogeographically segregated between Western, Southern and Central Europe.

  19. Status Kritis Dua Jenis Badak di Indonesia

    Directory of Open Access Journals (Sweden)

    Haerudin R. Sadjudin

    2016-03-01

    Full Text Available There are five species of rhinoceros in the world, two types of African (Diceros bicornis and Ceratotherium simum and three species in Asia (Rhinoceros unicornis, Rhinoceros sondaicus and Dicerorhinus sumatrensis. Indonesia has two types, namely: the Javan rhino (Rhinoceros sondaicus Desmarest, 1822 and the Sumatran rhino (Dicerorhinus sumatrensis Fischer, 1814.Both types of rhino in Indonesia is not endemic wildlife, but it is a species relich; formerly spread is very wide, but now in addition to the steadily declining population is also more limited distribution. This happens because it is caused by the conversion of forests as a habitat for rhinos, plantations, settlements, and exploitation of space for various purposes. Hunting of two species of rhinoceros also has a long history, so that a distribution in some places have been lost; as well as the habitat that has been designated as a conservation area too, the population in the last 35 years continues to decline. Therefore both the rhino species has been categorized by the IUCN (International Union of Conservation of Nature and Natural Resources as critical or threatened species (Critical Endangered Species, highly endangered species. Due to the critical status, then efforts were made to save him. But it seems these efforts have not maximized, because not all potential or the ability  multi-party support to carry out rescue from extinction.

  20. The aspects of using balance scorecard in business practice of companies operating in transitional conditions

    OpenAIRE

    Hustič, Igor

    2015-01-01

    Podjetje, ki deluje v nenehno spreminjajočem se okolju (takšno je tudi tranzicijsko) in želi biti pri tem uspešno oz. konkurenčno, mora biti strateško usmerjeno. Opredeljeno strategijo mora prevesti v merljive cilje (gre za najbolj nazorno implementacijo uravnoteženega sistema kazalnikov v poslovno prakso) ter prilagoditi organizacijsko strukturo procesom in strategiji, ne pa obratno, informirati vse zaposlene na vseh ravneh o sprejeti strategiji, jemati strategijo kot kontinuiran proces, upr...

  1. Etički krisis kod Dostojevskog

    OpenAIRE

    Senković, Željko

    2010-01-01

    U članku se razmatra nekoliko temeljnih pitanja kod Dostojevskog u kojima je uočljiv aporetički element. Tako, ovaj tragalac za smislom, govori o ljubavi (bar) dvosmjerno. Jednom je ona ključni element življenja po Riječi Krista, ali se prokazuje i kao egoistični impetus podčinjavanja i tiraniziranja Drugoga. Otkrivatelj kriza duše i duha istraživao je egzistencijalni pathos i kroz prijepore pokazivao da je biti čovjek i biti slobodan jedno te isto. Argumentira se protiv trivijalnih teza iz G...

  2. Boškovićev metodološki fenomenalizam

    OpenAIRE

    Škarica, Dario

    1999-01-01

    U članku se pod metodološkim fenomenalizmom razumijeva načelo usredotočenosti prirodoznanstvenog istraživanja isključivo na fenomene kao jedine pretpostavke (premise) prirodoznanstvenih zaključaka i teorija. Pritom načela prema kojima ti zaključci bivaju izvedeni mogu biti umske ili empirijske naravi. Isto tako i sâm predmet prirodoznanstvene teorije može biti bilo puka fikcija bilo sáma zbilja. Bitno je samo to da premise iz kojih prirodoznanstvena teorija biva izvedena budu isključivo fenom...

  3. Pluralističko društvo i religije

    OpenAIRE

    Volf, Miroslav

    2005-01-01

    Svijet je oduvijek bio vrlo religiozno mjesto i po svim izgledima nastavit će to biti u bližoj budućnosti. Ipak, to nije ono što su očekivale neke istaknute osobe europskoga moderniteta. U cijelome svijetu, pogled na život koji je sve prisutniji nije sekularni humanizam. Ako se prije pola stoljeća činilo da će sekularni humanizam biti val budućnosti, to je zato što su ga na mnogim mjestima nametnule autoritarne i totalitarne vlade — u Sovjetskome savezu, u istočnoeuropskim zemljama, u Kini i ...

  4. Prilog unapređenju rada i upravljanja u Vojnoj akademiji i na Univerzitetu odbrane / Contribution to work and management improvement in the Military Academy and the University of Defence / Повышение эффективности работы Военной академии и Университета обороны

    OpenAIRE

    Marko D. Andrejić; Ivana M. Andrejić; Slaviša N. Arsić; Srđan D. Ljubojević

    2015-01-01

    Obimne i dinamične organizacione promene koje su u poslednjih nekoliko godina sprovođene u oblasti odbrane zahvatile su i oblasti visokog obrazovanja i naučnoistraživačkog rada vezanog za odbranu. Nastojao se formirati novi, integrisani naučni i obrazovni sistem, harmonizovan sa nacionalnim sistemom, koji će biti samoobnovljiv i delom samoodrživ, te kao takav biti koristan ne samo sistemu odbrane već i široj društvenoj zajednici. Da bi se operacionalizovala osnovna zamisao osnovan je Univerzi...

  5. Vloga vohunov pri razvoju sovjetske atomske bombe : diplomsko delo visokošolskega strokovnega študija Varnost in policijsko delo

    OpenAIRE

    Križan, Petra

    2013-01-01

    Človek se je že od nekdaj zavedal, da je potrebno biti v koraku pred ostalimi, če želi biti uspešen in inovativen. Toda kako vedeti, da ni nasprotnik v razmišljanju, če ne celo v dejanjih že pred tabo? Za razblinjanje teh dvomov so tukaj nastopile osebe − vohuni, o katerih govori to diplomsko delo. Poskušala sem predstaviti pomembnost delovanja vohunov, še posebej pa sem se seveda osredotočila na njihov prispevek k razvoju sovjetske atomske bombe. Na samem začetku sem opisala pojme, ki so...

  6. DEFINICIJA I PODJELA ATIPIČNIH RANA

    OpenAIRE

    Šitum, Mirna; KOLIĆ, MAJA

    2013-01-01

    Prema definiciji rana je prekid anatomskog i funkcionalnog kontinuiteta tkiva, a s obzirom na tijek cijeljenja rane mogu biti akutne i kronične. Kronične rane su one koje ne zarastaju unutar predviđenog razdoblja u korelaciji s etiologijom i lokalizacijom rane, a u najkraćem razdoblju od 6 tjedana. Kronične rane mogu biti tipične i atipične. u tipične rane ubrajaju se ishemijske rane, neuropatski ulkus, venski ulkus te dva posebna entiteta: dekubitus i dijabetičko stopalo. Kronične rane na po...

  7. Diferencijalna dijagnoza vertiga

    OpenAIRE

    Demarin, Vida; TRKANJEC, ZLATKO; Aleksić-Shibabi, Anka; Uremović, Melita

    2007-01-01

    Vertigo je iluzija kretanja, najčešće rotacijskog kretanja. Vertigo je među najčešćim simptomima koji dovode bolesnike liječniku, a sa starenjem učestalost vertiga se povećava. Vertigo može biti uzrokovan poremećajima unutarnjeg uha – periferni vertigo, centralnim poremećajima – centralni vertigo, sustavnim bolestima, a može biti i psihogeni. Najčešći uzroci vertiga su benigni paroksizmalni pozicioni vertigo, akutni vestibularni neuronitis, Méniéreova bolest, migrena, anksiozni poremećaji, ve...

  8. UVEDBA CRM REŠITVE V SKUPINI ROTO IN VZROKI NJENE NEUPORABE PRI ZAPOSLENIH

    OpenAIRE

    Pavlinjek, Miha

    2014-01-01

    V današnjem dinamičnem poslovnem okolju, je pomembno biti korak pred ostalimi. Biti boljši od konkurence, pomeni predvideti in izkoristiti priložnosti hitreje in v večjem obsegu kot ostali. Tukaj igrajo pomembno vlogo pridobljene informacije. Tako kot lahko stranke pridejo do različnih informacij o izdelkih različnih proizvajalcev, lahko podjetja pridobijoin izkoristijo informacije o potencialnih strankah, ter na podlagi njih zgradijo dolgoročno poslovno razmerje. Ponudbe izdekov je vedn...

  9. Characterization of load bearing metrological parameters in reptilian exuviae in comparison to precision finished cylinder liner surfaces

    CERN Document Server

    Abdel-Aal, H A

    2014-01-01

    Design of precise functional surfaces is essential for many future applications. In the technological realm, the accumulated experience with the construction of such surfaces is not sufficient. Nature provides many examples of dynamic surfaces worthy of study and adoption, at least as a concept, within human engineering. In this work, we probe load-bearing features of the ventral skin of snake surfaces. We examine the structure of two snake species that mainly move by rectilinear locomotion. These are Python regius (pythonidae) and Bittis gabonica (Vipridae). To this end, we focus on the load bearing characteristics of the ventral skin surface (i.e. the Rk family of parameters). Therefore, we draw detailed comparison between the reptilian surfaces and two sets of technological data. The first set pertains to an actual commercial cylinder liner, whereas, the second set is a summary of recommended surface finish metrological values for several commercial cylinder liner manufacturers. The results highlight sever...

  10. Effect of child's cerebral palsy on the mother: a case control study in Ahvaz, Iran

    Directory of Open Access Journals (Sweden)

    Borzoo Samira

    2014-03-01

    Full Text Available Kvalitet života porodica koje imaju dete obolelo od cerebralne paralize (CP može biti značajno izmenjen. Cilj ovog istraživanja bio je da se ispita uticaj invaliditeta deteta na kvalitet života majke tako što su upoređivane majke dece sa cerebralnom paralizom i majke zdrave dece.

  11. Effect of child's cerebral palsy on the mother: a case control study in Ahvaz, Iran

    OpenAIRE

    Borzoo Samira; Nickbakht Mansoureh; Jalalian Mehrdad

    2014-01-01

    Kvalitet života porodica koje imaju dete obolelo od cerebralne paralize (CP) može biti značajno izmenjen. Cilj ovog istraživanja bio je da se ispita uticaj invaliditeta deteta na kvalitet života majke tako što su upoređivane majke dece sa cerebralnom paralizom i majke zdrave dece.

  12. Ainult üks õppekava korraga / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2004-01-01

    Tallinnas toimus osavõturohka õppekavakonverents. Tartu Ülikooli õppekava arenduskeskuse juhataja Ain Tõnisson ja BIT-i alternatiivse õppekava üks koostajaid Urve Läänemets püüdsid tõestada oma õppekava üldosa paremust

  13. ODNOS STAROG I NOVOG - SKLAD, VLAST ILI KOMPROMIS

    OpenAIRE

    Vicelja, Marina

    1991-01-01

    Trg Mljekarice i dvorište koje zatvaraju Užarska i Šporerova ulica primjeri su uspješnih interpolacija novog u staro gradsko tkivo. Pravilna revalorizacija povijesnih prostora riječkog Starog grada, njihove forme i njihova sadržaja, trebala bi biti osnova projekata i koncepcija obnove stare jezgre.

  14. UPRAVLJANJE I RAZVOJ LJUDSKIH RESURSA U OBRAZOVANJU

    OpenAIRE

    Vrban, Sonja

    2010-01-01

    Upravljanje ljudskim resursima ključna je profesionalna pozicija, nezamjenjiva za svaku tvrtku koja želi biti, dugoročno, kvalitetno pozicionirana na tržištu. Zbog velike brzine napretka tehnologije uspjeh opstanka na tržištu može garantirati najvrjedniji resurs – onaj ljudski cjeloživotnim učenjem.

  15. Haridustee = Education / Tiiu-Liisa Rummo-Laes

    Index Scriptorium Estoniae

    Rummo-Laes, Tiiu-Liisa

    2006-01-01

    Põhihariduses soolist eristumist ei ole märgata, murettekitavalt suur on poiste väljalangemine enne põhihariduse omandamist. Tütarlapsed ja noormehed üld- ja kutsehariduses, kesk- ja kõrghariduses. Noorte õppimine ja töötamine leibkonnatüübiti. Tabel, graafik, diagrammid

  16. Ortognatska kirurgija, funkcionalan ili estetski postupak

    OpenAIRE

    Uglešić, Vedran; Jokić, Davor; Knežević, Predrag; Gašparović, Stojanka

    2004-01-01

    Ortognatski kirurški zahvati mogu biti funkcionalni i estetski. Prikazani su pacijenti te ortodontske i kirurške indikacije za kirurško liječenje. U prikazu su raspravljeni primjeri preoperativnog planiranja, tijeka liječenja, rezultata i komplikacija za plastiku brade, razvoj i pomicanje donje čeljusti, razvoj gornje čeljusti i bimaksilarne zahvate.

  17. 商代晚期黄河以北地区的犀牛和水牛——从甲骨文中的(令)和兕字谈起%The Rhinoceros and Water Buffalo on North Place of Huanghe River in Late Shang Dynasty——From Chinese Word "Si" of Inscriptions on Bones or Tortoise Shells of the Shang Dynasty to Talk About Them

    Institute of Scientific and Technical Information of China (English)

    雷焕章; 葛人

    2007-01-01

    @@ 商代甲骨文中的(令),常被写定为兕或(凹豖),迄今为止,众多一流专家对它的解释是见仁见智.某些最常见的解释是:犀牛、牛一样的独角兕、兕属的牛、兕(没有解释)、让人垂涎的特殊猎物、中原地区的一种野生动物等等.本文试图就此问题再作探讨.

  18. EARLIEST OCCURRENCE OF WOOLLY RHINO (COELODONTA ANTIQUITATIS IN ITALY (LATE PLEISTOCENE, GROTTA ROMANELLI SITE

    Directory of Open Access Journals (Sweden)

    LUCA PANDOLFI

    2013-03-01

    Full Text Available We described the proximal epiphysis of a rhinoceros third metacarpus collected from the level XI of Grotta Romanelli. This level is chronologically referred to a time span between approximately 80 and 69 ka. Morphological and morphometric characters of the third metacarpus suggest that it belongs to Coelodonta antiquitatis. This is the earliest record of woolly rhino in Italy. 

  19. BIM Software Capability and Interoperability Analysis : An analytical approach toward structural usage of BIM software (S-BIM)

    OpenAIRE

    A. Taher, Ali

    2016-01-01

    This study focused on the structuralanalysis of BIM models. Different commercial software (Autodesk products and Rhinoceros)are presented through modelling and analysis of different structures with varying complexity,section properties, geometry, and material. Beside the commercial software, differentarchitectural and different tools for structural analysis are evaluated (dynamo, grasshopper,add-on tool, direct link, indirect link via IFC).

  20. Comparison of growth characteristics of anaerobic fungi isolated from ruminant and non-ruminant herbivores during cultivation in a defined medium.

    Science.gov (United States)

    Teunissen, M J; Op den Camp, H J; Orpin, C G; Huis in 't Veld, J H; Vogels, G D

    1991-06-01

    Anaerobic fungi were isolated from rumen fluid of a domestic sheep (Ovis aries; a ruminant) and from faeces of five non-ruminants: African elephant (Loxodonta africana), black rhinoceros (Diceros bicornis), Indian rhinoceros (Rhinoceros unicornis), Indian elephant (Elephas maximus) and mara (Dolichotis patagonum). The anaerobic fungus isolated from the sheep was a Neocallimastix species and the isolates from non-ruminants were all species similar to Piromyces spp. A defined medium is described which supported growth of all the isolates, and was used to examine growth characteristics of the different strains. For each fungus the lipid phosphate content was determined after growth on cellobiose and the resulting values were used to estimate fungal biomass after growth on solid substrates. The ability of isolates from ruminants and non-ruminants to digest both wheat straw and cellulose was comparable. More than 90% and 60%, respectively, of filter paper cellulose and wheat straw were digested by most strains within 60-78 h. Growth of two fungi, isolated from rumen fluid of a sheep (Neocallimastix strain N1) and from faeces of an Indian rhinoceros (Piromyces strain R1), on cellobiose was studied in detail. Fungal growth yields on cellobiose were 64.1 g (mol substrate)-1 for N1 and 34.2 g mol-1 for R1. The major fermentation products of both strains were formate, lactate, acetate, ethanol and hydrogen. PMID:1919514

  1. ZALIHE PITKIH VODA U REPUBLICI HRVATSKOJ

    OpenAIRE

    Mayer, Darko

    1996-01-01

    Godišnje obnovljive zalihe slatke vode na Zemlji iznose oko 45000 km3 . Pri današnjem stupnju razvitka ta količina dovoljna je za život 4,5 do 9 milijardi ljudi. S obzirom da se očekuje da će 2025. godine na našoj planeti živjeti preko 8,5 milijardi ljudi jasno je da će slijedeće stoljeće biti obilježeno problemom osiguranja dovoljnih količina čiste vode. Taj će problem biti posebno izražen u zemljama u razvoju i u velikim gradovima. U siromašnim zemljama aridnog i subaridnog područja nestaši...

  2. Poremećaji hranjenja i jedenja u ranoj dojenačkoj dobi, djetinjstvu i adolescenciji

    OpenAIRE

    Vidović, Vesna

    2009-01-01

    Poremećaji hranjenja i jedenja čest su medicinski i psihološki problem u adolescenciji, a mogu se javiti u dojenačkoj dobi i ranom djetinjstvu. Uzroci nastanka poremećaja su složeni i nisu potpuno istraženi. Liječenje bi trebalo biti multidimenzionalno, budući da psihofarmaci i psihoterapija primijenjeni zajedno nisu dovoljno učinkoviti, a u najvećem broju slučajeva u liječenje moraju biti uključene obitelji. Poremećaji svojom ozbiljnošću, trajanjem i teškoćama u liječenju te posljedicama za ...

  3. ZAVLAČEVANJE IZVRŠILNEGA POSTOPKA

    OpenAIRE

    Novak, Tamara

    2013-01-01

    Diplomska naloga obravnava zavlačevanje izvršbe s strani dolžnikov. Izvršba je namreč izredno pomemben del sodnega varstva, saj mora biti strankam zagotovljeno, da lahko svoje pravice uresničijo, ne le da so jim priznane. Izvršilni postopek mora zato biti učinkovit, hiter ter mora onemogočati zavlačevanje. V diplomski nalogi je tako predstavljeno, na kakšen način dolžniki v praksi zavlačujejo postopek izvršbe, prav tako je opisan tudi sistem izvršbe v Nemčiji ter predlogi, ki bi dolžnikom one...

  4. Dijalektika samoće

    OpenAIRE

    Paz, Octavio

    1991-01-01

    Samoća - osjećaj i spoznaja da si sam, otuđen od svijeta i od sebe sama - nije isključivo meksička osobina. Svi se ljudi, u nekom trenutku života, osjećaju usamljenima. A oni to i jesu, živjeti znači biti odijeljen od onoga što smo bili da bismo se približili onome što ćemo biti u tajnovitoj budućnosti. Samoća je najdublja činjenica ljudskog postojanja. Čovjek je jedno biće koje zna da je samo i jedino koje traži drugo. Njegova priroda - ako se ta riječ može upotrijebiti u odnosu na čovjeka, ...

  5. Koncept razvoja službi logistike / Concept development of logistic services

    OpenAIRE

    Marko D. Andrejić; Vlada S. Sokolović; Marjan A. Milenkov

    2010-01-01

    Da bi logističke službe, kao deo sistema odbrane, bile efikasne i efektivne moraju biti kvalitetno organizaciono-tehnološki isprojektovane i kvalitetno vođene. Moraju da imaju dugoročni koncept razvoja sa ugrađenim organizacionim aspektom, jasno izražena težišta i prioritete u funkcionisanju, a takođe i kvalitetno definisane pokazatelje uspešnosti. Neophodno je da prate promene u bližem i daljem okruženju. Takođe, svaki proces koji je u nadležnosti logističkih službi mora biti dobro isprojekt...

  6. VZGOJA DVEH GENERACIJ

    OpenAIRE

    Ambrož, Lidija

    2014-01-01

    Večkrat v življenju je vsak od nas že slišal, da je biti starš najtežja in najbolj odgovorna naloga. Biti ob tem še dober vzgojitelj, pa je včasih delo diplomata, prijatelja in še kaj od naštetih misli bi lahko opredelili. Vsak starš ima v sebi željo, da bi otroka vzgojil v zdravo, zadovoljno osebnost, kot radi rečemo: »da bi otrok bil lepo vzgojen«. Ker smo ljudje čuteča bitja in imamo radi svoje otroke, kakor so naši starši imeli radi nas. Ravno zadnja misel je ključna nit diplomske nal...

  7. Dicty_cDB: CHI233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence (All Frames) Frame A: kkkfinkpknrifvil**vkestnhqiqikkq*knnkik*kkkkkklqilqlqlqpqiii iii*nqi*qlingyqkkkhfqnvimkf*kreksyqfgnkk...tig*w*ck**ill* kykemyrcwllyasg*mrekkyllhpr**ticnlssfnwfnsss*ilylq*icfnl*kly *nnh*c*i*lvirigsklf*tki...fp*knkrnnsksskii*w***w***w***kinklinf knkikyfnliy*mfkk Frame C: kkiyk*TKKQDICYFIMSKRKHESSD...k*nili*yikclkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bit...i leqslmlnligy*nwlqvilnknlslkkqkkqfkelkdyivvvvvvvvvvviknk*inkf *k*nkif*fnilnv*k Frame B: kknl*inqktgyllfyne*kkariirfk*ksnek

  8. POKAZATELJI UHRANJENOSTI I NUTRITIVNA POTPORA ADOLESCENTICA OBOLJELIH OD ANOREKSIJE NERVOZE

    OpenAIRE

    Škoro Petranović, Vedrana; Žaja, Orjena; Banjari, Ines

    2014-01-01

    Uvod: Anoreksija nervoza (AN) predstavlja trajan poremećaj odnosa prema hrani i izgledu vlastitog tijela koji dovodi do znatnog oštećenja tjelesnog zdravlja i psiho-emocionalnog funkcioniranja. Pridružene metaboličke komplikacije zbog fizioloških osobitosti razdoblja rasta i spolnog razvoja mogu biti potencijalno ireverzibilne, izvjesno i fatalne ukoliko su kasno prepoznate. Cilj: Istražiti vrijednosti antropometrijskih parametara, elektrolitska odstupanja te ispitati trajanje i broj hosp...

  9. ALTERNATIVNE SIROVINE PREHRAMBENIH VLAKANA

    OpenAIRE

    Gaćina, Nikolina

    2014-01-01

    Prehrambena vlakana su komponente hrane koja blagotvorno djeluju na zdravlje čovjeka. Njihova proizvodnja se povećava jer se dodaju hrani koja ih uobičajeno ne sadrži da bi ona postala funkcionalna. Alternativne i jeftine sirovine za dobivanje prehrambenih vlakana mogu biti i nusproizvodi prerade nekih namirnica biljnog porijekla (jabuke, grožđe, citrusi i kim) koji zaostaju nakon njihove primarne obrane.

  10. Robustno optimalna monetarna politika sa skoro-racionalnim ocekivanjima

    OpenAIRE

    Michael Woodford

    2011-01-01

    U radu se razmatra optimalna politika monetarne stabilizacije unutar dalekovidog modela kada centralna banka uvida da ocekivanja privatnog sektora ne moraju biti nužno konzistentna modelu, i želi da izabere politiku zadovoljavajucu u slucaju bilo kog uverenja dovoljno bliskog konzistentnosti modela. Utvrdeno je da je obavezivanje i dalje bitno za optimalnu politiku, da optimalni dugorocni inflacioni target nije pod uticajem stepena potencijalnih distorzija verovanja, i da je optimalna politik...

  11. KONCEPCIJSKA STRUKTURA HRVATSKOG MODELA GLOBALNOG KOMUNIKACIJSKOG SUSTAVA

    OpenAIRE

    Grbavac, Jacinta; GRBAVAC, Vitomir; Popović, Goran

    2010-01-01

    Korisnički info sustavi u organizacijama raznih vrsta i veličina transformiraju svoje računarske resurse iz pretežno centraliziranog u distribuirani komunikacijski sustav gotovo na svim razinama. Ova nova paradigma, u biti definira ulogu velikih kompjutora unutar velikih poslovnih asocijacija kao i njihovu integraciju na nacionalnoj razini. To je, zapravo kombinacija performansi, fleksibilnost i korisničko-prijateljski odnos s malim autonomnim korisnicima od osnovnih operacija/obrada do uslug...

  12. Dicty_cDB: VHJ523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available evtkvdws ydeqsletvypaleernkerigdlfqeiikyvadnivkrckedmvlesfleatsnakivf rhnakangywnwsfenndlvitfksicnvsdnanfdfi...sdnanfnlklsf kinkx Homology vs CSM-cDNA Score E Sequences producing significant...04.12.24 Homology vs DNA Score E Sequences producing significant alignments: (bit...y vs Protein Score E Sequences producing significant alignments: (bits) Value AC117081_29( AC117081 |pid:non...VH (Link to library) VHJ523 (Link to dictyBase) - - - Contig-U13591-1 VHJ523P (Link

  13. Analiza panoge in SWOT analiza na primeru podjetja Golte

    OpenAIRE

    Kolar, Rebeka

    2012-01-01

    Za uspešnost podjetja je pomembno, da dobro poznamo svojo panogo, v kateri delujemo, dobro moramo poznati svojo konkurenco in biti vedno korak pred njo. Podrobno poznavanje panoge same pripomore k boljšemu in kvalitetnejšemu vrednotenju podjetja. SWOT analiza je pomembna za ugotavljanje konkurenčne prednosti podjetja in je ena najpogostejših in najpopularnejših analiz. Lahko jo izvajajo posamezniki ali skupina

  14. Posodobitev spletne trgovine in povezava z Microsoft Dynamics NAV

    OpenAIRE

    RONDAIJ, TILEN

    2016-01-01

    V diplomski nalogi je predstavljena posodobitev spletne trgovine slovenskega podjetja in vzpostavitev povezave med spletno trgovino in sistemom ERP Microsoft Dynamics NAV. Opisani so obstoječe stanje, povezava spletne trgovine in sistema ERP ter razlogi za posodobitev. Opravljena je podrobnejša analiza funkcionalnosti spletne trgovine, ki bi morale biti izboljšane ali dodane, kar je dodatno podkrepljeno z rezultati spletne ankete, katera se je izvedla med preteklimi kupci podjetja. Glavni ...

  15. Suvremene antropologijske teme: filozofijskoantropologijski podsjetnik suvremenoj socio-kulturnoj antropologiji

    OpenAIRE

    Skledar, Nikola

    2009-01-01

    Opća je značajka suvremenih antropologijskih i etnologijskih istraživanja zanemarivanje teorijskoga i metodologijskog značenja i uloge filozofijske antropologije i njezine tradicije. Svako filozofijskoantropologijsko istraživanje polazi od izvjesnih filozofijskih pretpostavki i razumijevanja čovjeka, čovjekove biti, smisla čovjekova stvaralaštva, kulture, povijesti itd. I ta teorijska povezanost socio-kulturne antropologije s filozofijskom antropologijom ima metodologijske reperkusije...

  16. Toponimi, ktetici i etnici u Žićima svetih otaca

    OpenAIRE

    Malić, Dragica

    2006-01-01

    Ovaj je prilog nastavak razmatranja vlastitih imena iz prethodnoga broja časopisa “Folia onomastica Croatica”, u kojem su prikazana osobna imena iz Žića svetih otaca. U navedenom su spomeniku znatno slabije zastupljena ostala vlastita imena. Među njima pretežu toponimi, a neki će od njih – vezano uz latinski predložak djela – najvjerojatnije biti jedine hrvatske potvrde.

  17. IZGRADNJA KANALIZACIJE NA OBMOČJU POSLOVNO STANOVANJSKEGA OBJEKTA GORICA V VELENJU

    OpenAIRE

    Kuhar, Jernej

    2015-01-01

    Kanalizacijski sistemi so medsebojno funkcionalno povezane naprave in objekti, ki so namenjeni za odvajanje in čiščenje odpadnih voda uporabnikov. Projektirani in zgrajeni morajo biti tako, da zagotavljajo optimalen odvod odpadne in padavinske vode ob minimalnih stroških izgradnje, vzdrževanja in obratovanja. V diplomskem delu smo opisali kanalizacijski sistem v Mestni občini Velenje in prikazali postopek izgradnje ločenega sistema kanalizacije Poslovno-stanovanjskega objekta Gorica.

  18. TRAJNOSTNO TESTIRANJE MAGNETNIH STIKAL

    OpenAIRE

    Stegu, Žiga

    2011-01-01

    V podjetju Gorenje d.d. uporabljajo v gospodinjskih aparatih magnetna stikala. Stikala so uporabljena za detekcijo odprtosti vrat hladilnikov. Pomembna so za pravilno delovanje aparata, zato mora biti življenjska doba stikal v skladu z zahtevami podjetja. Z uvedbo magnetnih stikal se je pojavil problem odpovedi zaradi neznanega vzroka. Do sedaj so preverjali vpliv vibracij, vendar samo na dveh stikalih hkrati. Namen in cilj diplomske naloge je avtomatizirana meritev življenjske dobe ve...

  19. UTJECAJ SOCIODEMOGRAFSKIH ČIMBENIKA NA POIMANJE ROMSKOGA RODITELJSTVA I ODRASTANJA

    OpenAIRE

    Šućur, Zoran

    2004-01-01

    Na uzorku od 800 romskih roditelja1 `eljelo se istra`iti u kojoj je mjeri poimanje romskoga roditeljstva i odrastanja uvjetovano socioekonomskim ~imbenicima kao {to su dob, ukupan broj djece, obrazovanje i stambeni status. Roditeljstvo nije analizirano na razini cjelovitoga modela, nego na razini aspekata roditeljstva i odrastanja koji mogu biti ilustrativni za romsku populaciju (stavovi roditelja o tome kada njihova djeca trebaju stupiti u brak, po~eti zara|ivati, briga ...

  20. POSPEŠENO UČENJE ROBOTOV ZA INTERAKCIJO Z OKOLJEM IN ČLOVEKOM NA PODLAGI SENZORIČNO-MOTORIČNEGA UČENJA

    OpenAIRE

    Peternel, Luka

    2015-01-01

    V prihodnje je premik robotov iz strukturiranih/nadzorovanih industrijskih in laboratorijskih okolij v človekov vsakdanjik neizogiben. Za uspešno vpeljavo robotov v naš vsakdanjik je treba rešiti dva osnovna problema, povezana z izvajanjem takih nalog. (1) Naloge, potrebe, orodja in okolje se razlikujejo med uporabniki. To zahteva pridobitev velike baze zelo specifičnih znanj, zato mora biti prenos znanja z uporabnika na robota enostaven, prilagodljiv in hiter. (2) Pri izvedbi ...

  1. Public health aspects of snakebite care in West Africa: perspectives from Nigeria

    OpenAIRE

    Abdulrazaq G Habib

    2013-01-01

    Snakebite envenoming is a major public health problem among rural communities of the Nigerian savanna. The saw-scaled or carpet viper (Echis ocellatus) and, to a lesser extent, the African cobras (Naja spp.) and puff adders (Bitis arietans) have proved to be the most important cause of mortality and morbidity. The main clinical features of E. ocellatus envenoming are systemic hemorrhage, incoagulable blood, shock, local swelling, bleeding and, occasionally, necrosis. Bites may be complicated ...

  2. TRANSFORMACIJSKO IN TRANSAKCIJSKO VODENJES S STRANI TOP MANAGEMENTA: PRIMER MEDNARODNE DRUŽBE X

    OpenAIRE

    Zorman, Natalija

    2013-01-01

    Zadnje čase strokovnjaki razvijajo raznovrstne multidimenzionalne modele vodenja, s katerimi si prizadevajo pripomoči k učinkovitejšemu vodenju človeškega kapitala organizacij, ki si želijo biti v koraku s časom. Eden izmed sodobno najbolj raziskovanih in veljavnih modelov vodenja enaindvajsetega stoletja, je celostni model vodenja (ang. Full Range Leadership Model - FRLM), kateri vsebuje integriran pregled komponent transakcijskega in transformacijskega vodenja, njegove meritve pa se izvajaj...

  3. MODEL ODLUČIVANJA U FARMACEUTSKOM MARKETINGU I SLUČAJ TURSKE

    OpenAIRE

    Toker, Didem; Tozan, Hakan; Vayvay, Ozalp

    2013-01-01

    Odabir prikladnog proizvoda za portfolio farmaceutske kompanije u smislu strategije i dugoročne komercijalne vrijednosti je sofisticirana problematika bazirana na mnoštvu kriterija u farmaceutskoj ekonomiji. Ovaj rad donosi sustavnu metodu za licenciranje u farmaceutskoj industriji i predlaže „fuzzy“ AHP bazirani model odlučivanja za one koji u farmaceutskoj industriji donose odluke kako bi odredili potencijal raznih proizvoda koji bi mogli biti pogodni za njihov portfolio. Predloženi model j...

  4. Protective Activity Against Oxidative Stress of Plants Indigenous to Korea

    International Nuclear Information System (INIS)

    We have screened the cytoprotective effect against Ha, Oa, and γ-ray radiation induced oxidative stress from 32 Korean plants. Betula ermani var, saitoana (caulis, leaves), Rosa wichuraiana (caulis), Sorbus commixta (caulis), Weigela florida (leaves), Cirsium rhinoceros (whole plant), and Viburnum erosum (caulis) were found to scavenge 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical and intracellular reactive oxygen species (ROS). As a result, extracts of six plants reduced cell death of Chinese hamster lung fibroblast (V79-4) cells induced by Ha,Oa, treatment. In addition, these extracts protected cell death of V79-4 cells damaged by γ-ray radiation. In addition, these extracts scavenged ROS generated by radiation. Taken together, the results suggest that Betula ermani var. saitoana, Rosa wichuraiana, Sorbus commixta, Weigela florida, Cirsium rhinoceros, and Viburnum erosum protect V79-4 cells against oxidative damage by radiation through scavenging ROS

  5. Organizacija tehnološkog procesa remonta složenih tehničkih sistema u tehničkom remontnom zavodu u Čačku

    Directory of Open Access Journals (Sweden)

    Vojkan M. Radonjić

    2014-04-01

    Full Text Available Složeni tehnički sistemi (STS od ostalih tehničkih sistema (TS razlikuju se po konstrukciji i nameni, koja može biti: zaštita ljudi, materijalnih bogatstava i teritorije. Ako želimo da STS budu ispravni i imaju zadovoljavajući nivo pouzdanosti i gotovosti,  sistem remonta mora biti u stanju da podrži zahteve koji proističu iz njihove specifičnosti. Sistem njihovog remonta mora biti programiran, a upravljanje njime zasnovano na konceptu QMS (Quality management system. Organizacija remonta STS za potrebe sistema odbrane Republike Srbije, u Tehničkom remontnom zavodu u Čačku (TRZ, primer je organizacije u koju je implementiran  procesni model sistema upravljanja kvalitetom (QMS. Ovaj članak opisuje proces remonta STS u TRZ sa njegovim procesnim sistemom upravljanja kvalitetom (QMS, koji je preduslov za efikasan i efektivan proces remonta. Proces remonta prikazan je na primeru remonta guseničnog borbenog vozila. 

  6. A Game of Horns: Transnational Flows of Rhino Horn

    OpenAIRE

    Hübschle, A.

    2016-01-01

    A multi-sectorial regime of protection including international treaties, conservation and security measures, demand reduction campaigns and quasi-military interventions has been established to protect rhinos. Despite these efforts, the poaching of rhinos and trafficking of rhino horn continue unabated. This dissertation asks why the illegal market in rhinoceros horn is so resilient in spite of the myriad measures employed to disrupt it. A theoretical approach grounded in the sociology of mark...

  7. Osteopathology in the feet of rhinoceroses: lesion type and distribution.

    Science.gov (United States)

    Regnault, Sophie; Hermes, Robert; Hildebrandt, Thomas; Hutchinson, John; Weller, Renate

    2013-12-01

    An estimated 1,170 white (Ceratotherium simum), black (Diceros bicornis), greater one-horned (Rhinoceros unicornis), and Sumatran (Dicerorhinus sumatrensis) rhinoceroses are kept in captivity worldwide, where they are a popular public attraction and serve important roles in education and conservation. Rhinoceroses in captivity are reportedly affected by a variety of foot conditions, including abscesses, nail cracking, and pododermatitis, but there are few studies reporting associated bony pathology in these species. This study aimed to describe osteopathology in rhinoceros feet and identify normal and abnormal osteologic features of rhinoceros feet. The metacarpal-tarsal and phalangeal bones from 81 feet (67 skeletal specimens and 14 cadaveric feet), derived from 27 rhinoceroses of various species, were evaluated in the study (1 black, 11 white, 2 greater one-horned, 3 Javan, 9 Sumatran, and 1 unknown). Bones were examined visually (skeletal specimens) or by computed tomography (cadaver specimens) for evidence of bony lesions. Of the 27 rhinoceroses examined, 22 showed some degree of bone pathology in at least one limb. Six broad categories of pathologic change were identified, with numbers in parentheses representing numbers of rhinoceroses with lesions in at least one limb/number of rhinoceroses examined: enthesopathy (20/27), osteoarthritis (15/27), pathologic bone remodeling (12/27), osteitis-osteomyelitis (3/27), fracture (3/8), and subluxation (3/8). The frequency of pathologic changes in fore- and hind limbs was not significantly different. Most (91%) enthesopathies were observed on the proximal phalanges of the digits, and osteoarthritis was most common in the distal interphalangeal joints of the medial and lateral digits (32 and 26%, respectively). In addition to the pathology described, all examined rhinoceroses also had multiple small surface lucencies in the distal limb bones as an apparently normal anatomic feature. This study is an important first

  8. A serological survey of brucellosis in wild ungulate species from five game parks in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Tatenda R. Motsi

    2013-03-01

    Full Text Available A retrospective serosurvey was carried out between 2009 and 2012 to detect antibodies to Brucella spp. in free-ranging African wildlife ungulates from five selected game parks in Zimbabwe. Samples were drawn from wildlife-livestock interface and non-interface areas in Zimbabwe. A total of 270 serum samples from four different species, namely African buffalo (Syncerus caffer (n=106, impala (Aepyceros melampus (n = 72, black rhinoceros (Diceros bicornis (n= 45 and white rhinoceros (Ceratotherium simum (n = 47, were tested. The percentage of positive samples was 17.0% in buffalo (18/106; 95% CI: 9.72% – 24.1% and 1.4% in impala (1/72; 95% CI: 0% – 4.2%. No antibodies to Brucella spp. were detected in the two rhinoceros species. The difference in the percentage of seropositive cases between buffalo and impala was significant (p< 0.05. Seropositivity to Brucella spp. was higher (19.1% in adult buffalo compared with juveniles and sub-adults younger than six years (5.9%. Further, seropositivity was marginally higher (20.4% in animals from wildlife-livestock interface areas than in those from non-interface areas (13.45%; OR = 1.45 although the difference was not statistically significant. The study showed that brucellosis could be more widespread in buffalo and may circulate in this species independently in the absence of contact with cattle, whilst rhinoceros may be considered less susceptible to brucellosis. The role of the wildlife-livestock interface in the epidemiology of brucellosis in wildlife and livestock is probably overstated but needs to be explored further.

  9. Near real-time ultrahigh-resolution imaging from unmanned aerial vehicles for sustainable land use management and biodiversity conservation in semi-arid savanna under regional and global change (SAVMAP)

    OpenAIRE

    Reinhard, Friedrich; Hauptfleisch, Morgan L.; Joost, Stéphane; SAVMAP, Consortium

    2015-01-01

    To prevent aggravation of existing poverty in semi-arid savannas, a comprehensive concept for the sustainable adaptive management and use of these ecosystems under unprecedented conditions is needed. SAVMAP is an innovative, trans-, and inter-disciplinary initiative whose goal is to develop a valuable monitoring tool for both sustainable land-use management and rare species conservation (black rhinoceros) in semi-arid savanna in Namibia. SAVMAP uses near real-time ultrahigh-resolution photogr...

  10. Intraocular pressure and tear production in five herbivorous wildlife species.

    Science.gov (United States)

    Ofri, R; Horowitz, I H; Raz, D; Shvartsman, E; Kass, P H

    2002-08-31

    The intraocular pressure and rate of tear production were measured in 18 addax antelopes (Addax nasomaculatus), four impalas (Aepyceros melampus), 11 wide-lipped rhinoceroses (Ceratotherium simum), 10 white-tailed wildebeests (Connochaetes gnou) and seven scimitar-horned oryxes (Oryx dammah). The animals were anaesthetised with an intramuscular injection of etorphine hydrochloride and acepromazine maleate, and the Schirmer tear test I was used to evaluate tear production, and applanation tonometry was used to evaluate the intraocular pressure. The mean (sd) rate of tear production ranged from 17.6 (3.1) mm/minute in the rhinoceros to 28.8 (8.3) mm/minute in the addax. The intraocular pressure ranged from 8.0 (1.2) mmHg in the impala to 32.1 (10.4) mmHg in the rhinoceros. The rate of tear production in the addax and the intraocular pressure in the rhinoceros appear to be the highest values of these variables to have been reported in any species. PMID:12233828

  11. Tsetse and trypanosomiasis at the Ngulia Rhino sanctuary

    International Nuclear Information System (INIS)

    The conservation of black rhinoceros (Diceros bicornis) in Kenya involves the translocation of rhinoceros to protected sanctuaries, e.g. the recently enlarged 69 km2 sanctuary at Ngulia in Tsavo West National Park. As the black rhinoceros is known to be particularly susceptible to infection with Trypanosoma brucei, there is a strong possibility that the stress of translocation will induce health problems that would not normally occur in resident populations. Similarly, the movement of animals born in tsetse-free areas to tsetse-infested areas may result in trypanosomiasis problems because of loss of immune protection in the absence of challenge in early life. Finally, there is some concern over the possibility of facilitating genetic exchange in T. brucei through the artificial movement of animals over long distances into novel environments. To aid in the development of prudent management practices, we initiated baseline studies on tsetse distribution and trypanosomiasis at the Ngulia sanctuary. To date, we have completed a dry season survey of tsetse distribution over a 125 km2 area centred on the sanctuary and have characterized the nature of the trypanosomiasis challenge in different areas. Trypanosomiasis challenge at Ngulia involves a variety of Trypanosoma spp. Nevertheless, an unusual finding is the lack of diversity in Nannomonas parasites, with most belonging to the savannah group of T. congolense

  12. Advanced optical system simulation in a coupled CAD/optical analysis package

    Science.gov (United States)

    Stevenson, Michael A.; Campillo, Chris J.; Jenkins, David G.

    1999-05-01

    Software packages capable of simulating complex optical systems have the power to shorten the design process for non-imaging illumination, projection display, and other imaging illumination systems, Breault Research Organization's Advanced Systems Analysis Program (ASAP) and Robert McNeel and Associates' Rhinoceros computer aided design software, together, allow complicated optical systems to be simulated and analyzed. Through the use of Rhinoceros, an optical system can be accurately modeled in a 3D design environment. ASAP is then used to assign optical properties to the Rhinoceros CAD model. After the optical system has been characterized, it can be analyzed and optimized, by way of features specific to the ASAP optical analysis engine. Using this simulation technique, an HID arc source manufactured by Ushio America, Inc. is accurately represented. 2D CCD images are gathered for the source's emitting-volume across its spectral bandwidth. The images are processed within ASAP, via the inverse Abel command, to produce a 3D emitting-volume. This emitting-volume is combined with an accurate model of the source geometry and its optical properties, to finalize a functioning virtual source model. The characterized source is then joined with a simulated optical system for detailed performance analysis: namely, a projection display system.

  13. Enhanced photocatalytic and photoelectrochemical activities of reduced TiO2-x/BiOCl heterojunctions

    Science.gov (United States)

    Fu, Rongrong; Zeng, Xiaoqiao; Ma, Lu; Gao, Shanmin; Wang, Qingyao; Wang, Zeyan; Huang, Baibiao; Dai, Ying; Lu, Jun

    2016-04-01

    A key issue to design highly efficient photoelectrodes for hydrogen production is how to prohibit the rapid carrier recombination. In order to use the visible light and reduce the recombination of electrons and holes, reduced TiO2-x/BiOCl heterojunctions are successfully synthesized and the photoelectrodes are assembled in this work. The effects of various Bi/Ti molar ratios on the structural, morphological, optical, photoelectrochemical and photocatalytic activities of the resultant samples are investigated systematically. The TiO2-x nanoparticles contain Ti3+, Ti2+, and oxygen vacancies (Ov), while the BiOCl nanosheets exposed {001} facet. Ultraviolet-visible diffuse reflectance spectroscopy (UV-vis DRS) results indicate that the existence of Ti3+, Ti2+ and Ov expand the light-response range. Linear scan voltammetry and electrochemical impedance spectroscopy results indicate that more efficient electron transportation is presented in the heterojunctions with the appropriate Bi/Ti molar ratio. Consequently, the reduced TiO2-x/BiOCl heterojunction with the most appropriate Bi/Ti molar ratio exhibits a high photocurrent density of 0.755 mA cm-2 with photoconversion efficiency up to 0.634%, 10.5 and 22.6 times larger than that of pure TiO2 and BiOCl. Furthermore, this heterojunction exhibit 48.38 and 12.54 times enhancement for the visible-light decomposition of rhodamine B compared with pure TiO2 and BiOCl.

  14. Obveščevalno vodena policijska dejavnost

    OpenAIRE

    Dekleva, Sven

    2015-01-01

    Policijska dejavnost 21. stoletja je v svojevrstni krizi identitete in se vse težje spopada z izzivi. Prav zaradi tega številni strokovnjaki, da bi izboljšali učinkovitost tega področja, kontinuirano predlagajo nove pristope in rešitve, znanost pa raziskuje, vpeljuje in analizira. V prihodnosti se mora marsikaj spremeniti, spremembe pa ne smejo biti samo kozmetične ali marketinške narave. Pri sistemih razvitih držav je opazen odmik od tradicionalne militaristične ureditve, ki je temeljila pre...

  15. Obravnava pravljic v predšolskem obdobju v različnih medijih

    OpenAIRE

    Lah, Mateja

    2015-01-01

    Z obravnavo pravljic uvajamo predšolske otroke v svet književnosti. S primernim izborom pravljic si otrok širi in bogati književni izbor ter se uči doživljati književno umetnost. Pozorni moramo biti na kvalitetno izbiro pravljic, na zrelost otroka, na njegovo sposobnost dojemanja in doživljanja ter na primeren način posredovanja pravljic. Poslušanje in pripovedovanje pravljic je za otroka dobra razvojna spodbuda, z njimi vplivamo na čustveni, miselni, domišljijski, izkustveni ter moralni razv...

  16. FENOTIPOVI ASTME I POREMEĆAJ HOMEOSTAZE IMUNOLOŠKOG SUSTAVA

    OpenAIRE

    STIPIĆ MARKOVIĆ, ASJA

    2011-01-01

    Danas razumijemo mnoge regulatorne putove u signalizaciji koja se odvija prije i poslije sinteze IgE i poznajemo učinke mnogobrojnih medijatora u alergijskog kaskadi, ali astma ipak i dalje ostaje klinički i znanstveni problem. Suvremena civilizacija zbunjuje imunološki sustav pa nastaje kompleksna interakcija između epigenetske regulacije, varijabilnih vanjskih čimbenika i različitih kombinacija parova utjecaja: gena, antigena i razdoblja života. Stoga će biti potrebno odgovoriti na pitanje ...

  17. IDEJNA ZASNOVA VAROVANJA GRADBENE JAME V POLHOVEM GRADCU

    OpenAIRE

    Eder, Dejan

    2011-01-01

    Gradbena jama je začasen objekt, ki ga po končani gradnji zasujemo. Gradbena jama mora biti izkopana pravilno in kakovostno, v nasprotnem primeru se lahko sesuje oz. poškoduje, kar podaljša čas in poveča stroške gradenj. Ker pomeni izkop za določen objekt vedno poseg v zemljino v različnih globinah, je potrebno takšne izkope oz. gradbene jame ustrezno varovati pred porušitvijo. V geotehnični praksi se najpogosteje uporabljajo racionalne kombinacije podpornih konstrukcij s sistemskimi sidra...

  18. Bakterijska flora zdravoga mlađa azijskoga lubina (Lates calcarifer) s naglaskom na otpornost na antibiotike i teške metale

    OpenAIRE

    S. Wei, Lee; Musa, Najiah; Wee, Wendy

    2010-01-01

    Opisana je bakterijska flora te otpornost na antibiotike i teške metale bakterija izdvojenih iz mlađa slatkovodnoga azijskoga lubina (Lates calcarifer) na mrijestilištu u Terengganu u Maleziji. Istraživanje je provedeno sa svrhom da se odredi bakterijska flora u uzorcima vode na ribogojilištu azijskoga lubina kao i otpornost izdvojenih bakterija na antibiotike i teške metale. Rezultati mogu biti od koristi za uzgajivače riba pri liječenju i provođenju preventivnih mjera. Bakterije su bile izd...

  19. POTENCIALI POVEZOVANJA SAP REŠITVE IN CRM REŠITVE NA PRIMERU PODJETJA GORENJE D.D.

    OpenAIRE

    Lešnik, Nataša

    2015-01-01

    Živimo v času nenehnih sprememb. Gospodarska kriza podjetjem otežuje prodajo njihovih izdelkov. Če se želijo podjetja obdržati na trgu in prodajati svoje izdelke, morajo biti naklonjena strankam in njihovim zahtevam. Podjetja morajo nenehno stremeti k novim izboljšavam in rešitvam informacijskih sistemov, da bodo lahko ostala konkurenčna na trgu. Rešitev CRM je orodje za upravljanje odnosov s strankami. Je sistem, ki povezuje vse tiste podatke in informacije, ki smo jih doslej imeli razd...

  20. UVEDBA ODPRTOKODNEGA CRM V MANJŠEM PODJETJU

    OpenAIRE

    Špenko, Romana

    2016-01-01

    Za upravljanje odnosov s strankami mnoga majhna podjetja v začetku ne uporabljajo temu namenjenih sistemov (CRM), temveč si pomagajo s standardnimi orodji, kot so npr. imenik, koledar in e-pošta. Sorazmerno z rastjo podjetja pa običajno raste tudi število strank, opravil in informacij, ki morajo biti pregledno zabeležene in posredovane. Pojavi se torej potreba po uvedbi CRM rešitve, v kateri bi bile integrirane vse funkcije upravljanja odnosov s strankami, od komunikacije po telefonu in e-poš...

  1. Od Ruhra do Bospora, europski gradovi kulture 2010. godine - Essen, Pečuh, Carigrad (Istanbul)

    OpenAIRE

    Orosz, Éva; Stefán, Klára; Vati, Tamás

    2010-01-01

    Godina 2010. je u mnogim aspektima posebna godina, obzirom na promjene u izboru kriterija u prethodnom periodu, proširen krug mogućih kandidata za titulu grada kulture, pa je to i omogućilo da i Istanbul, grad koji praktički simbolizira cijelu Tursku, može biti među dobitnicima ovog priznanja. Iako sva tri ova grada zadovoljavaju ciljeve i očekivanja koja se traže od nositelja ove laskave titule europskog grada kulture, u nekoliko aspekata ima mjesta i kritici. Jedan od najvažnijih može se...

  2. UTJECAJ MOTORIČKOG ISKUSTVA NA MOTORIČKU KREATIVNOST (FLUENTNOST) PREDŠKOLSKE DJECE

    OpenAIRE

    Sturza Milić, Nataša

    2014-01-01

    Cilj rada bio je razmotriti odnos između motoričke kreativnosti (fluentnosti) i motoričkog iskustva djece predškolske dobi. Prema suvremenim teorijama kreativnosti, iskustvo i znanje imaju važnu ulogu u formiranju kritične razine motoričkog znanja (ponašanja) ispod koje očitovanje kreativnosti nije moguće. Nedovoljno stimulirane i nerazvijene motoričke vještine i znanja u ovoj dobi mogu biti uzrokom smanjene ili „uspavane“ motoričke kreativnosti. Motoričke sposobnosti i znanja (motoričkim tes...

  3. INSCENIRANJE STVARNOSTI: KONSTRUKTIVISTIČKI NAČINI POUČAVANJA I UČENJA

    OpenAIRE

    Andevski, Milica; Budić, Spomenka

    2011-01-01

    Nove konstruktivističke koncepcije na području didaktike stranog jezika zasnivaju se na osnovnim pretpostavkama moderne psihologije znanja. Pri tome se polazi od činjenice da se znanje konstruiše u zavisnosti od predznanja, opažanja, konteksta i afekata pojedinca. Sticanje znanja se odvija situativno, socijalno je uslovljeno i mora imati određeni smisao i značenje. Kada je reč o produktivnom posredovanju znanja, moramo biti svesni da poučavanje ne znači i učenje. Znanje, koje je stečeno pukim...

  4. IZBOLJŠANJE PROCESA STORITEV

    OpenAIRE

    Kristl, Klemen

    2011-01-01

    Današnje turbulentno poslovno okolje prinaša podjetjem neprestane izzive. Globalizacija in gospodarske ter politične razmere prisilijo podjetja k nenehnemu prilagajanju in iskanju izboljšav. Konkurenca narekuje vedno hujši ritem, zato morajo biti spremembe hitre in kar se da učinkovite. Poznamo veliko način izboljšanja poslovanja podjetja. V mojem diplomskem seminarju sem preučil prenovo poslovnih procesov. Način prenove poslovanja je več. Štirje najpomembnejši so: celovita prenova poslova...

  5. Rehabilitacija senzibiliteta. Filozofijska konstrukcija senzibilnog čovjeka

    OpenAIRE

    Zagorac, Ivana

    2010-01-01

    Osnovna nakana teksta je ukazati na neke bitne momente u filozofijskom tematiziranju senzibiliteta. Unutar tog pokušaja se izdvaja razdoblje prosvjetiteljstva koje se pak oslanja na specifično čitanje kartezijanske misli kroz empirizam engleske provenijencije. Jean-Jacques Rousseau je prepoznat kao ključna figura ‘doba senzibiliteta’ te će njegova konstrukcija senzibilnog čovjeka biti posebno detaljno razmotrena. Zaključno se naslijeđe povijesnih, a posebno istaknuto Rousseauovih, čitanja sen...

  6. Važnost dokazivanja prisutnosti antibiotičkih ostataka u mlijeku

    OpenAIRE

    Samaržija, Dubravka; Antunac, Neven

    2002-01-01

    Antibiotički ostatci najčešće su prisutne inhibitorne tvari u mlijeku koje nepovoljno djeluju na ljudsko zdravlje, tehnološka svojstva i kakvoću mlijeka i mliječnih proizvoda. Zbog zaštite potrošača i osiguranja proizvodnje visoko kvalitetnog mlijeka Europska unija (EU) je propisom 2377/ 90. utvrdila gornju dopuštenu granicu za antibiotičke ostatke u mlijeku. Premda ostatci antibiotika u mlijeku mogu biti posljedica liječenja od bilo koje bolesti, oni su kod muznih životinja najčešće prisutni...

  7. Rehabilitacija bolesnika s ozljedom kralježnične moždine

    OpenAIRE

    Schnurrer-Luke-Vrbanić, Tea; MOSLAVAC, Saša; DŽIDIĆ, Ivan

    2012-01-01

    Ozljeda kralježnične moždine je kompleksna ozljeda s nizom posljedica koje je teško liječiti, a rehabilitacija osoba s ozljedom kralježnične moždine zahtjevna je. Posljedice ozljede za bolesnika, obitelj te užu i širu zajednicu mogu imati katastrofalan ishod s medicinske, ali i s društvene, emocionalne, psihološke i ekonomske strane, no specijaliziranim rehabilitacijskim pristupom multidisciplinarnog tima te praćenjem bolesnika u zajednici posljedice mogu biti ublažene. Cilj specijaliziranog ...

  8. OBVLADOVANJE KRIZE V POSLOVANJU PODJETJA

    OpenAIRE

    Kolednik, Mojca

    2009-01-01

    Poslovanje podjetja mora biti zaradi možnosti nastopa kriz, vedno vnaprej načrtovano. Samo v tem primeru se lahko poslovodstvo pravilno odzove na krize, ki nastopijo. Kot sem omenila že v diplomski nalogi, je pomembno, da ima krizni manager tehnična znanja, pravilen komunikacijski pristop in konceptualna znanja. Pomembno za uspešen izhod iz krize, je dobro sodelovanje med kriznim managerjem in ostalimi člani tima. V diplomskem delu sem najprej predstavila pomen krize, kako jo sploh lahko...

  9. Vrednote v šoli in v izobraževanju učiteljev:

    OpenAIRE

    Polak, Alenka; Razdevšek-Pučko, Cveta

    1995-01-01

    Vsakršno znanje vsebuje tudi vrednote in stališča. V prispevku predstavljamo, kako zaznavajo študenti bodoči učitelji vrednote v šoli in v svojem izobraževanju. Iz raziskave veje zelo jasno sporočilo in sicer, da je potrebno biti odprt do različnih pristopov k učenju in poučevanju v razredih in programih izobraževanja učiteljev.

  10. VAŽNOST EDUKACIJSKE INTERVENCIJE I ZNANJA RODITELJA O ATOPIJSKOM DERMATITISU KOD DJECE

    OpenAIRE

    Kotrulja, Lena; Milavić, Tina; Ožanić Bulić, Suzana; Šitum, Natalija; Bakija Konsuo, Ana; Muršić, Ivanka; Birkić Belanović, Ines; Dilenardo, Lidija

    2016-01-01

    Atopijski dermatitis (AD) je kronična, recidivirajuća upalna bolest kože. Neuspjeh u liječenju AD može biti izravno povezan s neprimjerenim pridržavanjem uputa o provođenju terapije kao posljedica nedostatka informacija o bolesti i osnovnim načelima liječenja. Nekoliko studija je utvrdilo da se uspješna strategija u liječenju AD zasniva na aktivnom uključenju bolesnika u provođenje skrbi kroz informiranje i edukaciju o bolesti. Cilj ovoga istraživanja bio je procijeniti poznavanje problematik...

  11. Informacijski sistem za podporo odločanju za mala podjetja z ekološko prehrano

    OpenAIRE

    Peternel, Jasna

    2016-01-01

    Magistrsko delo se osredotoča na razvoj informacijskih sistemov za podporo odločanju za mala podjetja, ki se ukvarjajo z ekološko prehrano. Odločanje predstavlja ključno komponento uspešnosti podjetja, ki mora biti ustrezno podprto z informacijsko tehnologijo. Merjenje uspešnosti informacijskih sistemov (IS) postaja vse bolj pomembno. V magistrskem delu smo za merjenje uspešnosti sistema za podporo odločanju prilagodili posodobljen D&M model uspešnosti IS. Model uspešnosti IS za mala podjetja...

  12. Strategija razvoja ravnanja s kovinskimi odpadki

    OpenAIRE

    Leskovar, Iris

    2016-01-01

    Okolje podjetja je vedno bolj nepredvidljivo, kar se je še posebej izkazalo v primerih predelovalcev kovinskih odpadkov (v nadaljevanju PKO). PKO morajo za doseganje finančne uspešnosti dobro poznati zunanje (ožje in širše) in notranje okolje podjetja, kar zahteva nenehno budnost vodilnih, kot tudi vseh ostalih zaposlenih, ki usmerjajo poslovanje in razvoj podjetja. Budnost pomeni biti pozoren na nove strateške priložnosti, ki jih lahko najdejo na prodajnih trgih in možnih dejavnostih podjetj...

  13. Ekonomski vidik konektiranja optičnih kablov

    OpenAIRE

    MIHELČIČ, KLEMEN

    2016-01-01

    Diplomsko delo prikazuje, ali bi bilo smiselno oziroma pod kakšnimi pogoji bi bilo smiselno odpreti samostojno podjetje, ki bi se ukvarjalo s proizvodnjo in prodajo povezovalnih optičnih kablov. Ker delo poskuša podati čim bolj realno in objektivno oceno, nam prikazuje, kolikšen bi moral biti osnovni kapital, kolikšna sredstva so potrebna za začetek in tekoče poslovanje podjetja. Pri tem so upoštevani najem poslovnega prostora, osnovna oprema prostora, strojna oprema, ki je potrebna za...

  14. INTOLERANCIJA NA HISTAMIN – KOJE SU MOGUĆE POSLJEDICE NA KOŽI?

    OpenAIRE

    Lugović-Mihić, Liborija; ŠEŠERKO, ANA; DUVANČIĆ, TOMISLAV; Šitum, Mirna; Mihić, Josip

    2013-01-01

    Iako se intolerancija na histamin (Histamine Intolerance, HIT) ne javlja često, posljedice mogu biti teške. Intolerancija na hranu je nealergijska preosjetljivost na hranu koja ne uključuje imunološki sustav iako su simptomi slični onima kod alergijskih reakcija posredovanih IgE-om. Čini se da HIT nastaje oštećenjem aktivnosti diaminoksidaze (DAO) zbog gastrointestinalnih bolesti ili inhibicijom DAO, a u dijelu bolesnika dokazana je i genetska predispozicija. Unos hrane bogate histaminom te a...

  15. Frekvenčna regulacija radiofrekvenčne votline

    OpenAIRE

    Menart, Jure

    2015-01-01

    To diplomsko delo opisuje načrtovanje, razvoj in uporabo sistema za frekvenčno regulacijo EMMA pospeševalniške radiofrekvenčne votline. Problem pri radiofrekvenčnih votlinah je, da se zaradi različnih zunanjih dejavnikov (sprememba temperature okolice, mehanski stres, ...) neprestano frekvenčno premikajo (angl. detuning). Posledica frekvenčnega premika votline je, da elektromagnetno polje v votlini ni optimalno za pospešitev delcev. Zaradi tega morajo biti radiofrekvenčne votline krmiljene...

  16. Konceptualno rješenje Vojnoga geoinformacijskog sustava Ministarstva obrane Republike Hrvatske

    OpenAIRE

    Biljecki, Zvonko; Rapaić, Mladen; Tonković, Tomislav

    2006-01-01

    Projektom "Vojni geoinformacijski sustav - VoGIS" Ministarstvo obrane Republike Hrvatske započelo je izgradnju jedinstvenoga geoinformacijskog sustava za potrebe Ministarstva obrane i Oružanih snaga, koji je usklađen s hrvatskim i međunarodnim normama u području geoinformatike, te je u potpunosti konforman standardima NATO-a. Prema Idejnom projektu, cilj VoGIS-a je uspostava geoinformacijskog sustava koji će biti osnova za razvoj svih daljnjih aktivnosti u području vojnih prostornih informaci...

  17. Difuzni infantilni hepatalni hemangioendoteliom: prikaz bolesnika [Diffuse infantile hepatic hemangioendothelioma: a case report

    OpenAIRE

    Sjekavica, Ivica; Petrovečki, Marko; Šunjara, Vice; Pavlović, Maja; Štern Padovan, Ranka

    2013-01-01

    Vaskularni tumori najčešći su benigni tumori jetre, a među njima najčešći je infantilni hepatalni hemangioendoteliom (IHHE), koji dobro reagira na terapiju i ima nisku stopu mortaliteta. U rijetkim slučajevima IHHE mogu biti rezistentni na terapiju te svojom veličinom i volumenom krvnog protoka mogu dovesti do kardiorespiratorne dekompenzacije i smrti. U ovom radu prikazuje se tromjesečno muško dojenče koje je klinički obrađeno zbog učestalih respiracijskih infekcija, bronhoopstrukcija i tumo...

  18. Vizualizacija podatkov o projektnem vodenju

    OpenAIRE

    Šolar, Miha

    2016-01-01

    Poslovna inteligenca, upravljanje poslovnih procesov in nadzorne plošče so orodja, s katerimi si organizacije pomagajo pri usklajevanju, nadzoru in optimizaciji izvajanja nalog. Gre za kontinuiran proces, v katerega morajo biti v organizaciji vključeni vsi  od zaposlenega, ki naloge izvaja in beleži, do nadrejenih na različnih nivojih, ki spremljajo izvedeno, določajo in optimizirajo predpise izvedbe, določajo strategijo organizacije ipd. Interna aplikacija za projektno vodenje trenutno ...

  19. VREDNOTENJE UČINKOVITOSTI IZOBRAŽEVANJA V JP VODOVOD-KANALIZACIJA D.O.O.

    OpenAIRE

    Zabukovec, Marija

    2015-01-01

    Vsi govorimo, da živimo v družbi znanja, visoke tehnologije, nenehnega hitro razvijajočega napredka na praktično vseh področjih in kako se zavedamo pomena človeka ter še posebej znanja. Vendar pa pomen znanja za uspešnost delovanja podjetja in zaposlenih kot posameznikov ne sme biti zgolj črka na papirju, in sicer samo zato, ker je danes »moderno« pisati o tem, ampak je potreben resen pristop k celostnemu obvladovanju našega znanja, ki naj sledi tako trendom v okolju kot tistim, ki jih nakazu...

  20. UVAJANJE SISTEMA KAKOVOSTI POSLOVANJA PO STANDARDU ISO 9001:2000 V PODJETJU ENERGA D.O.O.

    OpenAIRE

    Janič, Tina Jakopina

    2011-01-01

    Za obstoj podjetja na globalnem trgu mora le-to dosegati kakovost na vseh področjih poslovanja. Kakovost pa mora biti usmerjena na trg, saj jo določajo kupci. Za doseganje kakovosti si podjetja pomagajo s standardi kakovosti, med katerimi je tudi ISO 9001:2000. Namen diplomskega dela je predstaviti možnosti uvajanja standarda kakovosti ISO 9001:2000 v podjetje Energa d.o.o.. V nalogi sem predstavila podjetje, njegovo organizacijsko zgradbo ter glavne procese. Stanje podjetja sem primerjala z ...

  1. ANALIZA WELLNESS PONUDBE V IZBRANEM HOTELU NA PTUJU

    OpenAIRE

    Poljanec, Suzana

    2009-01-01

    Wellness je svetovno turistično gibanje sodobnega časa. Pomeni kakovost življenja in vključuje sestavine zdravega načina življenja. V celovito ponudbo wellnessa morajo biti vključene vse štiri temeljne sestavine - zdrava prehrana, osebna sprostitev, telesne aktivnosti in duševne aktivnosti. V diplomski nalogi sem raziskovala sedanje stanje wellness ponudbe v hotelu Mitra na Ptuju. Glavne ugotovitve raziskave so: • wellness postaja iz dneva v dan vse bolj pomemben segment turizma, sa...

  2. RADNA TERAPIJA KOD DJECE S OŠTEĆENJEM VIDA I DODATNIM POTEŠKOĆAMA

    OpenAIRE

    Jurišić, Dubravko

    2008-01-01

    Ovim se posterom želi prikazati nekoliko aspekata rada radnog terapeuta. Sam proces počinje procjenom (GOTA, GMFM 66/88), pripremom za provođenje intervencije ( određivanje ciljeva, načina provođenja radne terapije, vrste pomagala i sredstava koja će biti potrebni u radu), intervencije ( senzorička integracija, trening svakodnevnih i instrumentalnih aktivnosti, rane intervencije, vibro akustička terapija i kreativne aktivnosti) i evaluacija ( daje nam informacije o uspješnosti intervencije i ...

  3. RADNA TERAPIJA U JEDINICI NEONATALNE INTENZIVNE SKRBI

    OpenAIRE

    Jurišić, Dubravko; Popović Miočinović, Ljiljana

    2008-01-01

    Tridesetak posljednjih godina postoje brojna istraživanja o problemu radne terapije u jedinicima intenzivnog liječenja (JIL) djece. Radna terapija u JIL-u novorođenčadi jedan je od prvih koraka u njihovoj habilitaciji. U radu se raspravlja o brojnim aspektima radne terapije u procesu intenzivne skrbi djece najranije dobi. Radni terapeut u JIL-u mora biti educiran i imati znanja o svim područjima vezanim za JIL, tehnička znanja o opremi, procedurama, utjecaju okoline na malog bolesnika i sl. O...

  4. Reciklirana glinena opeka kao agregat za beton: pregled

    OpenAIRE

    Kesegić, Ivana; Netinger, Ivanka; Bjegović, Dubravka

    2008-01-01

    Jedan od sve značajnijih problema današnjice jest nagomilavanje i zbrinjavanje građevinskog otpada, koji neprestanom urbanizacijom i industrijalizacijom poprima sve veće razmjere. Građevinski se otpad može reciklirati i upotrijebiti kao sirovina za novu primjenu. Reciklirana opeka dobivena iz srušenih zidanih konstrukcija može biti primijenjena kao agregat u proizvodnji novih betonskih mješavina. Kako bismo osigurali održivo gospodarenje građevinskim otpadom, nužno je predvidjeti njegova svoj...

  5. JESMO LI „PRERASLI“ TEORIJU X I TEORIJU Y?

    OpenAIRE

    Dropulić, Marinela

    2010-01-01

    Najvrjedniji resursi koje poduzeće može imati su ljudski resursi, zbog toga bi svi aspekti vezani za njih trebali biti na vrhuncu važnosti. U ovom se radu analiziraju aspekti motivacije i stilova vođenja prema McGregorovoj Teoriji X i Teoriji Y. Za analizu samoga nastanka, stvaranja i shvaćanja Teorija X/Y sistematizirana je literatura i spoznaje, a metodom anketiranja (n=40) istražene su preferencije zaposlenika i stila vođenja zastupljenoga u znanstvenoj praksi na primjeru Instituta za polj...

  6. Kategorija brojivosti u hrvatskom jeziku

    OpenAIRE

    Znika, Marija

    2005-01-01

    Kategorija brojivosti promatra se u ovome radu kao na leksičkom značenju imenica utemeljena kategorija. Leksičko značenje imenica može biti dvojako strukturirano: kao jedinično ili kao nejedinično. Temelji se na opreci jedno ≠ mnogo. Kategorija brojivosti ima svoj sadržaj i izraz. Sadržaj kategorije brojivosti čini obilježje [± brojivo] i njegove oznake [+ brojivo] i [- brojivo]. Imenica je brojiva ako je njezin sadržaj pojmljiv kao jediničnost kojoj u opreci stoji mnogost (stol, jabuka). Ime...

  7. GLAZBA UNUTAR DRUŠTVENOG KONTEKSTA SADAŠNJICE. Terenski rad na području Delnica

    OpenAIRE

    Petrović, Željka

    2005-01-01

    Skup određenih elemenata definira kulturu stanovništva nekog mjesta otvarajući pojedincima mogućnost identifikacije samih sebe, a potom i naspram svih drugih. Ti elementi mogu biti kulturni, vjerski, jezični i drugo. Cilj ovog istraživanja je bila potraga za ključnim elementima identifikacije unutar svakodnevnog glazbenog izričaja na području Delnica. Tekst se temelji na terenskom istraživanju u Delnicama tijekom travnja 2004. godine.

  8. BITCOIN – NOVA GLOBALNA VALUTA, INVESTICIJSKA PRILIKA ILI NEŠTO TREĆE?

    OpenAIRE

    Buterin, Denis; Ribarić, Eda; Savić, Suzana

    2015-01-01

    Povijest bitcoina započela je 2008. godine objavom članka „Bitcoin: A Peer to-Peer Electronic Cash System“ pod pseudonimom Satoshi Nakamoto. Od tada do danas bitcoin je doživio značajne promjene obilježene naglim rastom i padom vrijednosti, praćene interesom javnosti. Bitcoin je sustav temeljen na složenim kriptografskim algoritmima, bez postojanja središnjeg autoriteta koji izdaje novac ili nadzire transakcije. Vode se rasprave može li bitcoin postati nova globalna valuta koja neće biti p...

  9. Identifikacija krivotvorenih lijekova za erektilnu disfunkciju iz ilegalnog lanca opskrbe

    OpenAIRE

    Tomić, Siniša; MILČIĆ, NEVEN; Sokolić, Milenko; Ilić Martinac, Adrijana

    2010-01-01

    Pojava krivotvorenih lijekova u lancima opskrbe globalni je javnozdravstveni problem koji može imati ozbiljnih posljedica za pacijenta. Krivotvoreni lijekovi ne zadovoljavaju propisane standarde kakvoće te su u svrhu prijevare drugačije deklarirani u odnosu na njihov stvarni sastav i/ili podrijetlo. Mogu biti generički, ili inovativni, mogu sadržavati ispravne sastojke, ali pogrešno pakiranje, pogrešne sastojke, ne sadržavati djelatnu tvar ili ne sadržavati dovoljnu količinu djelatne tvari. U...

  10. Družbena odgovornost in varnost : diplomsko delo univerzitetnega študija

    OpenAIRE

    Gostinčar, Lucija

    2013-01-01

    Družbena odgovornost pomeni, biti odgovoren za posledice dejanj, ki jih posameznik, organizacija ali katera druga institucija pusti na družbi ali okolju. Neodgovornost, želja po dobičku vodilnih ter kriza vrednot in izobilja so pripeljali do družbeno ekonomskih problemov s katerimi se soočamo danes. Po vsem svetu se pojavljajo protesti zoper nastali položaj, tudi v Sloveniji, razlike med revnimi in bogatimi so vse večje in naravni viri so izčrpani. Vsi ti problemi pa pomembno vplivajo na krim...

  11. Poljoprivreda – dionik kauzalnosti klimatskih promjena

    OpenAIRE

    JUG, Danijel

    2016-01-01

    Uz uvažavanje posebnosti pojedinih znanstvenih disciplina, pristup problematici klimatskih promjena mora biti promotren na interdisciplinarnoj razini i postavljen kao imperativ svih budućih djelovanja. Tek svekolikost ljudske misli i djela, s namjerom točnoga definiranja oblika i razine okolišnoga utjecaja pojedinih gospodarskih djelatnosti, kao i ukazivanje na njih, može rezultirati postavljanjem preciznih ishodišnih točaka s jasno vidljivim ciljem – ublaženje i prilagodba klimatskim promjen...

  12. IMPLEMENTACIJA PORTEROVIH GENERIČKIH STRATEGIJA I POSTIZANJE KONKURENTSKIH PREDNOSTI NA PRIMJERU AUTOMOBILSKE INDUSTRIJE

    OpenAIRE

    Vrdoljak Raguž, Ivona; Tolušić, Marijan

    2012-01-01

    Predmet istraživanja ovog rada postizanje je konkuretske prednosti u automobilskoj industriji implementacijom Porterovih generičkih poslovnih strategija. Postizanje konkurentske prednosti nužno je ukoliko poduzeće želi dugoročno opstati na tržištu. Za odabir konkurentske strategije važan je relativni položaj poduzeća u industriji jer takvo pozicioniranje određuje hoće li profitabilnost poduzeća biti iznad ili ispod prosjeka industrije. Poduzeće u odnosu na konkurente primjenom Porterovih gene...

  13. GENETSKI INŽENJERING I KLONIRANJE U POLJOPRIVREDI ŽIVOTINJA: BIOETIČKA BRIGA I SIGURNOST HRANE

    OpenAIRE

    W. Fox, Michael

    2009-01-01

    Uzgajanje životinja za humane medicinske i ostale komercijalne/industrijske svrhe povećava se putem dvije nove biotehnologije. Jedna je genetski inženjering, što obuhvaća razdvajanje tuđih gena u embrije ciljane životinje radi stvaranja "transgenih" životinja ili brisanje određenih gena radi stvaranja "izuzetnih" genetski modificiranih životinja. Druga je kloniranje, što uključuje uzimanje stanica iz željenog tipa životinje, koje mogu biti transgenske ili "izuzetne", ili iz konvencionalno uzg...

  14. ANALIZA VREDNOT, KULTURE, KLIME IN ETIKE V PODJETJU GRADBENIŠTVO IN PREVOZNIŠTVO JAMNIKER MARJAN, S.P.

    OpenAIRE

    Jamniker, Andreja

    2012-01-01

    Za vsako kakovost, učinkovitost in uspešnost je pomembno, da so cilji podjetja usklajeni z njegovimi organizacijskimi vrednotami in z vrednotami njegovih ljudi. Te pa z vrednotami podjetja. Zato je razjasnjevanje vrednot pomemben korak na poti k izboljšanim dosežkom in uspešnosti. Zaposleni v organizaciji predstavljajo pomemben dejavnik za uspešnost delovanja. Vendar ni dovolj, da samo opravljajo svoje delo, biti morajo tudi učinkoviti. Na to pa vpliva veliko dejavnikov, ki predstavljajo ...

  15. Etika, filozofija rata i pitanje Europe: Max Scheler u kontekstu

    OpenAIRE

    Gretić, Goran

    2007-01-01

    Autor tematizira Schelerovu filozofiju rata osvrćući se na njegovo djelo Genij rata. U kontekstu Njemačke zahvaćene Prvim svjetskim ratom, Scheler je polemizirao s različitim interpretacijama biti i naravi rata, osobito s onima gdje se rat svodi na ekonomske ili sociologijske uzroke, jer je kod jednoga “pravog” rata posrijedi samo duhovna pobuda ka povećanju vlasti. Rat je shvaćen kao dio ljudske naravi, ali ne kao puka borba za opstanak, nego kao borba za moć koja do kra...

  16. SLOVENSKI MANAGERJI IN VODENJE PODJETJA V ČASU GOSPODARSKE KRIZE

    OpenAIRE

    Mikolič, Katja

    2013-01-01

    Naslov magistrske naloge: »Slovenski managerji in vodenje podjetja v času gospodarske krize« V času gospodarske krize ni lahko biti vodja oz. manager podjetja, saj sodobna podjetniška praksa izkazuje zelo slaba stanja. Stanja kot so: upadanje prodaje, manjša kupna moč, krčenje proizvodnje in/ali storitev, slaba plačilna disciplina, odpuščanje delavcev, slabšanje ugleda podjetja, šibkejša vlaganja v investicije, vstopi mnogih novih konkurenčnih podjetij na naš trg itd. Kljub temu pa bi naj...

  17. Prijedlog standarda dentalne zrelosti

    OpenAIRE

    Štefanac, Jadranka

    1987-01-01

    Budući da evaluacija dentalne zrelosti može biti jedan od važnih dijagnostičkih i terapijskih faktora u ortodonciji te dječjoj i preventivnoj stomatologiji, ukazala se potreba da se ustanovi standard i indeks dentalne zrelosti djece osnovno školskog uzrasta zagrebačke populacije. Uzorak je reprezentativan i sastoji se od 320 eugnatih ispitanika koji su svrstani u statističke razrede od 7 do 14 godina po 20 istogodišnjaika istog spola u svakom razredu. Dentalna zrelost određivala se na ortapa...

  18. VLOGA VODITELJSTVA PRI OBVLADOVANJU INOVACIJSKEGA PROCESA

    OpenAIRE

    Trtnik, Maja

    2015-01-01

    Uspeh podjetja je v veliki meri odvisen od njegove inovativnosti in sposobnosti vpeljave novih inovacij na trg. Inovacije so ponavljajoč se proces, ki nastanejo z vztrajnim razmišljanjem in trdim delom vseh, ki so vključeni v proces. Podjetja, ki želijo biti inovativna potrebujejo inovativnega managerja, čigar vloga je, da s svojimi sposobnostmi ustvarja nove ideje, da je komunikativen in, da posledično spodbuja ustvarjalnost in inovacije. Namen diplomskega dela je opredeliti delovanje ino...

  19. SODOBNI STILI VODENJA

    OpenAIRE

    Nerat, Anja

    2012-01-01

    Način vodenja zaposlenih v podjetju je izjemnega pomena, saj bo le z dobro motiviranimi, zadovoljnimi zaposlenimi podjetje uspešno delovalo in bo hkrati inovativno ter dobro stoječe. Torej je najbolj pomemben pristop vodilnih, ki vpliva na to, da se izpolnijo zastavljeni cilji. V samem procesu vodenja je pomembna v prvi vrsti komunikacija, kjer se razvijajo ustvarjalne debate in odločitve, takoj za tem pa je pomembno tudi učenje oziroma posledično znanje. Vodje morajo biti zelo ustvarjalni, d...

  20. TRGOVINA POD KRINKOM SEKS TURIZMA U JUGOISTOČNOJ AZIJI – REAKCIJE EUROPSKE UNIJE

    OpenAIRE

    Gugić, Zrinka

    2014-01-01

    Statistika pokazuje da od ukupnog broja trgovine ljudima u svijetu, otprilike 79% otpada na žene i djecu. Ta činjenica je potaknula Europsku Uniju da se uključi u rješavanje tog problema posebno u zemljama jugoistočne Azije. Seksualno iskorištavanje žena i djece u jugoistočnoj Aziji koje je također usko povezano sa seks turizmom, predstavlja veliki problem u današnjem svijetu. Povezujući definiciju seks turizma i trgovinu ljudima, ovaj rad želi pokazati vezu između seks turizma koji može biti...

  1. MEĐUOVISNOST FUNKCIJA PLANIRANJA I KONTROLINGA I NJIHOVA PRIMJENA U HRVATSKOJ NARODNOJ BANCI

    OpenAIRE

    Jakelić, Diana

    2009-01-01

    Učinkovito poslovno odlučivanje i pravodobno donesena ispravna poslovna odluka rezultiraju uspješnim poslovanjem svakoga poslovnoga subjekta. Kako postaviti osnovu dobrog poslovnog odlučivanja, kako spriječiti propuste i kako svesti mogućnost donošenja pogrešne poslovne odluke na minimum? pitanja su koja se sama od sebe nameću svakome menadžeru. Danas se u modernome društvu posebna pozornost pridaje poslovnom procesu nazvanom kontroling. Ta skupina poslova može biti pozicionirana pri samom...

  2. OSKRBA POVPREČNE SLOVENSKE HIŠE S TOPLOTNO ENERGIJO

    OpenAIRE

    Regvart, Luka

    2009-01-01

    Ker se naše potrebe po energiji nenehno povečujejo, je energetski primanjkljaj iz leta v leto večji. Posledica sta vse dražja energija in tudi naše življenje. Narava nam ponuja različne vire, ki so nam na dosegu rok, samo moramo jih znati uporabiti. Namen diplomske naloge je občutno zmanjšati stroške ogrevanja povprečne stanovanjske hiše z okolju prijaznim virom energije. Stanovanjski objekt mora biti grajen po najnovejših standardih, torej mora ustrezati pravilniku o toplotni prehodnosti ...

  3. Usporedna analiza interaktivnih mrežnih servisa

    OpenAIRE

    Stančić, Hrvoje; Crnec, Dina; Mateljan, Stjepan; Salopek, Anita; Sanković, Dijana

    2007-01-01

    Činjenica da interaktivni mrežni servisi prožimaju sva područja današnjeg života potaknula je autore da analiziraju kolaborativne medije i njihov utjecaj na moderno informacijsko društvo. U radu su prikazani rezultati dobiveni metodom usporedne analize kolaborativnih medija. Interaktivnost je pritom smatrana jednim od najvažnijih kriterija za odabir mrežnih servisa koji će biti uključeni u istraživanje. Autori su analizirali glavne karakteristike odabranih servisa, klasificiral...

  4. RAZVOJ UPORABNIŠKIH VMESNIKOV SPLETNIH APLIKACIJ S POMOČJO JAVA PRIMEFACES

    OpenAIRE

    Stanko, Leon

    2015-01-01

    Če želi biti podjetje, ki izdeluje spletne aplikacije konkurenčno, je nujno, da za implementacijo grafičnega uporabniškega vmesnika (GUI) porabi čim manj časa. Tako se lahko njegovi razvijalci bolj posvetijo implementaciji, testiranju poslovne logike in podatkovnemu sloju svojih aplikacij. Eden izmed načinov, kako čim hitreje razviti grafični uporabniški vmesnik, je, da uporabimo knjižnico Java PrimeFaces, ki omogoča gradnjo uporabniško bogatih in interaktivnih spletnih strani. V delu smo pri...

  5. Kasnoantički stambeni objekt iz Caske (Cissa) na otoku Pagu

    OpenAIRE

    KURILIĆ, Anamarija

    2011-01-01

    U radu se obrađuje jedan manji rustikalno građen stambeni objekt istraživan 2008. godine tijekom arheoloških iskopavanja na kompleksnom antičkom lokalitetu u Uvali Caska (rimska Cissa) kod Novalje na otoku Pagu (Hrvatska). Istraživanja u ovom trenutku još nisu do kraja dovršena, ali je objekt prilično precizno definiran. Riječ je o manjoj četvrtastoj prostoriji od koje su otkrivena tri zida; sudeći prema perimetru koji su zidovi opasivali, prostorija je trebala biti velika najmanje 4 x 4 m. O...

  6. Razvoj i validacija hrvatskog upitnika školske klime za učenike

    OpenAIRE

    Velki, Tena; Antunović, Ana

    2014-01-01

    Školska klima je važan čimbenik djetetova kognitivnog, socijalnog i emocionalnog razvoja. Zbog brojnih kulturalnih specifičnosti i specifičnosti školskog sustava za mjerenje školske klime neopravdano je koristiti instrumente razvijene u inozemstvu bez prilagodbe, te je cilj ovog istraživanja bio adaptirati i validirati upitnik koji će mjeriti školsku klimu iz učeničke perspektive te biti primjeren za korištenje u hrvatskim školama. Kao polazište uzet je American School Climate Survey Versi...

  7. PRIMERJAVA DVEH METOD ZA MERJENJE ZADOVOLJSTVA GOSTOV V HOTELIH

    OpenAIRE

    Osterc, Miša

    2016-01-01

    Zadovoljstvo gostov je ključni element za uspešen razvoj in dolgoročen obstoj kateregakoli hotelskega podjetja, zato mora biti njihovo doseganje tudi glavni cilj vsakega hotela. Pri tem je potrebno upoštevati, da zagotavljanje zadovoljstva gostov zahteva dobro poznavanje želja in pričakovanj vsakega gosta, zato je merjenje, analiziranje in spremljanje zadovoljstva eden najpomembnejših izzivov pri pripravi strategije poslovanja vsakega hotela. To velja tudi za Hotel Bioterme Mala Nedelja,...

  8. Prekrški mladoletnih oseb

    OpenAIRE

    Cmok, Katja

    2015-01-01

    Diplomsko delo obravnava prekrške mladoletnih oseb v Republiki Sloveniji. Mladoletniki so v kazenskem pravu in tudi v pravu o prekrških posebna kategorija storilcev, saj gre praviloma za nedozorele in še ne dovolj razvite osebnosti, na katere lahko zelo hitro vplivajo zunanje okoliščine. Zato so ravnanja, ki presegajo meje dopustnega, pri mladoletnikih pogosta in zelo raznolika. Takšno neprimerno oziroma nedopustno ravnanje mladoletnika pa terja s strani okolice reakcijo, ki mora biti usmerje...

  9. 3ds Studio Max –Animacija čestica s pFlow i Krakatoa

    OpenAIRE

    Ludošan, Željka; Bernik, Andrija; Vusić, Damir

    2013-01-01

    Čestice su ključni element kod vizualnih efekata i animacije. Koriste se za simulaciju prirodnih pojava poput vatre, dima, vode, oblaka, lišća koje pada, ali i za apstraktne efekte poput magičnih pojava, traga svjetlećih točkica, neobičnih geometrijskih figura itd. Sustav čestica predstavlja upravljački kontejner koji sadrži funkcije koje obavljaju čestice i koje se obavljaju nad njima. Ti sustavi mogu doći u paketu s kompletnim 3d programom, mogu biti kao zaseban program ili kao plug-in. Nač...

  10. INŽENJERSKOGEOLOŠKE ZNAČAJKE KLIZIŠTA MLIJA I NJIHOV UTJECAJ NA INŽENJERSKE OBJEKTE (OMIŠ, JUŽNA HRVATSKA)

    OpenAIRE

    Šestanović, Slobodan; Barčot, Duško

    1998-01-01

    Za potrebe projektiranja obilaznice Omiša koja će dijelom biti temeljena na klizištu Mlija te za sigurna temeljenja obiteljskih kuća na toj padini, provedena su detaljna istraživanja, posebice inženjersko-geološko kartiranje, geofizička istraživanja, istraživačko bušenje i laboratorijska ispitivanja materijala koji klizi, U ovom radu prikazani su postignuti rezultati, a zbog brojnih oštećenja na prometnicama, zidovima i stambenim zgradama izvedenim na području Mlija i Borak, raspravljena je m...

  11. Laparoskopska operacija Spigelijeve hernije kroz jednu inciziju – pristup standardnim instrumentarijem

    OpenAIRE

    Car Peterko, Ana; Kirac, Iva; Filipović Čugura, Jakša; Bekavac-Bešlin, Miroslav

    2013-01-01

    Spigelijeva hernija je rijedak tip ventralne hernije. Uzrokovana je defektom u Spigelijevoj fasciji, a klinički se prezentira kao bolna i/ili palpabilna tvorba. Dijagnoza indicira kirurški zahvat zbog visokog rizika inkarceracije. Kirurški pristup može biti otvoren ili laparoskopski, a u oba slučaja kao metoda reparacije koristi se primarno zatvaranje defekta ili hernioplastika mrežicom, ovisno o veličini hernijskog otvora. Ovim radom predstavlja se slučaj 62-godišnje bolesnice s palpabilnom ...

  12. FOTOALERGIJSKE REAKCIJE NA LIJEKOVE

    OpenAIRE

    Bukvić Mokos, Zrinka; Lipozenčić, Jasna

    2011-01-01

    Reakcije na lijekove posredovane svjetlom mogu biti fototoksične i fotoalergijske. U ovom preglednom članku prikazane su fotoalergijske reakcije na lijekove koje nastaju interakcijom lijeka i ultraljubičastog svjetla uz sudjelovanje imunosnih mehanizama. Uz osvrt na fotobiologiju te najčešće lijekove koji sudjeluju u nastanku fotoalergijskih reakcija, prikazana je imunološkapodloga tih dermatoza, klinička slika, te dijagnostički i terapijski postupak. Poznavanje potencijalnih fotoalergena i p...

  13. IZVEDBA MERITEV IN PRESKUŠANJ V VN STIKALIŠČIH

    OpenAIRE

    Kovač, Matej

    2012-01-01

    V diplomski nalogi so podrobneje opisani stikalni aparati, kosovni preskusi in meritve, ki se na teh aparatih izvajajo. S temi preskusi se razkrivajo napake pri stikalnih aparatih in morajo biti narejeni tako, da je stikalna naprava brezhibna. Obravnavana je rekonstrukcija in delovanje 110 kV stikališča na območju HE Dravograd. Izvedeni so izračuni kratkih stikov s pomočjo katerih je dimenzionirana oprema to so ločilniki, odklopniki in zbiralke. Izračuni kratkih stikov so pokazali, da je izb...

  14. Prednosti in slabosti preoblikovanja s.p. v d.o.o.

    OpenAIRE

    Tišma, Zoran

    2016-01-01

    Naloga lastnikov in vodilnih v podjetju je, da oblikuje bodočo predstavo o podjetju. Obstajati mora trajna želja po njegovi učinkovitosti, uspešnosti, poštenosti ter notranji in zunanji interes po trajnem obstoju in razvoju. Poslovanje je treba usmerjati, uravnavati in nadzirati, da lahko dosežemo zastavljene cilje, ki morajo biti skladni z vizijo in poslanstvom podjetja. Za uresničitev vizije, poslanstva in ciljev je treba sprejeti strateške odločitve, ki lahko pomembno vplivajo na poslo...

  15. PRODUKCIJA NIZKOPRORAČUNSKEGA VIDEOSPOTA

    OpenAIRE

    Serušnik, Matej

    2011-01-01

    Različna glasba izzove pri ljudeh različne emocije in vizualne predstave. Mnogi ljudje si ob isti glasbi predstavljajo drugačne slike, drugačne zgodbe. V diplomski nalogi obravnavamo proces produkcije nizkoproračunskega avdiovizualnega izdelka – videospota. Zanima nas, katero opremo uporabiti, da bi kljub nizkim stroškom izdelali kvaliteten in konkurenčen izdelek. Skozi raziskavo spoznamo, na katere dejavnike moramo biti pozorni skozi proces, da je naš projekt čim manj finančno in časovno obr...

  16. VPLIV KULTURE NA MEDNARODNO POSLOVANJE NA PRIMERU JAPONSKE, BRAZILIJE IN RUSIJE

    OpenAIRE

    Radej, Helena

    2011-01-01

    Kultura ima močan vpliv na mednarodno poslovanje, ima vedno večji vpliv na medkulturna pogajanja in velja za spremenljivko, ki ne sme biti zanemarjena. Kultura je celota, ki vključuje znanje, prepričanja, vrednote, moralo, zakone, običaje in je način skupnega življenja vsakega naroda. Poznavanje kulture je ključ, brez katerega podjetniki ne morejo odklepati vrat v mednarodno poslovnem okolju. V diplomski nalogi smo opredelili pojem kulture in predstavili njene značilnosti in sestavine. Op...

  17. Kulturna uvjetovanost poslovne komunikacije

    OpenAIRE

    Špiljak, Višnja

    2007-01-01

    SAŽETAK: Poslovna kultura postaje globalna i sve uniformiranija. Na međunarodnom tržištu, koje kao svoj glavni komunikacijski instrument koristi poslovni engleski jezik, ta je kultura u osnovi biti anglosaksonska. Poslovne ili komunikacijske vještine potrebne akterima na međunarodnom tržištu također slijede globalni, uniformirani obrazac, u osnovi anglosaksonski. Tako će i njihovi pisani i usmeni oblici (pregovori, sastanci, prezentacije, poslovno dopisivanje…) slijediti zadane modele, koj...

  18. Radiološke manifestacije mišićno-koštanih komplikacija u bolesnika zaraženih HIV-om

    OpenAIRE

    Višković, Klaudija; Župetić, Ivana; Mustapić, Matej; Miklić, Dina; Brnić, Zoran; Begovac, Josip

    2012-01-01

    Bolesnici s infekcijom virusom humane imunodeficijencije (HIV) podložni su različitim komplikacijama koje mogu zahvatiti mišićno-koštani sustav. Infekcija (celulitis, nekrotizirajući fascitis, piomiozitis, osteomijelitis, septički artritis) predstavljaju najčešćee komplikacije. Upalna stanja mogu biti uzrokovana samom HIV-infekcijom, ali i potaknuta prilagodbom imunološkog sustava. Mišićni simptomi mogu nastati zbog rabdomiolize, miozitisa ili nuspojava antiretrovirusnog liječenja (ARL). Non-...

  19. Alzheimerova bolest kao gerontološki javnozdravstveni problem

    OpenAIRE

    Puljak, Ana; Perko, Goran; Mihok, Dijana; Radašević, Hrvoje; Tomek-Roksandić, Spomenka

    2005-01-01

    Svaki dvanaesti čovjek, stariji od 65 godina oboli od Alzheimerove bolesti, a 24% starijih od 75 godina ima neki oblik ove bolesti. U razvijenim zemljama svijeta, odnosno svim zemljama “starog stanovništva” (u koje se ubraja i Hrvatska), oko 50% starijih od 85 godina boluje od Alzheimera. Upravo ta dobna skupina najbrže je rastuća populacijska skupina! Sam po sebi nameće se zaključak koliki problem će uskoro biti ova bolest koja se s pravom nosi epitete “tinjajuće bombe” ...

  20. FREKVENČNO NASTAVLJIVA ANTENA Z VISOKIM IZKORISTKOM NA FEROELEKTRIKU

    OpenAIRE

    FURLAN, VLADIMIR

    2016-01-01

    Cilj raziskave je bil oblikovati frekvenčno in polarizacijsko prilagodljivo anteno, ki temelji na diodah z spremenljivo kapacitivnostjo (varaktorji) na podlagi tankega filma feroelektričnega materiala. Antena mora biti frekvenčno in polarizacijsko nastavljiva, poleg tega pa mora pokrivati frekvenčni pas od 7,8 GHz do 8,3 GHz, da je primerna za satelitsko komunikacijo. Frekvenčno in polarizacijsko nastavljiva antena je zasnovana kot sistem, ki vsebuje dve anteni in napajalno mrežo. Napajalna m...

  1. LOGISTIČNI PROCESI V SKLADIŠČNO-DISTRIBUCIJSKEM CENTRU PETROL SKLADIŠČENJE D.O.O.

    OpenAIRE

    Voda, David

    2010-01-01

    V diplomski nalogi je na kratko predstavljena »logistična podpora« delovanju skladiščno distribucijskega centra. To pomeni, da mora biti usklajen pretok informacij in blaga — od nabave blaga pri dobavitelju, preko prevzema, skladiščenja ter izdaje blaga, pa do oskrbe kupcev. V diplomski nalogi se bolj podrobno ukvarjam s »srednjim« delom te logistične poti — prevzem, skladiščenje in izdaja blaga. To so vse funkcije, ki se neposredno odvijajo v samem območju SDC-ja. Ves ta sistem ne s...

  2. Oblikovanje procesa izdelave plinske peči za termično obdelavo kovin

    OpenAIRE

    Kumer, Matjaž

    2014-01-01

    V diplomskem delu bom predstavil proces izdelave plinske peči. Prikazal bom, kako poteka nabava materiala pri tako veliki konstrukciji, kako ta material določimo in ga naročimo. Prikazal bom načine kako material obdelujemo oz. ga predpripravimo. Povzel bom proizvodnjo posameznih delov peči, kako jih sestavljamo in na kaj moramo biti pri tem še posebej pozorni. Za lažjo predstavitev problema bom v nalogi uporabil „Value Stream Mapping“ metodo. Ta metoda se uporablja za analizo in oblikovanje p...

  3. Meje dopustnosti tajnih spletnih preiskav

    OpenAIRE

    Häußler, Stefan

    2013-01-01

    Članek predstavlja nedavno sodbo nemškega Ustavnega sodišča, ki zadeva zakon o tajnih preiskavah računalnikov (t. i. »online« preiskave) s strani državnih oblasti, posebno v povezavi s terorizmom. Sodišče je menilo, da je tajno preiskovanje interneta in osebnih računalnikov v načelu dopustno, a je zakon razglasilo za protiustaven, saj ni prestal testa sorazmernosti. Glede na pomembnost podatkov, ki jih posameznik hrani na osebnem računalniku mora biti dostop do njih omejen na primere, v kater...

  4. KOJA BI SVOJSTVA MORALO ŠUMARSKO OSOBLJE POSJEDOVATI?

    OpenAIRE

    uredništvo

    2015-01-01

    Pod ovim naslovom taksator D. Ilijić u nastavcima u prva tri broja Šumarskoga lista iz 1895. god. daje odgovore na postavljeno pitanje, naglašavajući kako u svakom upravnom organizmu mora biti precizno određena sfera djelovanja pojedinih organa, sukladno njihovoj sposobnosti. Inače organizam prestaje pravilno obavljati svoje funkcije. To je razsulo i propast gospodarstva, kaže on, a posebice je to pogubno za cjelokupno gospodarstvo, jer ono „reprezentira veće glavnice“ i posljedice se tek kas...

  5. Daljinski nadzor i upravljanje industrijskim robotima temeljeni na upotrebi Android uređaja i Wi-Fi komunikacije

    OpenAIRE

    Lutovac Banduka, Maja

    2016-01-01

    Sustavi upravljanja robotima su obično složeni sustavi čiji korisnici moraju biti dobro obučeni da ih koriste. Također, upravljanje procesima se uglavnom provodi u neposrednoj blizini robota ili pomoću žičane veze. Postoji potreba za rješenjem koje može osigurati udobno i intuitivno upravljanje robotima neovisno o mjestu korisnika, koje se lako koristi i istovremeno omogućuje praćenje kretanja robota. Android uređaji su moćni mobilni uređaji sa otvorenom arhitekturom i stalnom internetskom ve...

  6. ZDRAVSTVENO VARSTVO ŠTUDENTOV

    OpenAIRE

    Frešer, Petra

    2016-01-01

    Zdravstveno varstvo je eno izmed najpomembnejših področij socialne varnosti in ima velik pomen za vse skupine ljudi, ne zgolj za študente. K zdravstvenemu varstvu prištevamo tudi zdravstveno zavarovanje. Zdravstveno zavarovanje delimo na obvezno, za financiranje katerega se plačujejo prispevki, in prostovoljno, znotraj katerega je najpomembnejše dopolnilno, za katerega se plačujejo premije. Z obveznim zdravstvenim zavarovanjem, v katerega morajo biti vključene vse skupine ljudi določene z zak...

  7. Profesionalni skepticizam revizora i rizik prijevarnog financijskog izvještavanja

    OpenAIRE

    Pretnar Abičić, Slivija

    2014-01-01

    Prijevarno financijsko izvještavanje odnosi se na namjerna pogrešna prikazivanja, značajne propuste ili objave u financijskim izvještajima sa ciljem obmane korisnika izvještaja. Učestalost prijevarnog izvještavanja je sve veća, te revizor tijekom revizije mora iskazivati skepticizam, odnosno imati ispitivački um, kritički pogled na revizijski dokaz i biti oprezan, a naročito kad razmatra i procjenjuje rizik prijevare, kako bi mogao pružiti razumno uvjerenje da izvještaji ne sadrže značajne po...

  8. Data migration from MySQL database to Percona Server and MariaDB

    OpenAIRE

    Mihelič, Mitja

    2015-01-01

    Diplomsko delo obravnava tematiko o izvedbi migracije podatkov iz podatkovne zbirke MySQL na podatkovno zbirko MariaDB in Percona Server. Pri tem se osredotoča predvsem na posebnosti na katere je potrebno biti pozoren pri migraciji podatkov, na enakosti in razlike med omenjenimi bazami, kaj je treba popraviti v že narejenih aplikacijah, ki uporabljajo MySQL, s katerimi pastmi se bodo razvijalci srečevali pri migraciji in kakšna naj bi bila nemotena ter pravilno izvedena migracija podatkov. Pr...

  9. Organiziranost in vloga varnostne službe v integralnem varnostnem sistemu podjetja : diplomsko delo visokošolskega strokovnega študija Varnost in policijsko delo

    OpenAIRE

    Krenker, Stojan

    2013-01-01

    Podjetje profesionalno organizira varnostno službo v integralnem varnostnem sistemu na podlagi dobro zastavljene varnostne politike. Odločitev vodstva je za katero varnostno službo se bodo odločili, slednja pa mora poskrbeti za fizično in tehnično varovanje. Vsi zaposleni morajo biti strokovno usposobljeni za delo, ki ga opravljajo. Način usposabljanja je na zunanjih institucijah, za določene potrebe pa se izvaja tudi interno strokovno usposabljanje. V svoj delokrog mora zagotoviti neprekinje...

  10. DELO NOVINARJA NA ŠPORTNEM PODROČJU

    OpenAIRE

    Dervarič, Mateja

    2009-01-01

    S pomočjo odgovorov, pridobljenih od izbranih športnih novinarjev, smo podkrepili oziroma ovrgli naša predvidevanja o tem, katere so bistvene značilnosti športnega novinarja ter kakšne so razlike med njim in novinarjem z drugega področja. Novinar se mora v vsakem trenutku zavedati svojih dolžnosti, biti mora pravičen in odkrit do javnosti in do svojih virov informacij. Imeti mora občutek za pripravo kvalitetnega novinarskega proizvoda in hkrati upoštevati tudi pravila novinarskega Kodeksa. Iz...

  11. ZLORABA BOLNIŠKEGA STALEŽA IN IZREDNA ODPOVED POGODBE O ZAPOSLITVI

    OpenAIRE

    Cunder, Ajda

    2012-01-01

    Izkoriščanje bolniškega staleža oz. njegova zloraba je ena najpogostejših kršitev iz delovnopravnega razmerja. Takšno dejanje je kršitev zadnje alineje 111. člena Zakona o delovnih razmerjih, ta pa ima za pravno posledico izredno odpoved pogodbe o zaposlitvi s strani delodajalca. Postopek pred samo odpovedjo pogodbe mora temeljiti na zakonskih podlagah, zato je pomembno, da se postopek pravilno izvede in da se delavcu omogoči zagovor. Izpolnjene morajo biti še marsikatere druge predpostavke, ...

  12. IZUM V DELOVNEM RAZMERJU IN PRAVICA DO NAGRADE

    OpenAIRE

    Slakan, Jana

    2013-01-01

    Nagrada za inovacijo mora biti vzpodbuda za inoviranje. V primerjavi s poslovno skrivnostjo so visoki stroški največja slabost patentiranja izuma, ki jih majhna in srednje velika podjetja težko zmorejo. Zakon o izumih iz delovnega razmerja določa obvezno nagrajevanje za izume ustvarjene v delovnem razmerju ter ureja druge pravice in obveznosti delodajalcev, ki izhajajo iz izumov, ustvarjenih v delovnem razmerju. Podrobnejše kriterije za odmero nagrade določa Pravilnik o nagradah za izume iz d...

  13. ZADOVOLJSTVO ZAPOSLENIH Z IZOBRAŽEVANJEM V PODJETJU X

    OpenAIRE

    Todić, Čedomir

    2014-01-01

    POVZETEK V diplomski nalogi smo se posvetili zadovoljstvu zaposlenih z izobraževanjem v Podjetju X. V današnjem času krize morajo podjetja še bolj upravičevati ceno svojih izdelkov, zato mora biti kakovost izdelkov boljša od konkurence, za dosego tega pa je treba zagotoviti nenehno izpopolnjevanje in izobraževanje zaposlenih. Namen diplomske naloge je ugotoviti, ali podjetje zagotavlja zadostno mero izobraževanja zaposlenim za njihovo delovno mesto, ter njihovo zadovoljstvo z izobraže...

  14. Ugotavljanje lažnega pričanja z opazovanjem besedne in nebesedne komunikacije : diplomsko delo univerzitetnega študija

    OpenAIRE

    Barle, Tanja

    2013-01-01

    Laž je zavestno neresnična izjava, katere namen je nekoga spraviti v zmoto, pri čemer pa niti ni bistveno, ali je ta poskus uspešen ali ne. Laganje lahko ugotavljamo na več načinov, od katerih je metoda z opazovanjem najbolj praktična zato, ker jo lahko izvajamo na mestu samem, takoj, brez uporabe dodatnih analiz in naprav, pa tudi časovno in ekonomsko je najbolj ugodna. Pri opazovanju moramo biti pozorni tako na besedne kot na nebesedne znake oz. predvsem na njihovo medsebojno ujemanje. Med ...

  15. SPREMEMBE ZAZNAVANJA KULTURE VARNOSTI PACIENTOV V SPLOŠNI BOLNIŠNICI JESENICE

    OpenAIRE

    Kramar, Zdenka

    2014-01-01

    Izhodišče: Varnost pacientov mora biti prioriteta vsakega zaposlenega v zdravstvu, ki se srečuje z oskrbo pacientov ne glede na poklicno skupino in nivo delovanja. Namen: Želeli smo primerjati stopnjo zaznavanja kulture varnosti pacientov pri zaposlenih v Splošni bolnišnici Jesenice med letoma 2010 in 2013. Raziskovalna metodologija: Merski instrument je bil anketni vprašalnik Agencije za raziskave in kakovost zdravstvene obravnave. Vključenih je bilo 380 zaposlenih, vrnjenih ...

  16. SODNO REŠEVANJE INDIVIDUALNIH DELOVNIH SPOROV

    OpenAIRE

    Kotnik, Katarina

    2009-01-01

    Za delovno razmerje je značilno, da gre praviloma za trajno razmerje med delavcem in delodajalcem, za odvisno razmerje, ki se kaže v podreditvi delavca delovnemu procesu in navodilom s strani delodajalca. Hkrati gre za prostovoljno razmerje, v katerem je delavec posebej varovan, zaradi podrejenega položaja. Prav tako pa je delavčev socialni položaj in položaj njegove družine odvisen od praviloma najpomembnejšega vira dohodka iz naslova plačila za delo. V primeru delovnega spora mora biti dela...

  17. ORALNI LIHEN PLANUS I ORALNA LIHENOIDNA REAKCIJA – NOVOSTI

    OpenAIRE

    Rotim, Željko; Bolanča, Željana; Andabak Rogulj, Ana; Andabak, Matej; VUČIĆEVIĆ BORAS, Vanja; Vrdoljak, Danko Velimir

    2015-01-01

    Oralni lihen planus (OLP) i oralna lihenoidna reakcija (OLR) su dvije klinički i patohistološki slične bolesti. OLP je posljedica autoimunog procesa koji je posredovan T limfocitima na još uvijek nepoznati antigen, a OLR može biti uzrokovana lijekovima, dentalnim materijalima i dentalnim plakom. Cilj je ovoga preglednog rada bio istražiti Pubmed te su uključena 24 rada koja su publicirana u posljednje tri godine, a s obzirom na etiologiju, dijagnostiku i malignu alteraciju ovih bolesti. Obolj...

  18. ANALIZA ZAPOSLITVENIH RAZGOVOROV V GRADBENEM PODJETJU X

    OpenAIRE

    Frkat, Lidija

    2012-01-01

    Pridobivanje zaposlenih je zahteven in dolgotrajen proces, za katerega porabimo veliko časa. Zaposleni so tisti, ki podjetju dajejo vrednost, kakovost in ugled. Pomembno je, da imamo pravi kader na pravem delovnem mestu, kajti samo tako bo podjetje delovalo rentabilno in bo na trgu konkurenčno. V današnjem času moramo biti pri iskanju novega kadra pozorni na to, da izberemo tistega, ki ima zahtevano izobrazbo in izkušnje, saj bomo le-tako dobili ustrezen kader. V prvem delu diplomske nal...

  19. Dijana Škrbina (2013): ART TERAPIJA I KREATIVNOST

    OpenAIRE

    Dubovicki, Snježana

    2014-01-01

    Knjiga Art terapija i kreativnost nastala je kao svojevrstan odgovor na uočene potrebe teorije i prakse. Knjiga je namijenjenima svima koji se bave problematikom kreativnosti i art terapije na svim razinama odgoja i obrazovanja, dijagnostike i terapije. Knjiga će biti posebno vrijedna dopuna literaturi na nastavničkim fakultetima koji se i u okviru nekih kolegija dotiču ove problematike. Pored namijenjenosti stručnjacima i studentima različitih profila, knjiga je namijenjena i rodite...

  20. Avtomatizirano objavljanje vsebin v spletnih medijih

    OpenAIRE

    VOLEK, AMBROŽ

    2016-01-01

    Spletni mediji in objavljanje vsebin v njih so ključni faktor današnje informacijske dobe. Pri ustvarjanju, objavljanju in urejanju vsebin želimo biti kar se da učinkoviti. Pri tem nam služijo razni sistemi za upravljanje vsebin, ki pa so navadno med sabo neenotni in nepovezljivi, kar zmanjšuje učinkovitost pri hkratnem delu z več različnimi sistemi. Objavljanje iste vsebine v več medijih je zamudno in nepregledno, saj mora avtor vsebino vnesti v različne sisteme in jo v primeru dopolnitev tu...

  1. PERCEPCIJA O HACCP NORMAMA I RAZINA KVALITETE IMPLEMENTACIJE HACCP-A U STRUCI

    OpenAIRE

    Bošnjak, Mirko

    2011-01-01

    U okviru obrazovnog programa VPŠ Utilus provode se obavezne studentske radionice istraživanja pojava i fenomena u struci, koje imaju za cilj istražiti i ukazati na trendove u stručnom okruženju, a koji su u direktnoj ili neposrednoj povezanosti s razinom kvalitete usluge. Prezentiranje rezultata istraživanja studentima podiže kvalitetu obrazovnog programa, a može biti od velike koristi nadležnim institucijama države u svrhu donošenja adekvatnih mjera i odluka. Is...

  2. Izazovi moralnoj prosudbi u medicinskoj etici. Od utilitarizma i deontologije do autonomije pacijenta

    OpenAIRE

    Žitinski, Maja

    2008-01-01

    Naglim razvojem biologije i medicine medicinska profesija stoji pred novim izazovom. Uzeti pitanja ozbiljno u obzir jedino iz kliničkoga motrišta znači ispravno obuhvatiti kliničku situaciju pacijenta. Budući da su medicinske odluke uvjetovane kliničkom situacijom, te su zato heteronomne, a etičke odluke da bi bile ispravne moraju biti autonomne, može se dogoditi da medicinska rutina dođe u sukob s pacijentovim istinskim potrebama. Vrijednosti su aspekti istine, i zbog toga nisu relativne. Pi...

  3. MIKRORAZMNOŽAVANJE DIVLJE TREŠNJE (Prunus avium L.) IZ KLONSKE SJEMENSKE PLANTAŽE

    OpenAIRE

    TANČEVA CRMARIĆ, Olivera; Kajba, Davorin

    2016-01-01

    Velika pozornost pridaje se divljoj trešnji (Prunus avium L.) zbog plemenitog i visokovrijednog drva, ali i zbog važnosti očuvanja njezine genetičke raznolikosti. Oplemenjivanje divlje trešnje uobičajenim metodama uzgoja mogao bi biti vrlo spor proces, otežan time da je u prirodi teško dobiti redovne i dovoljne količine sjemena. Iako osnivanje klonskih sjemenskih plantaža osigurava redovitiji prinos kvalitetnog sjemena, ipak ostaje ovisnost od vremenskih prilika koje utječu na cvjetanje tj. p...

  4. O problemu čuvanja, obnove i prezentacije povijesnog tekstila velikog formata (na primjeru cehovske zastave iz Muzeja grada Koprivnice)

    OpenAIRE

    Bobnjarić – Vučković, Venija

    2012-01-01

    Muzej grada Koprivnice posjeduje zbirku zastava koprivničkih cehovskih i obrtnih udruženja. Zastave su do pohrane u Muzeju 1946. godine bile izložene u župnoj crkvi ovješene pokraj oltara. Zbog toga su bile izložene raznim nepovoljnim mikroklimatskim uvjetima (svjetlu, vlazi, mikročesticama prašine, insektima), a budući da je tekstil vrlo osjetljiva materija, na njima su nastala mnogobrojna oštećenja (mehanička, fotokemijska, kemijska, fizikalna). Pohranom u Muzeju zastave će biti očuvane od ...

  5. Ekonomska upravičenost postavitve vetrne turbine

    OpenAIRE

    Behmer, Marco

    2015-01-01

    Diplomsko delo predstavlja idejni projekt postavitve ene vetrne elektrarne za izbrano mesto Košenjak. Predpostavljam investitorja, ki je v projekt pripravljen vložiti 70 % lastnih sredstev. Predmet dela je smotrnost postavitve vetrne elektrarne. Postavitev mora biti energetsko, ekonomsko in okoljsko upravičljiva. Pri ugotavljanju ekonomske upravičenosti postavitve vetrne turbine je ključna ocena povrnitve začetne investicije. Na podlagi te ocene se odločamo o potencialni uresničitvi ali op...

  6. Dendrološka i hortikulturna vrijednost Arboretuma Lisičine

    OpenAIRE

    Idžojtić, Marilena; Zebec, Marko; Poljak, Igor

    2011-01-01

    Prilikom podizanja arboretuma kriteriji su za izbor biljaka drugačiji nego prilikom hortikulturnoga oblikovanja nekoga prostora. Ipak, ako se osim znanstvene i edukativne funkcije vodi računa i o estetskom izgledu, arboretum će u svako doba godine biti prostor ugodan za boravak, a ne samo skupina eksperimentalnih biljaka. U radu je analizirana dendrološka i hortikulturna vrijednost Arboretuma Lisičine. Analiza je prikazana za svako od dvanaest polja u hortikulturnom dijelu, površine oko 9 ha,...

  7. LIJEČENJE ANEMIJE U KRONIČNOJ BUBREŽNOJ BOLESTI – STAV HRVATSKOG DRUŠTVA ZA NEFROLOGIJU, DIJALIZU I TRANSPLANTACIJU I OSVRT NA PREPORUKE KDIGO I ERBP

    OpenAIRE

    Rački, Sanjin; Bašić-Jukić, Nikolina; Kes, Petar; Ljutić, Dragan; LOVČIĆ, VESNA; Prkačin, Ingrid; RADIĆ, JOSIPA; VUJIČIĆ, BOŽIDAR; Bubić, Ivan; Jakić, Marko; BELAVIĆ, ŽARKO; Šefer, Siniša; Pehar, Mario; Klarić, Dragan; GULIN, MARIJANA

    2014-01-01

    Bubrežna anemija nastaje kao posljedica kronične bolesti bubrega (KBB), a pogoršava se s napredovanjem bolesti. Anemija može biti prvi znak bolesti bubrega. Sve bolesnike s KBB i anemijom potrebno je dijagnostički obraditi čime se može otkloniti druge uzroke bolesti. Dokazana je direktna povezanost koncentracije hemoglobina i stadija zatajenja bubrežne funkcije, a ranija pojava anemije učestalija je u dijabetičara. Rano liječenje anemije moglo bi usporiti napredovanje KBB. Anemija je neovisan...

  8. Mediji kao izvor ideja za oponašanje

    OpenAIRE

    Ružić, Nataša

    2009-01-01

    Svakodnevica nosi obilje stresnih situacija, što je još više karakteristika zemalja u tranziciji, od čak životno ugrožavajućih u proteklom desetljeću do egzistencijskih problema u sadašnjem trenutku. To može prouzročiti socijalno udaljavanje, krizu obiteljskih i prijateljskih odnosa, emocionalnu otuđenost i nemogućnost da se čovjek samostalno nosi s vlastitim problemima“. Prema nekim predviđanjima, depresija će, poslije koronarnih bolesti, biti po učestalosti druga bolest u svi...

  9. MANAGER IN VODENJE PODJETJA

    OpenAIRE

    Pušnik, Amadeja

    2010-01-01

    V delu diplomskega seminarja sem si zastavila, da dokažem kako pomembno je vodenje v današnjem času. V vsakem podjetju se nahajajo vodje, ki se vsak dan soočajo z reševanjem različnih problemov. Ker je vsak problem bistvenega pomena za organizacijo, je pomembno, da je le- ta čim bolje razrešen. Za to skrbijo vodje, ki usmerjajo svoje sodelavce k doseganju želenih ciljev in nalog. Vsaka naloga oziroma aktivnost pa ne more biti izvedena, če v podjetju ni ustrezne komunikacije in motivacije. Kom...

  10. Epiduralni spinalni apsces nakon vađenja zuba- rijetka, ali moguće fatalna komplikacija

    OpenAIRE

    Škrobot, Renato; Macan, Darko

    2004-01-01

    Poznate su komplikacije odontogenog apscesa, a otežano gutanje kod submandibularnog ili pterigomandibularnog apscesa ozbiljan je i pažnje vrijedan znak. Ali većini liječnika nije poznato da ukočen i bolan vrat može biti pokazatelj komplikacije odontogene infekcije. Upravo je to jedan od prvih, a ujedno i glavni simptom kod epiduralnoga spinalnog apscesa. U literaturi se navodi samo nekoliko slučajeva obrađenih pacijenata s takvim apscesom. Specifičnost epiduralnog spinalnog apscesa jest št...

  11. Čustva in vodenje v zdravstveni negi

    OpenAIRE

    Nikolić, Klavdija

    2011-01-01

    Razmerja med ljudmi so osnova, na katerih temelji sodobno vodenje. Vsakodnevni medsebojni odnosi so prežeti s čustvi, taki so tudi odnosi v negovalnem timu. Čustva so stalno prisotna tako v našem delu kot tudi v našem življenju. Namen diplomskega dela je opredeliti pojem čustev v povezavi z vodenjem v zdravstveni negi in negovalnem timu, saj so le ta pojem človeške biti. Želimo prikazati kompleksnost, specifičnost in pomen čustev ter čustvene inteligence vodje, doprinos čustev k dobremu voden...

  12. Nevronski sistem za avtomatsko odstranjevanje ozadja pri Augerjevih spektrih:

    OpenAIRE

    Belič, Igor; Jenko, Monika; Poniku, Besnik

    2012-01-01

    Spektralno ozadje in šum sta neločljiva sestavna dela Augerjevih spektrov, ki zaradi svoje spremenljivosti onemogočata avtomatsko analizo in obdelavo spektrov. Ključni element zanesljive avtomatske analize spektrov je odstranjevanje spektralnega ozadja in šuma. To je postopek, ki mora pri svojem delovanju ohraniti večino informacij spektra, pri tem pa ne sme popačiti in spremeniti vsebine spektra, biti mora predmet temeljite študije, saj je izhodišče nadaljnje analize spektrov. Tudi samo spek...

  13. Ozaveščenost staršev o razvoju otrok z govorno-jezikovnimi težavami

    OpenAIRE

    Tement, Evelina

    2015-01-01

    Komunikacija nam omogoča sporazumevanje z ožjim in širšim okoljem. Da se lahko uspešno sporazumevamo, morata biti govor in jezik ustrezno razvita. V primeru odstopanj v govorno-jezikovnem razvoju se starši obrnejo na govorno-jezikovnega strokovnjaka – logopeda. Preden pa starši poiščejo pomoč, morajo otrokovo odstopanje oceniti kot pomembno za intervencijo govorno-jezikovnega strokovnjaka. Raziskava je nastala z namenom, da ugotovimo, kdaj in za katero težavo se starši odločajo za obisk ...

  14. Detektor podzemnih instalacija Spar300 u integriranom radu s GNSS prijamnikom Trimble GeoXR

    OpenAIRE

    Panić, Dario; Rajić, Igor; Herent, Marija

    2014-01-01

    Vodovi predstavljaju objekte koji služe za transport određene vrste energije. Vodovi mogu biti postavljeni iznad i ispod zemlje tvoreći tako različite mreže instalacija koje se sastoje od samih vodova i njima pripadajućih objekata. Prilikom geodetske izmjere različitih objekata, kao sastavni dio podrazumijeva se i snimanje podzemnih instalacija, odnosno komunalnih vodova. Nepoznati položaj podzemnih instalacija pronalazi se uređajima za detekciju podzemnih instalacija koji rade na princip...

  15. Piramida profesionalne i poslovne odgovornosti u hrvatskoj stomatologiji

    OpenAIRE

    Cerjan-Letica, Gordana

    2010-01-01

    Hrvatski stomatolozi, posebice vlasnici/nositelji privatne prakse, zakupci prostora i opreme za obavljanje privatne prakse, pa i zaposleni u privatnoj praksi - kao i njihovi kolege u europskim i ostalim razvijenim zemljama - svaki se dan suočavaju s nizom etičkih i moralnih dvojbi koje se redovito pretvaraju u višestruki sukob interesa: a) trebaju striktno slijediti i poštovati sve zakonske, etičke i druge profesionalne norme (kao i one običajima nametnute); b) moraju biti poslovno uspješ...

  16. SINDROMI PRENAPREZANJA U PODRUČJU KUKA

    OpenAIRE

    Ivković, Alan; Smoljanović, Tomislav; Bojanić, Ivan; Pećina, Marko

    2005-01-01

    Bolni sindromi u području kuka se općenito smatraju najučestalijim sindromima prenaprezanja u nekim sportskim aktivnostima, npr. u nogometu. Razmatrajući lokaciju i anatomske strukture zahvaćene prenaprezanjima u području kuka, lokacija i karakteristika boli može biti točno lokalizirana, a isto tako može se raditi o neodređenoj difuznoj boli u području preponske regije, male zdjelice i natkoljenice. Naziv sindrom se s pravom upotrebljava, jer zaista postoje mnogobrojni simptomi kao što mogu b...

  17. TORKVESI - JEDNOSTAVNA ELEGANCIJA PRAPOVIJESNOG UMJETNIČKOG OBRTA

    OpenAIRE

    Buršić-Matijašić, Klara

    2010-01-01

    Torkvesi ili kolutaste ogrlice čine omiljeni nakit za vrat koji se javlja tijekom brončanog doba. Obično su od jednog komada metala bronce, željeza, srebra ili zlata. Mogu biti glatki, tordirani, cjevasti, čvorasti kao i bogato ukrašeni. Većina ima otvorene krajeve koji završavaju različitim inačicama. Tijekom mlađe faze željeznog doba Europe postaju oznaka keltskih ratnika, plemenskih vođa i heroja. Za Kelte je torkves bio mnogo više od običnog nakita - predstavljao je predmet id...

  18. Supsidijarnost u hrvatskom medijskom prostoru. Problemi i mogućnosti djelovanja

    OpenAIRE

    VALKOVIĆ, Jerko

    2009-01-01

    Medijski prostor hrvatskoga društva složeno je područje koje tvore ne samo brojni mediji i razne institucije već i medijski konzumenti, oni kojima je medijska poruka upućena. Ali oni nisu samo pasivni primatelji medijskog sadržaja. Naime, polazeći od osobe kao cilja i ishodišta supsidijarnog djelovanja, autor u prvom dijelu govori o osobi koja je subjekt medijskog prostora ističući neka njezina prava: pravo na informaciju i sudjelovanje u javnom mnijenju. Mediji trebaju biti u službi afirmira...

  19. KONCEPT NOVE EKONOMIJE I ZNAČAJ INFORMACIJSKO-KOMUNIKACIJSKE TEHNOLOGIJE U REPUBLICI HRVATSKOJ

    OpenAIRE

    Škuflić, Lorena; Vlahinić-Dizdarević, Nela

    2003-01-01

    Od devedesetih godina pa dalje sve se manje u ekonomiji problem razvitka promatra preko postavki Solowljevog modela razvitka, nego su osnovni izvori ekonomskog rasta usmjereni na tehnološke promjene, na poboljšanje inovacija i na obrazovanje radne snage koja će biti sposobna upravljati novom tehnologijom. Te postavke prema istraživanjima omogućuju ostvarivanje snažnog gospodarskog rasta bez inflacije i uz nisku nezaposlenost, i omogućuju rast proizvodnosti. Nova ekonomija znači duboke i ko...

  20. POSLOVNA UPORABNOST SPLETNIH ISKALNIKOV

    OpenAIRE

    Horvat, Nika

    2012-01-01

    Svetovni splet se iz dneva v dan povečuje in pridobiva uporabnike. Podjetja pa se na trgu borijo, katera bodo bolj uspešna oziroma bodo imela več strank, saj to pomeni večjo prodajo. Način pridobivanja strank, se zaradi razvoja ekonomije in tehnologije spreminjajo. Podjetja morajo biti sposobno slediti tem trendom, zavedati se morejo njihovih potencialov. Podjetje mora posodabljati svoje procese, svoj marketing in prodajo in ker večina ljudi v današnjem svetu nima več toliko časa, da bi infor...

  1. SPLETNE TRGOVINE S POUDARKOM NA SPLETNIH DRAŽBAH

    OpenAIRE

    Fras, Janja

    2011-01-01

    V današnjem času napredne tehnologije se je nakupovanje preko spleta močno razširilo in vedno več je uporabnikov, ki jim to predstavlja vsakdanji način nakupovanja. Spletno nakupovanje je hitro, enostavno, ter dostopno kar iz domačega fotelja. Izdelava spletnih strani in internet sta postala nuja za podjetje. Za uspešnost spletnih strani je potreben aktivni spletni pristop. Optimizacija spletnih vsebin je danes najbolj pomembna naloga spletnih razvijevalcev. Priti na prvo mesto, biti na p...

  2. PLAVA RIBA – PREDNOSTI ALI I NEKI RIZICI KONZUMIRANJA

    OpenAIRE

    Nosić, Mario; Krešić, Greta

    2015-01-01

    Plava riba je nutritivno izrazito vrijedna, lako probavljiva namirnica koja je izvor biološki vrijednih bjelančevina, joda i selena dok istovremeno sadrži malo masti i ima niski sadržaj kolesterola. Vrijedan je izvor višestruko nezasićenih masnih kiselina kojima se pripisuju brojni pozitivni učinci na zdravlje. Međutim uz konzumaciju plavu ribu mogu biti vezani i određeni rizici, primjerice, histaminsko trovanje. Histaminsko trovanje morskom ribom uzrokuje 5% svih oboljenja vezanih za hranu k...

  3. OCENA KAKOVOSTI VODIJ TIMA NA INTENZIVNEM ODDELKU

    OpenAIRE

    Podsedenšek, Darja

    2016-01-01

    Teoretična izhodišča: Za najboljši možni izid zdravljenja življenjsko ogroženih pacientov je potreben tim, v katerem so vsi zaposleni visoko strokovno usposobljeni, vodje pa odlikujejo sposobnosti načrtovanja, organiziranja in nadzorovanja dela, pa tudi motiviranja, komuniciranja in konstruktivnega reševanja problemov. Hkrati morajo biti tudi zanesljivi, primerno čustveno inteligentni in imeti razvito empatijo, saj naj bi bili vzor ostalim zaposlenim. Namen magistrskega dela je bil ugotoviti...

  4. RELEVANTNE ZNAKOVITOSTI EUROPSKOGA PROMETNOGA TRŽIŠTA

    OpenAIRE

    Pupavac, Drago

    2005-01-01

    Glavni je cilj ove rasprave istražiti relevantne znakovitosti europskoga prometnoga tržišta. Dobijene spoznaje u ovoj raspravi, zasnovane na metodi analize i sinteze, na sustavnoj metodi, na metodama matematičkoga modeliranja i matematičkoga programiranja, kvalitetna su polazišta za postizanje ravnoteže na značajnijim segmentima europskoga prometnoga tržišta. Posebno se ističe da prometna ponuda na regionalnom prometnome tržištu mora biti sposobna zadovoljiti potrebe za regionalnim prometom, ...

  5. Problem nalaganja in pritrjevanja splošnega tovora v cestnem prometu

    OpenAIRE

    Lajnšček, Andrej

    2015-01-01

    Predmet izdelave diplomskega dela je izpostaviti problem, ki se pojavlja pri nalaganju in pritrjevanju tovora v javnem cestnem prometu. Osnova poznavanja pravilnosti naloženega tovora so seveda predpisi, ki morajo biti upoštevani s strani vseh prevoznikov in udeležencev v prevozu tovora v cestnem prometu. Diplomsko delo smo razdelili na dva dela, in sicer na teoretičnega in empiričnega. V teoretičnem delu smo v uvodu najprej predstavili nekaj osnovnih pojmov, ki se pojavljajo pri transpor...

  6. Razvoj mobilne aplikacije Interaktivni kviz za okolje Android

    OpenAIRE

    Štefanič, Klemen

    2015-01-01

    Cilj našega diplomskega dela je dodobra spoznati metodologijo izdelave in razvoja aplikacije za okolje Android. Pri tem smo upoštevali, da mora naš, sicer študijski primer aplikacije, vsebovati intuitiven in konsistenten uporabniški vmesnik, a biti dovolj robusten in zanesljiv za izvajanje spletnih storitev in prikaz informacij. Rezultat našega praktičnega dela je delujoč interaktivni spletni kviz. Tekom razvoja smo uporabljali programsko okolje Android Studio, ki podpira razvoj aplikacij s p...

  7. USTVARJALNOST IN INOVATIVNOST KOT POGOJ ZA PREMAGOVANJE GOSPODARSKE KRIZE

    OpenAIRE

    Esih, Marko

    2010-01-01

    Ustvarjati in biti ustvarjalen. Samo to je pot, ki bi jo morala podjetja imeti. Brez ustvarjanja tudi ni idej, ki pripeljejo do inovacij. Inovacije pa so nujne za preživetje podjetja. Pri tem je pomembna ustvarjalna svoboda. Tako se včasih pojavi težava, da družba ni spodbujevalno naravnana in tako za ustvarjalca ni pozitivna in ga zavira pri ustvarjalnosti ter iskanju idej. Poznane so štiri značilne faze pri nastajanju ideje. To so: priprava, inkubacija, razsvetlitev in preverjanje. Pri...

  8. Zbrinjavanje medicinskog otpada - zakonodavstvo i njegova provedba

    OpenAIRE

    Marinković, Natalija; Vitale, Ksenija; Janev Holcer, Nataša; Džakula, Aleksandar

    2006-01-01

    Gospodarenje medicinskim otpadom, koji po svojim svojstvima može biti opasan i/ili inertan, u Hrvatskoj je regulirano trima temeljnim pravnim aktima: Zakonom o otpadu, Pravilnikom o vrstama otpada te Naputkom o postupanju s otpadom koji nastaje pri pružanju zdravstvene zaštite. Uz njih još su i Zakon o prijevozu opasnih tvari i Zakon o otrovima akti koji podupiru provedbu ovih propisa. Slijedom razvoja suvremenih cjelovitih sustava za gospodarenje otpadom razvijen je i cjeloviti sustav za gos...

  9. GEN–TEHNOLOGIJA: ETIČKE I SOCIJALNE IMPLIKACIJE

    OpenAIRE

    Orešković, Stjepan

    1995-01-01

    Po čemu je za sociologiju i socijalnu ekologiju zanimljiv projekt stvaranja genskih mapa? Gen–tehnologija zadire najdublje u resurse ljudskog identiteta, identiteta jedinke, porodice, nacije i vrste. Ona iz temelja mijenja unutarnju prirodnu čovjekovu okolinu. Nasuprot uvjerenju da je potrebno pomiriti se s činjenicom da je život u koegzistenciji s manjinom hendikepiranih, starih i nemoćnih i slabašnom djecom normalna prirodna okolnost, postoje uvjerenja da će biti moguće eliminirati gene nos...

  10. Politička instrumentalizacija filozofije u Heideggerovu tumačenju Hegela. Obrana Hegela

    OpenAIRE

    Gretić, Goran

    2011-01-01

    Autor raspravlja o Heideggerovim seminarima “O biti i pojmu prirode, povijesti i države” iz 1933/1934. te “Hegel o državi” iz 1934/1935. Ti tek nedavno objavljeni seminari bacaju posebnu svjetlost na odnos Heideggerova mišljenja i nacionalsocijalizma. U radu se prvenstveno istražuje Heideggerova interpretacija Hegelova određenja pojma, uloge i zadaće države. Autor pokazuje da Heideggerova interpretacija predstavlja pokušaj da se arbitrarnim tumačenjem Hegela opravda vlastito...

  11. ASTEROIDI

    OpenAIRE

    Andreić, Željko

    2016-01-01

    Asteroidi su najveća mala tijela Sunčeva sustava. Danas se intenzivno proučavaju iz nekoliko razloga. Kao prvo, neki asteroidi (tzv. NEA podvrsta) mogu se sudariti sa Zemljom, a posljedice takva sudara bile bi katastrofalne. Drugo, na njih se gleda kao na potencijalni izvor materijala koji na Zemlji postaju rijetki, a koji će ionako biti potrebni za svemirske konstrukcije budućnosti. I treće, oni čuvaju tajne postanka Sunčeva sustava i njegove evolucije do danas. Na kraju, kako je nekoliko hr...

  12. Analiziranje mjerodavnog tipa kvara za proračun iznosa minimalne struje kvara na primarnoj strani distribucijskog transformatora

    OpenAIRE

    Boras, Vedran; Barić, Tomislav; Muharemović, Alija

    2010-01-01

    U ovom radu je analiziran utjecaj spoja namota trofaznog transformatora i više tipova izravnih kratkih spojeva, koji se pojavljuju na sekundarnoj strani nekog distribucijskog transformatora kao i simultanih kvarova u određivanju mjerodavnog tipa kvara za proračun minimalnog iznosa struje kvara na primarnoj strani transformatora, koji će biti mjerodavan u odabiru minimalne prekidne struje topljivih umetaka visokonaponskih osigurača za zaštitu transformatora. Ovom analizom obuhvaćene su dvije g...

  13. VELIKI JETRENI HEMANGIOM KOMPLICIRAN TEŠKIM POLIHIDRAMNIONOM I KASABACH-MERRITTOVIM SINDROMOM

    OpenAIRE

    Alhassan, Mai M; Bassioni, Ibrahim; TIKVICA, ANA; Baderldeen, Ahmed

    2008-01-01

    Novorođenački jetreni hemangiom je dobroćudni tumor jetre koji može biti združen s perinatalnim komplikacijama opasnim po život, kao što su zatajenje srca ili fetalni hidrops. Opisujemo slučaj velikog jetrenog hemangioma na koji se prenatalno postavila sumnja prilikom dvodimenzionalnog ultrazvučnog pregleda u 35 tjednu trudnoće kod 24-godišnje drugorotkinje. Hemangiom je bio kompliciran ekstenzivnim polihidramnijem i Kasabach-Merrittovim sindromom. Dijete je operirano drugog dana života i dij...

  14. NOTRANJI MARKETING IN NOTRANJA TRŽNA NARAVNANOST ORGANIZACIJE

    OpenAIRE

    Gašparič, Tamara

    2011-01-01

    Marketinški koncept že vse od petdesetih let naprej velja za temelj marketinške discipline. Z njim je najtesneje povezan preobrat v naravnanosti organizacij k trgu in odjemalcu. Izhaja iz spoznanja, da je doseganje ciljev organizacije odvisno od opredelitve potreb in želja ciljnih trgov ter učinkovitejšega in uspešnejšega zadovoljevanja le-teh, kot to počno konkurenti. Vendar preživetje podjetij na trgu še daleč ni dovolj, podjetja želijo biti uspešna in vodilna na svojih področjih. Notr...

  15. Živeti vojaške vrednote

    OpenAIRE

    Krejač, Jure

    2012-01-01

    Obstaja cela vrsta definicij, ki pojem vrednot utemeljujejo. V splošnem lahko rečemo, da je vrednota za človeka vse, kar je zanj vredno, dragoceno in sveto. Kljub temu da se temeljne kategorije vrednot pojavljajo pri vseh ljudeh in v vseh kulturnih okoljih, se vrednote in vrednotni sistemi skozi zgodovino lahko spreminjajo. Vsaka vojaška organizacija razvija nek lasten vrednotni sistem, ki praviloma ni in ne sme biti v nasprotju z vrednotnim sistemom, ki je uveljavljen v civilnem okolju. Voja...

  16. Pravi self - preduvjet stvaralaštva

    OpenAIRE

    Gruden, Zdenka

    2003-01-01

    Prema M. Klein, self je cjelokupno ljudsko biće, pod čime se podrazumijeva tjelesni i duševni ustroj. Duševni je ustroj sastavljen od svjesnog, predsvjesnog i nesvjesnog. Self se sastoji od ida, ega i super ega. Self reprezentacija je projekcija selfa. Self se projicira u egu, dakle u jednom svom dijelu. Ta reprezentacija selfa može biti lažna ili prava. Kada self reprezentacija odražava objektivna svojstva selfa, njega se, prema Winnicottu, može zvati pravim selfom. Težnja za istinom urođena...

  17. Mollusca contagiosa

    OpenAIRE

    Husar, Karmela; Skerlev, Mihael; Husar, Darko

    2009-01-01

    Mollusca contagiosa (MC) definiramo kao čestu virusnu infekciju kože uzrokovanu Molluscipox virusom (MCV) koja se viđa u djece i odraslih. Klinički se manifestira u obliku malih, umbiliciranih papula voštana sjaja. Dok su MC relativno česta u djece od 1. do 5. godine i mogu biti smještene bilo gdje na tijelu, njihova pojavnost u odraslih uglavnom se smatra spolno prenosivom infekcijom (engl. sexually transmitted infection, STI). MCV se može prenositi direktno s osobe na osobu ili autoinokulac...

  18. Prednosti i nedostaci primjene ultrazvuka visoke snage u mljekarskoj industriji

    OpenAIRE

    Režek Jambrak, Anet; Lelas, Vesna; Herceg, Zoran; Badanjak, Marija; Batur, Verica; Muža, Mislav

    2009-01-01

    Konzerviranje hrane termičkom sterilizacijom još uvijek je najčešći oblik konzerviranja. Međutim, osim poželjnog učinka na mikroorganizme, povišena temperatura istovremeno izaziva značajne promjene na nutritivnim i organoleptičkim značajkama hrane. Gubitak kvalitete proizvoda može biti povezan s deformacijom strukture i teksture, modifikacijom makromolekula i stvaranjem novih tvari iz reakcija kataliziranih toplinom. Ultrazvuk je pritom jedna od novih metoda koja može uvelike pomoći različiti...

  19. Komuniciranje s finančnimi javnostmi

    OpenAIRE

    Vesel, Marjeta T.

    2014-01-01

    Članek obravnava področje komuniciranja s finančnimi javnostmi kot posebno področje odnosov z javnostmi, ki po privatizaciji in uvedbi tržnega gospodarstva postaja aktualno tudi za slovenske managerje in komunikatorje. Finančne javnosti zajemajo: lastnike podjetij (delničarje) ter vse, ki vplivajo na njihova stališča in investicijske odločitve, t.j. borzne posrednike, analitike, medije in regulatorje. Namen komuniciranja s finančnimijavnostmi mora biti usklajen z osrednjim ciljem managementa ...

  20. ZAŠČITA SONČNIH ELEKTRARN PRED POSLEDICAMI UDARA STRELE

    OpenAIRE

    Mešiček, Aljaž

    2011-01-01

    Sončni generator predstavlja glavni del investicije v sončno elektrarno. Zaradi velike cene in tudi izpostavljenosti sončnega generatorja (strehe …) ga moramo dobro zaščititi pred neposrednimi udari strele. Pri dimenzioniranju strelovodnega sistema moramo biti pozorni tudi na vpliv zaščitnega sistema na sončni generator (senčenje …). Diplomsko delo opisuje zaščito sončnega generatorja pred udarom strele, probleme pri določanju in dimenzioniranju strelovodnega sistema. Opira se na veljavne ...

  1. DIFERENCIJALNA DIJAGNOZA KRONIČNIH RANA

    OpenAIRE

    Šitum, Mirna; KOLIĆ, MAJA

    2014-01-01

    Rana je prekid anatomskog i funkcionalnog kontinuiteta tkiva, a s obzirom na tijek cijeljenja rane dijelimo na akutne i kronične. kronična rana je rana koja unatoč standardnom medicinskom postupku ne cijeli očekivanom dinamikom, odnosno u užem smislu rana koja ne cijeli unutar 6 tjedana. kronične rane mogu biti tipične i atipične. u tipične rane ubrajaju se ishemijske, neurotrofičke i hipostatske rane te dva posebna entiteta: dekubitus i dijabetičko stopalo. kronične rane na potkoljenicama su...

  2. KVALITETA ŽIVOTA I PSIHOLOŠKI ASPEKTI U BOLESNIKA S KOŽNIM VRIJEDOM

    OpenAIRE

    Šitum, Mirna; KOLIĆ, MAJA; ŠPOLJAR, SANJA

    2016-01-01

    Prema definiciji kožni vrijed (rana) je prekid anatomskog i funkcionalnog kontinuiteta tkiva. S obzirom na tijek cijeljenja, rane mogu biti akutne i kronične. Kada govorimo o utjecaju rane na kvalitetu života i psihološki status osobe, u prvom redu mislimo na utjecaj kronične rane (vrijeda). Kronične rane su one koje ne zarastaju unutar predviđenog razdoblja u korelaciji s etiologijom i lokalizacijom rane (najkraće razdoblje - 6 tjedana). Kronične rane su rastući socioekonomski problem u razv...

  3. Distribucijske greške u procesu procjene performansi zaposlenih/Distribution errors in the employee performance evaluation process

    OpenAIRE

    Vesko M. Lukovac; Snežana A. Pejčić-Tarle; Milena J. Popović; Dragan S. Pamučar

    2014-01-01

    Racionalno angažovanje, usmjeravanje i razvoj, motivisanje i nagrađivanje, unapređenje organizacijske efikasnosti i poslovanja teško se može ostvariti ukoliko se ne vrši ocjenjivanje kvaliteta rada zaposlenih. U literaturi o manadžmentu ova tehnika je poznata pod nazivom 'procjena performansi zaposlenih'. Performansa ili učinak može biti bilo neki mjerljiv rezultat koji je ostvaren, bilo ponašanje ili lične karakteristike neophodne za obavljanje određene aktivnosti u definisanom periodu. U po...

  4. RAZVOJ IN EVALVACIJA USPOSABLJANJA BOMBNIH OPERATERJEV Z E-UČENJEM

    OpenAIRE

    Gladek, Matevž

    2012-01-01

    V magistrskem delu bomo predstavili teoretična izhodišča za izgradnjo elektronskega učbenika. Namen je predstaviti potek izgradnje elektronskega učbenika za program izobraževanja bombni operater. Predstavljen bo celoten postopek od zasnove preko končne izvedbe in nazadnje do evalvacije. Pogledali si bomo programsko orodje CourseLab, s katerim bomo učbenik izdelali. Predstavili bomo, kaj je smiselno upoštevati pri njegovi izdelavi in na kaj moramo biti pozorni. Pri evalvaciji učbenika bomo naj...

  5. Migracija neurona i poremećaji kortikalne migracije

    OpenAIRE

    Kostović, I.; Jovanov-Milošević, N.; Petanjek, Z.

    2007-01-01

    U ovom radu pružili smo pregled spoznaja o neurobiološkoj osnovi poremećaja migracije koja je važna za njihovu klasifikaciju. Kortikalni neuroni rađaju se u ventrikularnoj i subventrikularnoj zoni te prolaze dugačak put do svojeg konačnog odredišta, rabeći dva osnovna mehanizma i puta migracije: (1) radijalnu migraciju, put uzduž radijalne glije i (2) tangencijalnu, najvjerojatnije “neurofilnu” migraciju. Tijek migracije je složen i može biti poremećen utjecajem različitih genetskih i vanjski...

  6. LONGITUDINALNO ISTRAŽIVANJE VARIJABILITETA KINEMATIČKIH PARAMETARA SKOKA U VIS JEDNE HRVATSKE ATLETIČARKE

    OpenAIRE

    Blažević, Iva; Antekolović, Ljubomir; Mejovšek, Mladen

    2006-01-01

    Uvod Primjena kinematičkih mjernih sustava u atleti-ci nezaobilazna je metoda dijagnostike treniranosti sportaša koja omogućuje dobivanje relevantnih informacija o stanju sportaša i tehnici izvođenja sportskih gibanja. Izračunavanjem linearnih i kutnih pomaka te brzina i ubrzanja moguće je dobiti detaljan uvid u tehniku gibanja, što može biti značajna komponenta praćenja, programiranja i kontrole procesa treninga u različitim atletskim disciplinama. Skok u vis može se strukturalno pod...

  7. Jednostavna metoda procjene maksimalnog kapaciteta proizvodnje kapljevine korištenjem sustavaklipnog (plunžernog) plinskog lifta u bušotinama

    OpenAIRE

    Bahadori, Alireza; Zahedi, Gholamreza; Zendehboudi, Sohrab; Jamili, Ahmad

    2012-01-01

    Klipni (plunžerni) plinski lift je ciklička metoda umjetnog podizanja nafte koja koristi plunžer (klip) za uspostavljanje razdjelne površine između kapljevine akumulirane u koloni uzlaznih cijevi i ležišta ili tlaka plina u prstenastom prostoru koji će biti upotrijebljen za podizanje kapljevine u bušotinama. U ovom je radu, maksimalni mogući kapacitet proizvodnje koji će podnijeti plunžerni plinski lift za danu dubinu i dimenzije uzlazne cijevi, postavljen na kvantitativnoj osnovi pomoću j...

  8. Povezanost upravljanja odnosima s klijentima i tržišne vrijednosti marke

    OpenAIRE

    Mandić, Miroslav

    2007-01-01

    Upravljanje odnosima s klijentima predstavlja jednu od temeljnih odrednica marketinške filozofije poslovanja. Ono na prvo mjesto stavlja klijenta (kupca) i njegovo zadovoljstvo tako da sve procese unutar poduzeća usmjerava prema klijentu. Temelj upravljanja odnosima s klijentima predstavlja poznavanje klijenata kako bi im poduzeće "isporučivalo" veću vrijednost. Povezanost s klijentima pretpostavlja ispunjavanje potreba klijenata onako kako klijenti to žele, što može biti ključni izvor konkur...

  9. Pomen elektronskih prevajalskih orodij na primeru slovensko-nemškega glosarja s področja računalništva

    OpenAIRE

    Nemec, Andrej

    2012-01-01

    Prevajanje je zelo kompleksen proces, v katerem mora prevajalec poznati številna področja in biti pripravljen se vedno na novo učiti. Pri svojem delu skorajda ne more več brez uporabe informacijsko-komunikacijske tehnologije, ki je v njegovo stroko vnesla številne možnosti za hitrejše in učinkovitejše, a obenem nič manj kakovostno delo. Obenem ga je naglica razvoja postavila pred nova dejstva in izzive, da med vsemi možnostmi, ki jih ima na voljo, izbere tiste najbolj primerne. Za prevajalca ...

  10. Kompetencije učitelja biologije za primjenu informacijsko-komunikacijskih tehnologija u nastavnom procesu

    OpenAIRE

    Kostović-Vranješ, Vesna; Bulić, Mila; Novoselić, Daniela

    2016-01-01

    Profesionalni razvoj učitelja treba biti u samom središtu obrazovne politike svake države jer je njihova kompetentnost jedan od glavnih činitelja koji djeluju na razinu obrazovnih postignuća učenika. Stoga je izuzetno važno imati osposobljene učitelje za osmišljavanje raznovrsnih nastavnih scenarija i primjenu suvremenih tehnologija kojima bi omogućili učenicima stjecanje znanja i razvijanje kompetencija potrebnih za zdrav i održiv život u 21. stoljeću. Sa svrhom ustvrđivanja kako i u kolikoj...

  11. ODREĐIVANJE LOKACIJE SMJEŠTAJA LOGISTIČKO-DISTRIBUCIJSKOG CENTRA ŠIBENIK

    OpenAIRE

    Šego, Darijo; Poljičak, Ana-Mari; Martina LJUBIĆ HINIĆ

    2016-01-01

    Logističko-distribucijski centri predstavljaju suvremeni objekt u kojem se prihvaća, čuva, dorađuje i priprema roba za daljnju distribuciju do kupca. U ovom radu biti će prikazano određivanje lokacije smještaja Logističko-distribucijskog centra Šibenik. Izgradnjom, opremanjem i puštanjem u rad Logističko-distribucijskog centra Šibenik za neprehrambene proizvode, grad Šibenik dobio bi novu vrijednost u svom gospodarskom i prometnom razvoju. Lokacija smještaja je određena na temelju vrednovanja...

  12. Analiza razvoja i okluzalne karakteristike u primarnoj denticiji kod ispitanika sa i bez zbijenosti trajnih zubi

    OpenAIRE

    Miličić, Asja; Gaži-Čoklica, Vesna; Šlaj, Mladen; Rajić, Senka

    1993-01-01

    Činjenica da se kompresija u većem broju slučajeva prvi put pojavljuje za vrijeme mjene zubi, ne isključuje mogućnost ranije pojave određenih indikatora, na temelju kojih bi se mogla predvidjeti buduća anomalija. S ciljem provjere navedene hipoteze odlučili smo odrediti faktore koji bi mogli biti relevantni za razvoj kompresije i to analizom kvalitativnih i kvantitativnih karakteristika mliječne denticije i evaluacijom utjecaja svakog pojedinog obilježja na prostorne uvjete u trajnoj dent...

  13. Primjena lasera u dezinfekciji i čišćenju korijenskih kanala zuba: pregledni rad

    OpenAIRE

    BAGO JURIČ, Ivona; Anić, Ivica

    2014-01-01

    Uspjeh endodontskog liječenja zuba ovisi o učinkovitoj dezinfekciji endodontskog prostora i prevenciji reinfekcije. Današnjim postupcima kemijsko-mehaničke obrade korijenskog kanala ne može se uvijek postići zadovoljavajuća dezinfekcija i zato cijeljenje periapikalnog procesa može biti otežano. Zbog velike energije lasera i specifične interakcije s biološkim tkivima posljednja se dva desetljeća istražuje njihova primjena u dezinfekciji i čišćenju korijenskog kanala zuba. Predstavljeni su ...

  14. Antropontologija kao novi tip ontologije

    OpenAIRE

    Çotuksöken, Betül

    2013-01-01

    Antropontologija kao filozofski diskurs razlikuje se od klasične ontologije, fenomenološke ontologije, ontologije biti i nove ontologije. Poznato je da su različiti ontološki pogledi doveli do različitih prijelomnih točaka u povijesti filozofije. Antropontologija nudi novi tip ontologije koji se ustvari usredotočuje posebice na ljudska bića kao početnu točku. Što obuhvaća filozofski napor koji nastoji analizirati veze između ljudskog bića i znanja svijeta u svjetlu antropontologije? Što antro...

  15. Informacijski servisni sustav za poljoprivredni IoT

    OpenAIRE

    Minbo, Li; Zhu, Zhu; Guangyu, Chen

    2014-01-01

    Internet stvari suočen je s poteškoćama poput upravljanja s velikom količinom podataka, različitim standardnima identifikacije objekata, fuzije podataka iz više izvora, upravljanja poslovnim podatcima i pružanje informacijskih usluga. Sigurnosno nadgledanje poljoprivrednih proizvoda u Kini uvijek podliježe centraliziranoj arhitekturi gdje su podatci koncentrirani na jednom mjestu. Takvi sustavi ne mogu biti povezani jedni s drugim te jedan drugome ne mogu pristupati. U ovome radu predložen je...

  16. RAT I OKOLIŠ

    OpenAIRE

    Stanić, Sanja; Kutleša, Anja

    2008-01-01

    U radu se razmatraju utjecaji suvremenog rata na okoliš. Prvi dio rada donosi koncept rata u vidu kratkog prikaza društvene misli o ratu, te se obrazlaže pojam okoliša kao cjelokupnost prirodnog i socijalnog okruženja. Odnosi rata na okoliš analiziraju se kroz četiri konkretna rata, od kojih je kod svakoga naglašena specifična manifestacija na okoliš. Na primjeru Vijetnamskog rata ukazuje se kako destrukcija okoliša može biti u okviru ratnih operacija i poslužiti kao ratna strategija. Rat u P...

  17. Defenzivni pesimizam

    OpenAIRE

    Žužul, Tiona

    2008-01-01

    Novija istraživanja su, čini se, otkrila oblik pesimizma koji bi mogao biti adaptivan pojedincima koji ga pokazuju. Defenzivni pesimizam, strategija koja uključuje postavljanje niskih razina očekivanja u rizičnim situacijama radi spremnosti na neuspjeh, ne ometa izvedbu, a može dovesti i do određenog uspjeha. Međutim, adaptivnost ove strategije procijenjena je u određenom kontekstu i nije je moguće generalizirati u svim situacijama.

  18. Almanah 2015.: Istraživanja o fibrilaciji atrija u časopisu Heart.

    OpenAIRE

    Jawad-Ul-Qamar, Muhammad; Kirchhof, Paulus

    2016-01-01

    Fibrilacija atrija (FA) ne prestaje biti predmet zanimanja kardiovaskularne zajednice i časopisa Heart. U 2014. i 2015. godini u Heartu je objavljeno više od 60 istraživanja i preglednih članaka o raznim oblicima FA, od pridruženih stanja i trigerirajućih čimbenika do novih pristupa liječenju. Ovdje sažimamo članke o FA-u objavljene u Heartu tijekom 2014. i 2015. godine, uz naglasak na novim istraživanjima, idejama i pristupima liječenju.

  19. POMEN PREVENTIVE V PATRONAŽNEM VARSTVU

    OpenAIRE

    Gorinšek, Valentina

    2015-01-01

    Teoretična izhodišča. Vsak izmed nas si želi biti in ostati zdrav, saj je zdravje človekova največja vrednota. Prav tako si to želimo za vse svoje najbližje. Premalokrat pa ljudje pomislimo kaj lahko storimo sami, da bi svoje zdravje okrepili in preprečili obolevanje. Patronažne medicinske sestre izvajajo zdravstveno vzgojo in tako osveščajo o pomenu zdravja zdrave in bolne ljudi, vse od rojstva do smrti. Metodologija raziskovanja. V teoretičnem ...

  20. PREHRANA I DODACI PREHRANI KOD BOLESTI BUBREGA

    OpenAIRE

    Šabanović, Marizela; Cikotić, Jasmin; Jašić, Midhat; Azabagić, Almir; Miličević, Radoslav; Spaseska Aleksovska, Emilija

    2015-01-01

    Uvod: Najčešće bolesti bubrega su akutna i hronična upala ili nefritis, upala intersticija bubrega, nefrotski sindrom, bubrežni kamenci, degenerativne bolesti bubrega i bubrežni tumori. Pored općih načela pravilne prehrane kod bubreznih bolesti neophodno je voditi računa o unosu minerala, proteina i vode. Restriktivne dijete moraju biti individualno prilagođene svakom pacijentu i sprovedene uz liječnički nadzor. Danas se na tržištu nalaze i dodaci prehrani namijenjeni pacijentima koji boluju ...

  1. UKREPI ZA ZMANJŠANJE HRUPA ZARADI CESTNEGA PROMETA

    OpenAIRE

    Šolar, Marko

    2010-01-01

    Hrup je dandanes eden najpogostejših motenj ljudi in okolice, ki negativno vpliva na človeka fizično, psihološko in sociološko. V stanovanjskih stavbah ob prometnih cestah se je hrupu cestnega prometa mogoče izogniti tako, da so bivalni prostori obrnjeni stran od zunanjih virov hrupa, okna in vrata morajo biti primerno zvočno izolirana, zemljišča v okolici oblikovana z brežinami, zidovi itd. Da se stanje hrupne obremenjenosti izboljša, se posega za raznimi gradbenimi ukrepi na in ob ce...

  2. VPLIV OSEBNOSTNIH LASTNOSTI NA VODENJE MSP S POUDARKOM NA KOMUNICIRANJU KOT POGOJU ZA IZOGIBANJE KONFLIKTOV V PODJETJU STONEX D.O.O.

    OpenAIRE

    Urleb, Špela

    2011-01-01

    Nikogar ni mogoče prisiliti, da prevzame položaj vodje pa čeprav je morda za takšno delovno mesto izredno sposoben. Da oseba postane uspešen vodja, mora imeti izredno močno voljo, saj se je potrebno odreči veliko stvarem, za kar mora biti osebno in moralno močna oseba, prav tako pa mora v svoje podjetje verjeti. Da podjetje deluje uspešno je izjemno pomembno, da je komunikacija med zaposlenimi in vodjo podjetja iskrena, korektna, da temelji na resničnih trditvah. Če v podjetju nastanejo konfl...

  3. Zadržavanje duševno bolesnih osoba u zdravstvenoj ustanovi prema pravnom uređenju u Federaciji Bosne i Hercegovine

    OpenAIRE

    Čizmić, Jozo

    2013-01-01

    Prisilna (civilna) hospitalizacija složen je društveni fenomen koji otvara brojne medicinske, etičke, pravne, ekonomske, čak i političke probleme. Služi da bi se zdravstveno stanje osobe s trajnim ili privremenim duševnim smetnjama poboljšalo ili da bi se društvo zaštitilo od osoba s duševnim smetnjama, odnosno da bi se one same zaštitile od vlastitoga ponašanja. Zbog toga je prisilna hospitalizacija neodvojiva od problema temeljnih ljudskih prava i mora biti razmatrana i u tom kontekstu. U r...

  4. PRODAJA V KLICNEM CENTRU

    OpenAIRE

    Prcić, Damir

    2016-01-01

    Moje diplomsko delo obravnava temo prodaje v klicnem centru. S tem je povezana tudi obdelava tematike komunikacije – kaj je komunikacija, kako komuniciramo ter kaj pomeni v poslovnem svetu. Opredelil bom tudi, kaj klicni center je, in njegove prednosti ter slabosti. Izvedel bom tudi praktično raziskavo, v kateri bom potrdil oziroma ovrgel hipotezi, in sicer da mora biti prodaja prek klicnega centra skrbno načrtovana s pomočjo primerne komunikacije in da so stranke že navajene na pomoč klicneg...

  5. USTANOVITEV MALEGA PODJETJA "X"

    OpenAIRE

    Flisar, Alenka

    2010-01-01

    Veliko ljudi razmišlja, da bi »odšli na svoje«, da bi ustanovili podjetje, ga vodili in si tako sami krojili usodo, kajti če delaš sam, upravljaš lastnino z delom (Rozman, 2009). Za uresničitev sanj je potrebno veliko poguma in sposobnosti. Podjetnik mora imeti tako imenovano podjetniško žilico. Imeti mora vizijo, biti pripravljen trdo delati in delo, ki ga opravlja, imeti rad zaradi dela samega, ne pa zaradi denarja. Le tako bo zmogel po morebitnih padcih tudi vstati. Posameznik, ki se od...

  6. Osiguravanje međuoperabilnosti za Internet stvari: iskustvo s testiranjem CoAP protokola

    OpenAIRE

    Chen, Nanxing; Viho, César; Baire, Anthony; Huang, Xiaohong; Zha, Jiexi

    2014-01-01

    Constrained Application Protocol (CoAP) je specijalizirani prijenosni protokol, dizajniran za realizaciju međuoperabilnosti uz ograničene mrežame i čvorove za primjene poput pametne energije, automatizacije u zgradarstvu itd. Kao važan i sveprisutan protokol za Internet stvari CoAP bi mogao biti implementiran kod velikog broja pametnih uređaja kako bi se ostvarile kooperativne usluge. Zbog toga je od velike važnosti postic´i visoku razinu međuoperabilnosti CoAP implementacija. U tom kontekstu...

  7. OPTIMIZACIJA SPLETNIH STRANI

    OpenAIRE

    Morandel, Tjaša

    2012-01-01

    Današnja informacijska družba je prispevala k temu, da si svojega vsakdana ne znamo več predstavljati brez interneta. Če hočejo biti podjetja konkurenčna in v toku s časom, tudi njim ne uide uporaba interneta. Internet je postal med drugim tudi odličen oglaševalski medij za podjetja, vendar pa spletna stran ni učinkovita, če ni vidna obiskovalcem. K večji in učinkoviti vidnosti pripomore uporaba optimizacije spletnih strani. Osrednja tema diplomskega seminarja je bila optimizacija spletni...

  8. UTJECAJ DETERMINIRAJUĆIH ČIMBENIKA NA IMIDŽ TURISTIČKE DESTINACIJE

    OpenAIRE

    Kesić, Tanja; Jakeljić, Marija

    2012-01-01

    Imidž turističke destinacije koncept je od univerzalne važnosti ukoliko turistička destinacija želi biti konkurentna na lokalnom ili globalnom tržištu. Stoga je svrha ovog rada utvrditi i testirati determinirajuće čimbenike imidža grada Splita kao turističke destinacije na uzorku inozemnih turista. Za postizanje ove svrhe koristilo se postojećim kompleksnim modelom koji je prilagođen specifičnostima istraživane destinacije. Klasična obilježja destinacije poput zanimljivih atrakcija, kvalitetn...

  9. Marcel pl. Kiepach - zaboravljeni izumitelj na polju elektrotehnike

    OpenAIRE

    Homen, Zoran

    2005-01-01

    Obitelj Kiepach od Haselburga doselila se u Križevce u prvoj polovici 19. stoljeca, boraveci u tom gradu do završetka 2. svj. rata, kada su im dvorac i svi posjedi oduzeti od novih komunistickih vlasti. Njihov znacaj, kao i uloga pojedinih clanova obitelji u gospodarskom, humanitarnom, kulturnom i inovatorskom radu bili su predstavljeni na velikoj izložbi 2004. godine koju je priredio Gradski muzej Križevci. Uz podatke o podrijetlu obitelji Kiepach, u ovom tekstu naglasak ce biti ...

  10. Deformacije skupljanja betona - uzroci i vrste

    OpenAIRE

    Šahinagić-Isović, Merima; Markovski, Goran; Ćećez, Marko

    2012-01-01

    Skupljanje predstavlja vremensku deformaciju smanjenja volumena betona bez djelovanja vanjskih sila. Na vremenski tijek i konačne vrijednosti skupljanja utiče vrlo mnogo čimbenika: temperatura i vlažnost okoline, dimenzije elementa, vrsta i količina cementa, v/c faktor, granulometrijski i mineraloški sastav agregata, čvrstoća betona, način ugradnje i njega betona, starost betona u trenutku prekida njege i dr. Suštinski, ono je kombinacija nekoliko elementarnih vrsta skupljanja koji će biti iz...

  11. PRIMERJALNA ANALIZA RAČUNALNIŠKIH REŠITEV Z PODPORO RAČUNOVODSKIH SERVISOV

    OpenAIRE

    Korez, Tatjana

    2011-01-01

    Računovodstvo je posebna celota delov informacijskih dejavnosti, znotraj katerih se zbirajo, urejajo, obdelujejo, prikazujejo in shranjujejo podatki. Računovodstvo zasebnikov in družb je pomembno zaradi državnih oz. davčnih potreb, kot tudi zaradi interesov odločanja o poslovanju. Informacijski sistem in poslovanje podjetja morata biti usmerjena v doseganje ciljev in prilagodljiva. Pri predvidevanju spremenjenih potreb strank in pravočasnem odzivanju na nove zahteve igrajo najpomembnejšo...

  12. Računalni program za određivanje geometrijskih i hidrodinamičkih značajki brodskog vijka

    OpenAIRE

    Radonić, Mladen; Dejhalla, Roko

    2007-01-01

    U radu se razmatra izbor i optimizacija brodskog vijka te je prikazan računalni program za određivanje geometrijskih i hidrodinamičkih značajki brodskog vijka. Brodski vijak mora biti vrlo učinkovit, ne bi smio stvarati neželjene vibracije i buku te se naposljetku ne bi smjelo dopustiti erozijsko oštećenje uslijed kavitacije na krilima. Glavni zadatak projektanta jest pronaći ravnotežu između ovih zahtjeva. Početni pristup kod projekta brodskog vijka uobičajeno se temelji na rezultatima ispit...

  13. Strukturalne promjene kao indikator poslijeratnog socioekonomskog položaja emigracije iz južnoslavenskih zemalja u Australiji

    OpenAIRE

    Banović, Branimir

    1991-01-01

    Polazeći od primarnih izvora (statistike zemlje useljenja) prezentiranim se tekstom pokušalo ukazati na određene strukturalne promjene kao indikatore recentnog socioekonomskog položaja emigracije iz jugoslavenskih zemalja (teritorij bivše Jugoslavije) u Australiji. Poznata je, naime, činjenica da neki elementi demografske strukture (osobito njen ekonomski segment) mogu biti relativno pouzdani, iako ne i jedini pokazatelji socioekonomskog položaja stanovništva određenog prostora. U konkretnom ...

  14. PRAVNI VIDIKI SPLETNEGA IGRALNIŠTVA V EU IN V SLOVENIJI

    OpenAIRE

    Delič, Tanja

    2010-01-01

    V diplomski nalogi predstavljamo področje spletnih iger na srečo z vidika uporabnosti, saj je le-ta namenjena širšemu krogu bralcev. V njej je vse, kar potencialnega igralca lahko zanima, torej od samih iger, ki se ponujajo na spletu, plačilnih metod in tveganj, do pomembnih mejnikov v zakonodaji, ki vplivajo na njegovo igranje in institucij, na katere mora biti pozoren. Specifično področje spletnih iger na srečo predstavlja dandanes globalen izziv tako na političnem, ekonomskem in pravnem po...

  15. Unutarnji osjet i široki perceptualni model: odgovor Shoemakeru

    OpenAIRE

    Kimble, Kevin

    2014-01-01

    U nekolicini recentnih tekstova, Sydney Shoemaker tvrdi da introspektivnom znanju nedostaju određene ključne centralne značajke koje odgovaraju uvjetima zadovoljenima u običnim slučajevima osjetilne percepcije. U jednom utjecajnom radu on razmatra i kritizira »široki perceptualni « model prirode introspektivnog znanja mentalnih stanja, stajalište koje tvrdi da je naša introspektivna svijest unutrašnjih činjenica analogna našoj svijesti o činjenicama izvanjskoga svijeta. Ovaj model može biti o...

  16. ČASOPIS »RIBARSTVO« U CABI BAZAMA PODATAKA

    OpenAIRE

    Piria, Marina

    2008-01-01

    Ovim putem želimo obavijestiti čitatelje da će od 2008. godine časopis Ribarstvo biti indeksiran i u CABI bazama podataka. Komisija je napravila procjenu kvalitete časopisa na osnovu znanstvene vrijednosti članaka, uredništva i geografskog značaja. Rezultati procjene vrijednosti časopisa su nas ugodno iznenadili. Citiram dobiven odgovor nakon njihova sastanka u ožujku ove godine: “I am pleased to inform you that the publication was judged highly relevant to our subject area of the applied...

  17. NOVE VRSTE U JADRANSKOJ IHTIOFAUNI I SOCIO-EKONOMSKE POSLJEDICE NA HRVATSKO MORSKO RIBARSTVO

    OpenAIRE

    Dulčić, Jakov; Đođo, Željana; Dragičević, Branko; Ćukteraš, Marlena; Glamuzina, Branko

    2012-01-01

    Sve promjene u morskim ekosustavima imaju određeni učinak na korisnike morskih bioresursa, prije svega na morsko ribarstvo. Utjecaj klimatskih promjena na sektor morskoga ribarstva je složen, a učinci mogu biti i pozitivni i negativni u gospodarskom smislu. Promjene obuhvaćaju cijeli morski okoliš, od promjena u migracijskom obrascu riba u otvorenom moru, potencijalne promjene u sezoni rasta i vremena potrebnog za uzgoja riba, te potencijalni porast broja invazivnih vrsta. Ovo je dovelo do po...

  18. UPORABA MULTIVARIATNIH STATISTIČNIH METOD ZA RAZISKOVANJE ZADOVOLJSTVA ZAPOSLENIH V VISOKOTEHNOLOŠKEM PODJETJU

    OpenAIRE

    Blatnik, Staša

    2014-01-01

    Vodenje podjetja temelji na uporabi pravih informacij, ki morajo biti vodstvu na voljo ob pravem času. Pridobivanje informacij, ki odražajo dejansko stanje v podjetju, je zahteven postopek. Najprej moramo dobro definirati raziskovalni problem in na podlagi le-tega določiti konceptualne okvire raziskave. Nadalje moramo poznati teoretične osnove izvajanja raziskav, pridobivanja podatkov ter na koncu tudi teoretične in praktične osnove obdelave pridobljenih podatkov. V pričujočem delu smo om...

  19. SNOVANJE DELOVNIH SKUPIN V ORGANIZACIJI

    OpenAIRE

    Ferk, Matej

    2011-01-01

    Delovna skupina je pomembna sestavina vsakega podjetja, saj udeleženci skupine s svojimi znanji in povezanostjo pripomorejo k hitrejšem, kakovostnejšem in bolj ekonomičnem opravljanju nalog v podjetju. Pomemben člen delovne skupine predstavlja vodja skupine, ki mora skupino voditi tako, da je le-ta produktivna, obenem pa mora biti pazljiv, da prepreči oziroma reši morebitne konflikte med člani delovne skupine. S pomočjo poslovnih sestankov, ki potekajo v vsakem podjetju pa poskuša vodja z upo...

  20. MOTIVIRANJE ZAPOSLENIH V PODJETJU L & C D.O.O.

    OpenAIRE

    Pavlović, Maja

    2015-01-01

    Motivacija ljudi na delovnem mestu je izrednega pomena. Ljudje morajo biti za delo motivirani, saj bodo le tako opravili svoje delo kvalitetno. Motivacija je pravzaprav gonilna sila katera žene posameznika k cilju zato je izjemnega pomena za vse ljudi. Ljudje se razlikujemo seveda po načinu kateri nas motivira. Zato je dobro da managerji k vsakemu tipu osebnosti pristopijo na pravilen način in tako svojega zaposlenega motivirajo za nadaljnje delo. Pravzaprav so ključ do uspešnega podjetj...

  1. ODLOČITVENI MODEL ZA IZBIRO PARNOKONVEKCIJSKE PEČICE

    OpenAIRE

    Kosar, Jože

    2015-01-01

    Delo v profesionalni kuhinji je zelo intentivno in stresno. Obroki morajo biti pripravljeni hitro in okusno. V veliko pomoč pri tem je kvalitetna parnokonvekcijska pečica. Njena glavna značilnost je zmožnost kuhanja, peke in kombinacije obeh načinov, kar omogoča vrhunsko pripravo obrokov. V proučevanem podjetju so se odločili za nakup nove parnokonvekcijske pečice. Pri odločitvi smo si pomagali z računalniškim programom za podporo odločanju DEXi in programom Verdana. Izbirali smo med petimi...

  2. ZAŠČITA GEOGRAFSKIH OZNAČB V ZDA IN V EU TER ODNOS DO VARSTVA GEOGRAFSKE OZNAČBE V OBEH SISTEMIH, S POUDARKOM NA ZAŠČITI GEOGRAFSKIH OZNAČB VIN IN OSTALIH IZDELKOV IZ GROZDJA

    OpenAIRE

    Ložar Glumac, Mojca

    2011-01-01

    Magistrska naloga obravnava področje zaščite geografskih označb s poudarkom na geografskih označbah vina in ostalih izdelkov iz grozdja v EU in v ZDA, podobnosti, razlike in odnos do zaščite med obema sistemoma. Danes namreč ni več dovolj, da je izdelek različen od drugih, mora biti tudi med najboljšimi. Ker se geografske označbe in označbe porekla razlikujejo od drugih pravic intelektualne lastnine, ki nakazujejo kakovost, predvsem od blagovne znamke, je potrebno, da sta pri izdelku z geogra...

  3. ABSENTIZEM IN FLUKTUACIJA V VRTCU MEDVODE

    OpenAIRE

    Leben, Barbara

    2014-01-01

    V tem času, ko moramo biti pripravljeni učiti se in se prilagajati nenehnim spremembam, v katere nas sili sodobni čas, v organizacijah velikokrat pride do upravičenega ali neupravičenega zdravstvenega absentizma in do zaželene ali nezaželene fluktuacije. Za delodajalce to pomeni strošek, za delojemalce pa na primer nižji mesečni dohodek, slabo voljo, nemotiviranost za delo. V diplomski nalogi smo na osnovi teoretičnih spoznanj prišli do ugotovitev, da je tako zdravstveni absentizem kot fl...

  4. DEJAVNIKI, KI VPLIVAJO NA PLANIRANJE KADROV V PODJETJU KNAUF INSULATION

    OpenAIRE

    Šuša Zavolovšek, Maruša

    2013-01-01

    Diplomsko delo je razdeljeno na teoretični in praktični del. V teoretičnem delu sem podrobneje definirala pojem managementa človeških virov in pojem kadrovske politike ter razložila, da je potrebno kadrovsko politiko in njeno izvajanje opredeliti kot sistem norm, načel in temeljnih odločitev o kadrovskih zadevah, ki morajo temeljiti na strokovnih dogajanjih in morajo biti sprejete po demokratični poti. V praktičnem delu, sem podrobneje predstavila začetke podjetja Knauf Insulation, njegov...

  5. SPLETNO OGLAŠEVANJE BLAGOVNE ZNAMKE VIN

    OpenAIRE

    Hafner, Tamara

    2015-01-01

    Z napredovanjem informacijske tehnologije vse več uporabnikov uporablja internet. Inovacije in konkurenca pa pripeljejo do tega, da se tudi oglaševanje na internetu razvija ter išče nove možnosti in oblike oglaševanja. Biti samo prisoten na spletu na svoji spletni strani ni več dovolj. V ospredje prihaja problem in vprašanje kje in kako oglaševati, da bo naša blagovna znamka prepoznavna, mi pa konkurenčni. V magistrskem delu so predstavljene različne oblike in metode oglaševanja, predno...

  6. UPORABA INTERNETA ZA NEPOSREDNO PRODAJO

    OpenAIRE

    Tomec, Matej

    2010-01-01

    Namen diplomskega dela je preučiti internet, kot nov medij in njegovo vlogo pri prodaji. Da je internet kot medij nekaj posebnega in da nudi več priložnosti, kot nevarnosti, sem dokazal s primerjavo s tradicionalnimi mediji. Posebej sem še izpostavil slabosti in prednosti e-nakupovanja, ter s tem želel ugotoviti, na kaj morajo biti podjetja pozorna, da bodo pri prodaji preko interneta uspešna. Razlogi, zakaj večina slovenskih podjetij pri spletni prodaji ni uspešna v tolikšni meri, kot bi si ...

  7. Pedagogija kao sustavna znanost obrazovanja

    OpenAIRE

    Komar, Zvonimir

    2008-01-01

    Pedagogija shvaćena kao znanost koja se ne može temeljiti na pojmu funkcioniranja, pozitivizmu ili pragmatizmu, iziskuje utemeljenost putem samoevidentnog općeg pojma, koji u smislu ishodišta i svrhe omogućuje konzistentnu cjelinu znanosti. Rad prije svega ima intenciju sustavno misliti o takvom samo-utemeljenom, te u bitnom smislu samosvrhovitom pojmu, koji bi mogao biti i sabiralište i temelj pedagogijske znanosti kao sustava. Kao toj intenciji primjeren pojam istražuje se pojam obrazovanja...

  8. Pridobitev lastninske pravice na nepremičnini s priposestvovanjem v povezavi s sodno prakso

    OpenAIRE

    Boršič, Klara

    2016-01-01

    Diplomsko delo z naslovom »Pridobitev lastninske pravice na nepremičnini s priposestvovanjem v povezavi s sodno prakso« obravnava institut priposestvovanja kot originarnega načina pridobitve lastninske pravice na nepremičninah in vsebuje pregled aktualnih sodnih odločb na tem področju. Priposestvovanje lastninske pravice na nepremičninah omogoča izpolnitev temeljnih predpostavk, in sicer dobre vere, lastniške posesti ter preteka 10 – letne priposestvovalne dobe, ki morajo biti izpolnjene ...

  9. OBLIKOVANJE ETAŽNE LASTNINE

    OpenAIRE

    Štampalija, Nuša

    2014-01-01

    Etažna lastnina je najpomembnejša in najmnožičnejša lastninska oblika. Opredeljena je kot lastninska pravica na posameznem delu zgradbe in solastninska pravica na skupnih delih. Kot lastnina na posameznem delu zgradbe predstavlja izjemo od načela "superficies solo cedit" in načela specialnosti. Da se na zgradbi lahko oblikuje etažna lastnina, mora biti mogoče oblikovati posamezne dele zgradbe kot samostojne funkcionalne celote, primerne za samostojno uporabo. Oblikovanje etažne lastnine k...

  10. Farmakoterapija vertiga

    OpenAIRE

    TRKANJEC, ZLATKO; Aleksić-Shibabi, Anka; Demarin, Vida

    2007-01-01

    Farmakoterapija vertiga može biti simptomatska ili specifična. Ne postoji idealni lijek za liječenje vertiga. Akutni vertigo se obično liječi vestibularnim supresorima i antiemeticima. U liječenju vertiga i pridruženih simptoma najčešće se primjenjuju antikolinergici, antihistaminici, dopaminergički antagonisti i monaminergici. I neki drugi lijekovi se također primjenjuju u liječenju vertiga. Međutim, vertigo je subjektivni osjećaj, što otežava mjerenje učinka lijekova. Stoga mnogi radovi o l...

  11. KEMPINSKI PALACE PORTOROŽ - ENKRATNA PRILOŽNOST SLOVENSKEGA TURIZMA

    OpenAIRE

    Pondelak, Mojca

    2010-01-01

    Razvoj močnega turističnega položaja na svetovnem trgu lahko za državo predstavlja veliko prednost. Za doseganje takšnega položaja mora biti ponudba prilagojena tudi najbolj zahtevnim gostom. Prenovljeni hotel Palace predstavlja možnost razvoja turizma za najbolj zahtevne goste, saj je ponudba na najvišjem nivoju. K izboljšanju ponudbe dodatno prispeva menedžerski prevzem s strani hotelske verige Kempinski. V diplomskem delu je tako predstavljena ponudba hotela Palace in Kempinski hotelska ve...

  12. MEDVRSTNIŠKO NASILJE V PREDŠOLSKEM OBDOBJU

    OpenAIRE

    Poklič, Ksenija

    2010-01-01

    Diplomsko delo Medvrstniško nasilje v predšolskem obdobju je sestavljeno iz teoretičnega in empiričnega dela. Znotraj tega smo navedli in opisali, kaj je pojav medvrstniškega nasilja, kaj vpliva nanj, na kaj moramo biti pozorni. Pomemben poudarek smo dali tudi na vrtec, kot vzgojno-izobraževalno ustanovo in vzgojiteljico, kot pomemben dejavnik v otrokovem življenju v predšolskem obdobju. To smo v empiričnem delu tudi raziskali. Nasilje med vrstniki ni nov, je pa na žalost vedno pogostejši poj...

  13. Novost u kontaktologiji – silikonske mekane leće. Koliko su sigurnije za pacijenta?

    OpenAIRE

    Ćuruvija Opačić, Ksenija; Šarić, Dean

    2008-01-01

    Razvoj silikonskih mekanih leća ujedinio je dobre osobine silikona: visoku propusnost za kisik i udobnost hidrogela iz mekanih kontaktnih leća. Optimizam da će time svi problemi biti riješeni nije se u cijelosti ostvario. Najveći napredak postignut je u smanjenju znakova hipoksije koja je bila relativno čest problem u nositelja standardnih mekanih leća, posebno kod produženog nošenja. No komplikacije su moguće i opisane su u literaturi. Od mehaničkih, to je pojava mucinskih loptica, lučnog ep...

  14. TRŽNO KOMUNICIRANJE IZOBRAŽEVALNIH STORITEV

    OpenAIRE

    Cvetko, Barbara

    2012-01-01

    Obravnavano področje se nanaša na tržno komuniciranje izobraževalnih storitev, kjer se v praktičnem delu analizira poslovanje jezikovne šole Hiša jezikov na tem področju. Tržno komuniciranje ni le oglaševanje in prodaja storitev. Vsaka organizacija mora razumeti potrebe svojih ciljnih skupin in poiskati rešitve, katere bodo te potrebe predvsem kakovostno zadovoljile. Zaposleni v organizaciji morajo biti usposobljeni za izvedbo celotnega postopka izvajanja tržnega komuniciranja, od raziskovanj...

  15. Katalog oružja i dodatne opreme

    OpenAIRE

    Braica, Silvio

    1996-01-01

    Zbirka oružja u Etnografskom muzeju u Splitu nakon dugog rada na determinaciji je napokon sređena i popisana u stanju u kojem je nađena 90-ih godina. Kako je muzej u nemogućnosti prezentirati eksponate zbog neadekvatne zgrade i nedostatka prostora, te zbog zaštitnih radova na samim predmetima, biti će predočen sažeti katalog cijele zbirke. Nadati se je da će stručnjacima i ovakva prezentacija pomoći pri usporedbi i radu na svojim zbirkama hladnog i vatrenog oružja, te dodatne opreme.

  16. OCENJEVANJE VELIKOSTI RASTLIN S POMOČJO DIGITALNIH POSNETKOV

    OpenAIRE

    Videc, Barbara

    2015-01-01

    Tema diplomskega dela je preučiti možnost ocenjevanja velikosti rastlin s pomočjo digitalnih posnetkov zajetih z običajnim digitalnim fotoaparatom. Ti sceno digitalizirajo in jo predstavijo v slikovnem prostoru, kjer metrični podatki niso več neposredno dostopni, se pa ohranijo razmerja velikosti. V kolikor sta za izbrano sceno na voljo dve takšni slikovni predstavitvi, lahko določimo metrične lastnosti, vendar morata biti znani medsebojna oddaljenost in zorni kot kamere. Postopek v delu je r...

  17. VZPOSTAVITEV RAČUNALNIŠKO PODPRTEGA RAČUNOVODSKEGA PREDRAČUNAVANJA POSLOVNEGA IZIDA TURISTIČNEGA PROIZVODA V TURISTIČNI AGENCIJI X

    OpenAIRE

    Glazer, Nataša

    2014-01-01

    Računovodsko predračunavanje je dandanes temeljni sestavni del računovodenja v vsaki organizaciji, ki želi dosegati dobre rezultate, se hitro prilagajati spremembam na trgu, biti korak pred konkurenco in sprejemati prave poslovne odločitve ob pravem času za dolgoročni razvoj in obstoj organizacije. Poznamo tradicionalne in novejše metode predračunavanja. Zelo pomembno je, da vsako podjetje izbere pravo v svojem okolju, ki bo nepogrešljivo orodje managerjem na najvišji in najnižji ravni. V...

  18. Uzorkovanje upravljano ispitanicima: novi pristup uzorkovanju skrivenih populacija

    OpenAIRE

    Baćak, Valerio

    2006-01-01

    Uzorkovanje upravljano ispitanicima (respondent-driven sampling – RDS) dio je porodice metoda uzorkovanja lančanim upućivanjem utemeljenim na društvenim mrežama, usmjereno na skrivene i teško dostupne populacije poput intravenskih korisnika droga i muškaraca koji imaju seksualne odnose s muškarcima. Te su populacije izložene povećanom riziku od zaraze HIV-om i stoga su glavne ciljne skupine preventivnih aktivnosti. One, međutim, ne mogu biti poduzete bez potrebnih informacija o stavovima, pon...

  19. 3D geometrijsko modeliranje namještaja

    OpenAIRE

    Mijović, Budimir; Grbac, Ivica; Domljan, Danijela

    2006-01-01

    U radu je prikazan opis računalne grafike u dizajnu namještaja. Uvođenje računalne grafike u dizajn namještaja mora biti koncipirano na bazi podataka pomoću kojih se mogu proučiti elementi modela ili cijeli model. Za tu je svrhu opisan način 3D geometrijskog modeliranja namještaja. Računalnom vizualizacijom virtualnog 3D postupka u interakciji s digitaliziranim realno izvedenim namještajem i okolinom uvedeno je optimalno i ergonomsko oblikovanje i određivanje dimenzija namještaja. Radi što bo...

  20. Ovarian down Regulation by GnRF Vaccination Decreases Reproductive Tract Tumour Size in Female White and Greater One-Horned Rhinoceroses

    Science.gov (United States)

    Hermes, Robert; Schwarzenberger, Franz; Göritz, Frank; Oh, Serena; Fernandes, Teresa; Bernardino, Rui; Leclerc, Antoine; Greunz, Eva; Mathew, Abraham; Forsyth, Sarah; Saragusty, Joseph; Hildebrandt, Thomas Bernd

    2016-01-01

    Reproductive tract tumours, specifically leiomyoma, are commonly found in female rhinoceroses. Similar to humans, tumour growth in rhinoceroses is thought to be sex hormone dependent. Tumours can form and expand from the onset of ovarian activity at puberty until the cessation of sex-steroid influences at senescence. Extensive tumour growth results in infertility. The aim of this study was to down regulate reproductive function of tumour-diseased and infertile females to stop further tumour growth using a Gonadotropin releasing factor (GnRF) vaccine. Four infertile southern white (Ceratotherium simum simum) and three Greater one-horned rhinoceroses (rhinoceros unicornis) with active ovaries and 2.7 ± 0.9 and 14.0 ± 1.5 reproductive tract tumours respectively were vaccinated against GnRF (Improvac®, Zoetis, Germany) at 0, 4 and 16 weeks and re-boostered every 6–8 months thereafter. After GnRF vaccination ovarian and luteal activity was suppressed in all treated females. Three months after vaccination the size of the ovaries, the number of follicles and the size of the largest follicle were significantly reduced (P<0.03). Reproductive tract tumours decreased significantly in diameter (Greater-one horned rhino: P<0.0001; white rhino: P<0.01), presumably as a result of reduced sex-steroid influence. The calculated tumour volumes were reduced by 50.8 ± 10.9% in Greater one-horned and 48.6 ± 12.9% in white rhinoceroses. In conclusion, GnRF vaccine effectively down regulated reproductive function and decreased the size of reproductive tract tumours in female rhinoceros. Our work is the first to use down regulation of reproductive function as a symptomatic treatment against benign reproductive tumour disease in a wildlife species. Nonetheless, full reversibility and rhinoceros fertility following GnRF vaccination warrants further evaluation. PMID:27403662

  1. Generalism as a subsistence strategy: advantages and limitations of the highly flexible feeding traits of Pleistocene Stephanorhinus hundsheimensis (Rhinocerotidae, Mammalia)

    Science.gov (United States)

    Kahlke, Ralf-Dietrich; Kaiser, Thomas M.

    2011-08-01

    The so-called Hundsheim rhinoceros, Stephanorhinus hundsheimensis, was a very common faunal element of the Early to early Middle Pleistocene period in the western Palaearctic. In this study, individuals from two different central European populations of the Hundsheim rhinoceros were analysed in order to determine whether their local dietary signals could reflect differing food availability between the two populations, and whether such information could provide a better understanding of the ecological role of S. hundsheimensis within corresponding faunal assemblages, and of its principal subsistence strategy in the western Palaearctic. The mesowear traits observed in the studied S. hundsheimensis populations have been interpreted as representing biome-specific signals, indicating grassland vegetation at the site of Süßenborn, and dense to open forests at Voigtstedt (both localities in Germany). The analyses performed on the fossil rhino material demonstrate the most pronounced dietary variability ever established for a single herbivorous ungulate species by mesowear studies. This variability ranges from an attrition dominated grazing regime, to a one of predominantly browsing, and characterises S. hundsheimensis as the most ecologically tolerant rhinoceros of the Palaearctic Plio-Pleistocene. Although such dietary flexibility proved an effective enough subsistence strategy over a period of 600-900 ka (1.4/1.2-0.6/0.5 Myr) in the western Palaearctic, the situation changed dramatically after 0.6 Myr BP, when the new species of rhinoceroses, Stephanorhinus hemitoechus and Stephanorhinus kirchbergensis, appeared and started to compete for both the grass and the browse. For the generalist S. hundsheimensis, this bilateral interference was detrimental to its success in all of its habitats. The successful competition of specialised forms of rhinoceroses, which might have originated as a result of the development of 100 ka periodicity in the global climatic record, is

  2. Mandibular 2 implant destekli overdenture protezlerde ataşmanlar üzerine gelen streslerin değerlendirilmesi

    OpenAIRE

    Ramoglu, Serhat; OZAN, Oğuz; Kurtulmuş Yılmaz, Sevcan

    2014-01-01

    Objectives: The aim of this study was to evaluate the effect of implant locations on the stress around the two different attachment systems in mandibular two-implant overdentures.Materials and Methods: The data obtained from Visible Human Project were modified with the use of VRMESH and Rhinoceros 4.0 software to establish a 3D mandible model with 2 mm cortical bone covering the trabecular bone and 2 mm mucosae. 3D models (totally 6 models) of mandibular two-implant overdenture were designed ...

  3. Rash caused by Oryctes nasicornis.

    Science.gov (United States)

    Veraldi, Stefano; Fanoni, Daniele; Nazzaro, Gianluca

    2016-02-01

    We report a case of rash caused by crushing of a male of Oryctes nasicornis (Linnaeus 1758) (Coleoptera, "http:// it. wikipedia. org/ wiki/ Scarabaeidae" \\o "Scarabaeidae" Scarabaeidae), popularly known as "European rhinoceros beetle", on the skin of an Italian tourist who developed the reaction during a trip to Turkey. The rash appeared one hour after the crushing of the insect on the skin. The patient was observed one day later, when she returned to Italy. To our knowledge, no similar cases have been reported in the literature. PMID:26858273

  4. Universal nature of spondyloarthropathy as a reactive disease, reflecting differential sensitivities.

    Science.gov (United States)

    Rothschild, Bruce M

    2013-01-01

    Tendency to afflict one part of the skeleton, rather than another, could be referred to as the osseotropism of the disease. That term would also include which part of the particular bone was affected. That, in addition to characteristics of erosions, facilitates distinguishing spondyloarthropathy from rheumatoid arthritis, calcium pyrophosphate deposition disease and gout. Spondyloarthropathy, however, is not limited to humans. Initially recognized in 20% of gorillas and rhesus macaques, it was subsequently identified in 25% of bears and 35% of rhinoceros. It is truly a pan-mammalian phenomenon, extending from marsupials and rodents to whales and as ancient as dinosaurs. PMID:25409665

  5. Ecological factors differentially affect mercury levels in two species of sympatric marine birds of the North Pacific

    International Nuclear Information System (INIS)

    In 2003 and 2004, we measured mercury concentrations and δ15N and δ13C values in the whole blood of adults of two species of seabirds, Cassin's auklet (Ptychoramphus aleuticus) and rhinoceros auklet (Cerorhinca monocerata), during their prelaying, incubation, and provisioning periods. We also collected whole blood from the offspring of both seabirds. Among prey items, δ15N values were higher in fish than in crustaceans, while δ13C did not vary systematically between prey types. Mercury concentrations in prey showed little relationship with either stable isotope. In the zooplanktivorous Cassin's auklet, year, reproductive stage, and δ15N and δ13C stable isotope values explained only 14% of the variation in mercury concentrations in adult blood, and none of these variables had a statistically significant effect. In contrast, these same variables explained 41% of the variation in mercury levels in the more piscivorous rhinoceros auklet, and all but δ15N values had statistically significant effects. Mercury concentrations in adult rhinoceros auklets were higher in 2003 than in 2004; higher prior to laying than during the incubation or provisioning periods; and increased with δ13C values - but in just one of two years. In both species, mercury concentrations were substantially higher in adults than in nestlings. Our results accord with previous studies in showing that mercury concentrations can vary among years, species and age classes, while the marked variation with reproductive stage is noteworthy because it is so rarely considered. Our results may help to explain the disparate conclusions of previous studies: while many factors influence mercury concentrations in marine predators, they apparently do so in a manner that defies easy characterization. We believe that there is a need for more studies that consider a range of physiological, ecological and behavioral factors that might affect mercury burdens in marine predators. - Research Highlights: → We

  6. Ecological factors differentially affect mercury levels in two species of sympatric marine birds of the North Pacific

    Energy Technology Data Exchange (ETDEWEB)

    Hipfner, J.M., E-mail: mark.hipfner@ec.gc.ca [Environment Canada, Pacific Wildlife Research Centre, RR 1 5421 Robertson Road, Delta, BC, V4K 3N2 (Canada); Hobson, K.A., E-mail: keith.hobson@ec.gc.ca [Environment Canada, 11 Innovation Blvd., Saskatoon, SK, S7N 3H5 (Canada); Elliott, J.E., E-mail: john.elliot@ec.gc.ca [Environment Canada, Pacific Wildlife Research Centre, RR 1 5421 Robertson Road, Delta, BC, V4K 3N2 (Canada)

    2011-03-01

    In 2003 and 2004, we measured mercury concentrations and {delta}{sup 15}N and {delta}{sup 13}C values in the whole blood of adults of two species of seabirds, Cassin's auklet (Ptychoramphus aleuticus) and rhinoceros auklet (Cerorhinca monocerata), during their prelaying, incubation, and provisioning periods. We also collected whole blood from the offspring of both seabirds. Among prey items, {delta}{sup 15}N values were higher in fish than in crustaceans, while {delta}{sup 13}C did not vary systematically between prey types. Mercury concentrations in prey showed little relationship with either stable isotope. In the zooplanktivorous Cassin's auklet, year, reproductive stage, and {delta}{sup 15}N and {delta}{sup 13}C stable isotope values explained only 14% of the variation in mercury concentrations in adult blood, and none of these variables had a statistically significant effect. In contrast, these same variables explained 41% of the variation in mercury levels in the more piscivorous rhinoceros auklet, and all but {delta}{sup 15}N values had statistically significant effects. Mercury concentrations in adult rhinoceros auklets were higher in 2003 than in 2004; higher prior to laying than during the incubation or provisioning periods; and increased with {delta}{sup 13}C values - but in just one of two years. In both species, mercury concentrations were substantially higher in adults than in nestlings. Our results accord with previous studies in showing that mercury concentrations can vary among years, species and age classes, while the marked variation with reproductive stage is noteworthy because it is so rarely considered. Our results may help to explain the disparate conclusions of previous studies: while many factors influence mercury concentrations in marine predators, they apparently do so in a manner that defies easy characterization. We believe that there is a need for more studies that consider a range of physiological, ecological and behavioral

  7. 美術の「タフォノミー」について : 芸術の起源をめぐって

    OpenAIRE

    小川, 勝

    2013-01-01

    The discovery of Parietal art at Chauvet, France, in 1994, for long time, has shocked the academic world of specialists for prehistoric arts. Above all, the absolute date of pigments used for confronting rhinoceros, for example, about 32,000 BP, is extraordinary against our common sense of art origin, and artistic high quality of the oldest art has needed to be explained by a proper theory. Australian Bednarik proposed the term ‘Taphonomy’ that situated the origin of art about 100,000 and mor...

  8. The $^{15}$N($\\bm\\alpha$,$\\bm\\gamma$)$^{19}$F reaction and nucleosynthesis of $^{19}$F

    OpenAIRE

    Wilmes, S.; Wilmes, V.; Staudt, G.; Mohr, P; Hammer, J. W.

    2002-01-01

    Several resonances in the $^{15}$N($\\alpha$,$\\gamma$)$^{19}$F reaction have been investigated in the energy range between 0.6 MeV and 2.7 MeV. Resonance strengths and branching ratios have been determined. High sensitivity could be obtained by the combination of the {\\sc{dynamitron}} high current accelerator, the windowless gas target system {\\sc{rhinoceros}}, and actively shielded germanium detectors. Two levels of $^{19}$F could be observed for the first time in the ($\\alpha$,$\\gamma$) chan...

  9. Building energy demand aggregation and simulation tools

    DEFF Research Database (Denmark)

    Gianniou, Panagiota; Heller, Alfred; Rode, Carsten

    2015-01-01

    - were examined, all connected to the regional district heating network. The aggregation of building energy demands was carried out according to typologies, being represented by archetype buildings. These houses were modelled with dynamic energy simulation software and with a simplified simulation tool......, which is based on monthly quasi-steady state calculations, using a visual parametric programming language (Grasshopper) coupled with a 3D design interface (Rhinoceros). The estimated heat demand of the examined houses from both simulation tools is compared to actual measured data of heat consumption...

  10. Conservation

    OpenAIRE

    NN,

    1988-01-01

    The Pahang and Johore State Governments have agreed to declare the 92,000 hectare Endau-Rompin Forest as a State Park. It had been proposed as a National Park in 1975, but, as usual, this did not prevent logging in the core area in 1977. This was halted after considerable national protest, but logging still occurs around the fringes and between S. Kinchin and S. Kemapan. The area is not only important for its animals (largest breeding population of Sumatran rhinoceros), but also has an outsta...

  11. Estudio, diseño y fabricación de un bulbo convencional

    OpenAIRE

    Escámez Galián, Daniel

    2013-01-01

    [SPA]El presente proyecto expone un estudio del comportamiento del bulbo en la mar en diferentes situaciones, el efecto que este produce sobre el rendimiento propulsivo y sobre la resistencia al avance. Además, damos una síntesis de los pasos seguidos para la creación de un bulbo, utilizando el programa de diseño gráfico Rhinoceros. Y concluimos con el diseño de un bulbo de propia creación, creado a través del programa de diseño gráfico Solidwords. Citando los procesos de fabricación ut...

  12. Timber Curtain: Designing with material capabilities

    DEFF Research Database (Denmark)

    Lahmy, Maya; Larsen, Niels Martin

    2015-01-01

    Timber Curtain explores relations between digital precision and material indeterminacy. It is an installation engaging spatially through its presence as a 1:1 architectural component as well as it is exploring novel technologies in the architectural design process from the very beginning of the g...... with use of pinewood, processed with a 5-axis CNC router. The digital process generation and simulation is implemented with Rhinoceros 3D, Grasshopper and GHPython, and AlphaCAM was used for preparing the CNC-milling....

  13. Manipulacija rezultatima sportskih natjecanja - kaznenopravna odgovornost za kazneno djelo prijevare

    Directory of Open Access Journals (Sweden)

    Matko Pajčić

    2011-12-01

    Full Text Available Manipulacija rezultatima sportskih natjecanja ima povijest vjerojatno jednako dugu kao i sport sam; međutim za pretpostaviti je da se prije radilo o rijetkim, izoliranim slučajevima. No, u novije vrijeme, a kao posljedica velike komercijalizacije sporta, takvo postupanje, koje je u pravilu koruptivne prirode, sve je učestalije. Riječ je o pojavi koja je vrlo često povezana s klađenjem, no ne nužno, budući da su prisutna i namještanja rezultata isključivo s ciljem postizanja određenog sportskog rezultata, npr. ostanka u određenom rangu natjecanja ili slično. U radu se razmatraju pojavni oblici tih radnji te mogućnosti kažnjavanja počinitelja navedenih protupravnih radnji temeljem normi kaznenog prava. Od više mogućnosti uspostavljanja kaznenopravne odgovornosti za više različitih kaznenih djela, u ovom radu će biti razmotrena samo kaznenopravna odgovornost za kazneno djelo prijevare, dok će razmatranje drugih kaznenih djela pod koja se obično povezuju s namještanjem rezultata sportskih natjecanja (primanje mita, davanje mita, udruživanje za počinjenje kaznenih djela, protupravno posredovanje, zlouporaba položaja i ovlasti i dr. biti predmet potanjeg razmatranja u posebnom radu.

  14. OSOBNI STEČAJ U HRVATSKOJ I SLOVENIJI

    Directory of Open Access Journals (Sweden)

    Sime Ivanjko

    2014-12-01

    Full Text Available Postupak osobnog stečaja bez obzira na pojedina dobra ili slaba rješenja u bilo kojoj državi neće naići na opću suglasnost u društvu, a osobitom u onim društvima gdje se svako neplaćanje dugova ocjenjuje negativnim moralnim predznakom i bez obzira na realne mogućnosti dužnika da plaća svoje dugove. Posebno to važi za neplaćanje obveza u poduzetništvu. Poduzetništvo je po svojoj osnovi amoralno - što znači da ga nije moguće ocjenjivati pozitivnim ili negativnim moralnim predznakom ako se poštuju pravila poduzetništva. Tako npr. stečaj gospodarskog subjekta nije u osnovi nemoralan jer je to nužna pojava u kapitalizmu. U prosjeku je potrebno da oko 300 sudionika u poduzetništvu na njih 10 000 mora u stečaj jer inače kapitalistički sustav ne može djelovati i ne može biti efikasan. U socijalizmu nismo imali stečajeva i zato poduzetništvo nije moglo biti konkurentno s partnerima u kapitalističkim sustavima.

  15. Uloga odvjetnika u upravnom postupku; studija slučaja u području pune jurisdikcije

    Directory of Open Access Journals (Sweden)

    Bruno Odent

    2015-04-01

    Full Text Available Uloga odvjetnika u upravnom postupku.(1 Pokreće postupak, mora imati presudnu ulogu vis-a-vis klijenta; odvjetnik ne smije biti zadovoljan s prinosima klijenta već mora istraživati dokumente i svjedočanstava; (2 Nakon postupka. Dakako, u istrazi nije gospodar postupka, ali on mora voditi računa da osigura i zadovolji rokove i uvjete koji su mu nametnuti od strane suda;(3 Aktivna uloga u ročištima, u kojoj mora biti u stanju kratko, ali snažno odgovarati izvjestitelja-zastupniku države; (4 Ima ulogu nakon donošenja odluke: objašnjenje uloge vis-a-vis klijenta; ulogu u slučaju neizvršenja kojeg uzrokuje uprava; ulogu u procjeni opravdanosti žalbe. Posebna je uloga odvjetnika iz Vijeća: (1 on opisuje posebnost uredovnog postupka; (2ima savjetodavnu ulogu; (3 objašnjava kasacijsku kontrolu(4 objašnjava spis protiv odluka Državnog vijeća; (5 pred Državnim vijećem objašnjava očekivanja u sporu.

  16. Quantitative methods of identifying the key nodes in the illegal wildlife trade network.

    Science.gov (United States)

    Patel, Nikkita Gunvant; Rorres, Chris; Joly, Damien O; Brownstein, John S; Boston, Ray; Levy, Michael Z; Smith, Gary

    2015-06-30

    Innovative approaches are needed to combat the illegal trade in wildlife. Here, we used network analysis and a new database, HealthMap Wildlife Trade, to identify the key nodes (countries) that support the illegal wildlife trade. We identified key exporters and importers from the number of shipments a country sent and received and from the number of connections a country had to other countries over a given time period. We used flow betweenness centrality measurements to identify key intermediary countries. We found the set of nodes whose removal from the network would cause the maximum disruption to the network. Selecting six nodes would fragment 89.5% of the network for elephants, 92.3% for rhinoceros, and 98.1% for tigers. We then found sets of nodes that would best disseminate an educational message via direct connections through the network. We would need to select 18 nodes to reach 100% of the elephant trade network, 16 nodes for rhinoceros, and 10 for tigers. Although the choice of locations for interventions should be customized for the animal and the goal of the intervention, China was the most frequently selected country for network fragmentation and information dissemination. Identification of key countries will help strategize illegal wildlife trade interventions. PMID:26080413

  17. Energy Production from Zoo Animal Wastes

    Energy Technology Data Exchange (ETDEWEB)

    Klasson, KT

    2003-04-07

    Elephant and rhinoceros dung was used to investigate the feasibility of generating methane from the dung. The Knoxville Zoo produces 30 cubic yards (23 m{sup 3}) of herbivore dung per week and cost of disposal of this dung is $105/week. The majority of this dung originates from the Zoo's elephant and rhinoceros population. The estimated weight of the dung is 20 metric tons per week and the methane production potential determined in experiments was 0.033 L biogas/g dung (0.020 L CH{sub 4}/g dung), and the digestion of elephant dung was enhanced by the addition of ammonium nitrogen. Digestion was better overall at 37 C when compared to digestion at 50 C. Based on the amount of dung generated at the Knoxville Zoo, it is estimated that two standard garden grills could be operated 24 h per day using the gas from a digester treating 20 metric ton herbivore dung per week.

  18. Translocations as experiments in the ecological resilience of an asocial mega-herbivore.

    Directory of Open Access Journals (Sweden)

    Wayne L Linklater

    Full Text Available Species translocations are remarkable experiments in evolutionary ecology, and increasingly critical to biodiversity conservation. Elaborate socio-ecological hypotheses for translocation success, based on theoretical fitness relationships, are untested and lead to complex uncertainty rather than parsimonious solutions. We used an extraordinary 89 reintroduction and 102 restocking events releasing 682 black rhinoceros (Diceros bicornis to 81 reserves in southern Africa (1981-2005 to test the influence of interacting socio-ecological and individual characters on post-release survival. We predicted that the socio-ecological context should feature more prominently after restocking than reintroduction because released rhinoceros interact with resident conspecifics. Instead, an interaction between release cohort size and habitat quality explained reintroduction success but only individuals' ages explained restocking outcomes. Achieving translocation success for many species may not be as complicated as theory suggests. Black rhino, and similarly asocial generalist herbivores without substantial predators, are likely to be resilient to ecological challenges and robust candidates for crisis management in a changing world.

  19. Dietary variation and overlap in Central and Northwest European Stephanorhinus kirchbergensis and S. hemitoechus (Rhinocerotidae, Mammalia) influenced by habitat diversity. "You'll have to take pot luck!" (proverb)

    Science.gov (United States)

    van Asperen, Eline N.; Kahlke, Ralf-Dietrich

    2015-01-01

    To trace the dietary evolution of the two abundant Middle to Late Pleistocene rhinoceros species Stephanorhinus kirchbergensis and Stephanorhinus hemitoechus in Europe over several climatic cycles, we examined comprehensive material of stratigraphically well-defined palaeopopulations from different regions and interglacials. Using morphometrics and mesowear analysis, these reconstructions of Stephanorhinus diets indicate that habitat diversity and interspecific competition with closely related rhinoceros species induced variation in feeding behaviour. Although anatomical features of both species suggest significantly higher dietary specializations compared to the Early to early Middle Pleistocene Stephanorhinus hundsheimensis, their mesowear signals are characteristic of a mixed feeder diet, similar to that of extant mammal species in relatively open habitats. Both species retained a degree of dietary flexibility, enabling them to survive in a range of environments. Although each of these rhinoceroses preferred different habitats, species identity alone is not sufficient to establish the real dietary traits of a Stephanorhinus palaeopopulation. As a consequence, their occurrence in a faunal assemblage alone cannot be taken to indicate a specific habitat. S. kirchbergensis and S. hemitoechus were embedded in a dynamic process of temporo-spatial replacements and interspecific differentiation of rhinoceroses in the western Palaearctic. However, dietary specialization in these Middle to Late Pleistocene European rhinoceroses was not the result of a directed time-transgressive evolution. Rather, within the range of each species' ecological tolerance, it was controlled by environmental parameters, with habitat variability as the main factor.

  20. Quantitative methods of identifying the key nodes in the illegal wildlife trade network

    Science.gov (United States)

    Patel, Nikkita Gunvant; Rorres, Chris; Joly, Damien O.; Brownstein, John S.; Boston, Ray; Levy, Michael Z.; Smith, Gary

    2015-01-01

    Innovative approaches are needed to combat the illegal trade in wildlife. Here, we used network analysis and a new database, HealthMap Wildlife Trade, to identify the key nodes (countries) that support the illegal wildlife trade. We identified key exporters and importers from the number of shipments a country sent and received and from the number of connections a country had to other countries over a given time period. We used flow betweenness centrality measurements to identify key intermediary countries. We found the set of nodes whose removal from the network would cause the maximum disruption to the network. Selecting six nodes would fragment 89.5% of the network for elephants, 92.3% for rhinoceros, and 98.1% for tigers. We then found sets of nodes that would best disseminate an educational message via direct connections through the network. We would need to select 18 nodes to reach 100% of the elephant trade network, 16 nodes for rhinoceros, and 10 for tigers. Although the choice of locations for interventions should be customized for the animal and the goal of the intervention, China was the most frequently selected country for network fragmentation and information dissemination. Identification of key countries will help strategize illegal wildlife trade interventions. PMID:26080413

  1. Translocations as experiments in the ecological resilience of an asocial mega-herbivore.

    Science.gov (United States)

    Linklater, Wayne L; Gedir, Jay V; Law, Peter R; Swaisgood, Ron R; Adcock, Keryn; du Preez, Pierre; Knight, Michael H; Kerley, Graham I H

    2012-01-01

    Species translocations are remarkable experiments in evolutionary ecology, and increasingly critical to biodiversity conservation. Elaborate socio-ecological hypotheses for translocation success, based on theoretical fitness relationships, are untested and lead to complex uncertainty rather than parsimonious solutions. We used an extraordinary 89 reintroduction and 102 restocking events releasing 682 black rhinoceros (Diceros bicornis) to 81 reserves in southern Africa (1981-2005) to test the influence of interacting socio-ecological and individual characters on post-release survival. We predicted that the socio-ecological context should feature more prominently after restocking than reintroduction because released rhinoceros interact with resident conspecifics. Instead, an interaction between release cohort size and habitat quality explained reintroduction success but only individuals' ages explained restocking outcomes. Achieving translocation success for many species may not be as complicated as theory suggests. Black rhino, and similarly asocial generalist herbivores without substantial predators, are likely to be resilient to ecological challenges and robust candidates for crisis management in a changing world. PMID:22295100

  2. Odnos učencev razrednega pouka do naravoslovja

    OpenAIRE

    Ignjatovič, Alma

    2015-01-01

    Na učenje strokovnjaki vse bolj gledajo kot na interaktivni transakcijski proces, ki je odvisen od učenca in učne situacije, predvsem pa od tega, kako so značilnosti učenca in učne situacije med seboj usklajene. Čim manjša je usklajenost med, na primer, učenčevim stilom učenja in učiteljevim stilom poučevanja, tem večja je možnost, da bo prišlo do učnih težav in šolske neuspešnosti. Zato mora biti pouk naravoslovja kakovostno pripravljen in organiziran, učitelj pa strokovno usposobljen in ust...

  3. ÖĞRENCİLERİN KADIN HASTALIKLARI VE DOĞUM DERSİNE İLİŞKİN DÖNEM BAŞLANGICI VE BİTİŞİNDEKİ GÖRÜŞLERİ

    OpenAIRE

    Taşcı, Kerime Derya

    2010-01-01

    ÖZETBu çalışma, Doğum ve KadınHastalıkları dersi alan öğrencilerin, dönembaşlangıcı ve bitişinde derse yönelikgörüşlerinin değerlendirilmesi, teorik veklinik uygulamaların öğrencilerin görüşleriüzerindeki etkisini belirlemek amacıylatanımlayıcı bir çalışma olarak yapılmıştır.Çalışmanın evrenini, Doğum ve KadınHastalıkları dersi alan 55 öğrenci,örneklemi ise 50 öğrenci oluşturmuştur.Araştırmanın ilk verileri ...

  4. Pronalaženje izvora onečišćenja u vodoopskrbnoj mreži

    OpenAIRE

    Kranjčević, Lado; Čavrak, Marko; Šestan, Marko

    2010-01-01

    Numeričkim hidrauličkim simulacijama mreže cijevi računaju se piezometrične visine i protoci u unutarnjim točkama cijevi i drugim hidrauličkim elementima mreže. Osim tih proračuna, cilj simulacije također može biti i širenje polutanata ili otopine u cijevnoj mreži. Širenje polutanata kroz vodnodistribucijsku mrežu cijevi uglavnom je uvjetovano svojstvima procesa miješanja u križnim cijevnim spojevima. Realno miješanje u križnom spoju nalazi se unutar pretpostavke modela potpunoga miješanja i ...

  5. Plućni tumorleti s okolnim fibroznim tkivom – suspektni karcinom: prikaz slučaja i pregled literature

    OpenAIRE

    Alerić, Ivan; Mosler, Domagoj; Seiwerth, Sven; Mlinarević Polić, Ines; Lazić Mosler, Elvira

    2014-01-01

    Plućni tumorleti su malene, često višestruke nodularne proliferacije plućnih neuroendokrinih stanica te su čest slučajni nalaz kod kroničnih upalnih plućnih bolesti. Također se mogu naći u normalnom plućnom parenhimu te kao jedan dio kontinuuma poznatog kao difuzna idiopatska hiperplazija plućnih neuroendokrinih stanica. U mnogim slučajevima oni su slučajni histološki nalaz bez značenja ili kliničkih posljedica, a mogu biti i povezani s vrlo sporom progresijom opstruktivnog ili miješanog opst...

  6. Rehabilitation of a Female Patient after Corrective Surgery for Tetralogy of Fallot

    Directory of Open Access Journals (Sweden)

    Cvetković Jovana

    2015-12-01

    Full Text Available Prikazana je bolesnica stara 25 godina sa tetralogijom Fallot. Ova urođena srčana mana nije tako česta, ali je najčešća među manama sa cijanozom. Lečenje bolesnica sa tetralogijom Fallot je hirurško i može biti palijativno i korektivno. Bolesnica koju smo prikazali imala je palijativnu operaciju, definitivnu korekciju i ponovnu operaciju zbog insuficijencije pulmonalne valvule. Tokom kardiovaskularne rehabilitacije bolesnica je bila ritmički stabilna uz odličnu toleranciju fizičkog napora. Imajući u vidu da se radi o mlađoj ženskoj osobi koja je tokom proteklih godina imala dva spontana abortusa, trudnoća nije apsolutno kontraindikovana, mada su spontani abortusi i komplikacije trudnoće češći kod ovih bolesnica.

  7. Tehnike povećanja iscrpka nafte i istiskivanje korištenjem CO2

    OpenAIRE

    Al-Jabra, Mojsin; Al-Anazi, Bandar Duraya

    2010-01-01

    Tijekom godina je zanimanje za povećanjem iscrpka nafte (EOR) smanjeno zbog povećanja naftnih rezervi i proizvodnje. Ispitano je mnogo metoda, u laboratoriju i na terenu, kako bi se povećala proizvodnja nafte. Otkriće velikih naftnih polja u svijetu donijelo je na svjetsko tržište velike količine nafte. Uz to su procjene naftnih rezervi s nalazišta na Bliskom Istoku znatno povećane, što je dovelo do očekivanja da će ponuda nafte biti velika. Iako su velike količine nafte i dalje preostale u s...

  8. Eksplorativno istraživanje mreže organizacijskog učenja u španjolskom poduzeću visoke tehnologije

    OpenAIRE

    Sánchez de Pablo González del Campo, Jesús David; Guadamillas Gómez, Fátima; Dimovski, Vlado; Škerlavaj, Miha

    2008-01-01

    Tekst sadrži rezultate istraživanja mreže unutar-organizacijskog učenja u španjolskom poduzeću visoke tehnologije. Istraživanje poopćava mrežnu perspektivu i prikazuje njenu primjenu na unutar-organizacijsko učenje. Na temelju eksplorativne analize socijalnih mreža, predložene su četiri hipoteze koje će biti razvijene i kasnije provjerene u konfirmatornoj analizi. Prvo, eksplorativna analiza pokazuje važnost stečenog iskustva o industriji i kontinuitet vrhovnog menadžmenta poduzeća kao zajedn...

  9. DELATNOST KAPITALA

    OpenAIRE

    Štimac Štimac, Milko; Jovičić, Željana

    2014-01-01

    Kapital može biti sve, samo ukoliko je aktivno. On postoji samo kroz obrt, što sledstveno znači da se svako dobro ili usluga mogu pretvoriti u kapital. Ovime se uspostavlja i granica između imovine i kapitala – imovina postaje kapital samo dok se upotrebljava u ekonomske svrhe. To takođe podrazumeva da se kapital može ostvariti jedino u odnosima između ljudi, što ga nužno povezuje i sa društvenim okruženjem. Ustrojstvo tog okruženja može da bude manje ili više prilagođeno pretvaranju dobara i...

  10. Koncept kreativnog grada u razvoju turizma Novog Sada

    OpenAIRE

    Kliček, Tamara

    2014-01-01

    U ovoj disertaciji primenjen je novi pristup koji za razvojni potencijal grada i urbanog turizma uzima kreativnost. Važno je razumeti i shvatiti da život gradu daju njegovi stanovnici i što je bolji kvalitet života u gradu, bolji će biti njegovi građani, a i sam grad će oživeti. Mnogi gradovi gube bitku sa destruktivnim silama, jer su se pomirili sa mišlju da su problemi toliko veliki i da se sa njima ne može izaći na kraj, pogotovo ako svi planski instrument...

  11. UVEDBA SPLETNE REŠITVE ZA PODPORO STRANKAM ZA PODROČJE IT

    OpenAIRE

    Močnik, Borut

    2016-01-01

    Cilj naloge je bil uvesti sistem za beleženje prijavljenih napak za področje IT. Beleženje mora biti takšno, da je vsa komunikacija med uporabnikom in tehnikom zbrana na enem mestu. Podatki, zbrani na takšen način omogočajo sistemsko zbiranje informacij, ki s časom tvorijo uporabno zbirko znanja. Ta zbirka znanja omogoča hitrejše odpravljanje napak kar se posledično odslikava v krajše izpade dela na uporabniški strani. Zaradi tega je organizacija pri delu lahko bolj učinkovita. Cilj smo doseg...

  12. PREVENCIJA DIJABETIČKOG STOPALA

    OpenAIRE

    Metelko, Željko; BRKLJAČIĆ CRKVENČIĆ, NEVA

    2014-01-01

    Dijabetičko stopalo (DS) najčešća je kronična komplikacija s pojavnosti koja ovisi o trajanju i uspješnosti liječenja šećerne bolesti. Temeljem epidemioloških studija procjenjuje se da će 25% osoba sa šećernom bolešću tijekom života razviti probleme sa stopalima, a 5 % do 15 % biti podvrgnuto amputaciji nogu. liječenje je dugotrajno i skupo, a rezultati neizvjesni i često loše prognoze. Promjene DS posljedica su utjecaja velikog broja različitih čimbenika, koji se javljaju najčešće usporedo s...

  13. LEUKEMIJA I TRUDNOĆA. NIJE DALJE ŠTETNA POVEZANOST?

    OpenAIRE

    Vladareanu, Ana-Maria; Popov, Viola; Vasilache, Veronica; Marinescu, Cristina; BUMBEA, Horia; Zvanca, Mona; Cisleanu, Diana; Begu, Madalina; Onisai, Minodora; Radesi, Sinziana; Andrei, Christian; VLADAREANU, Radu

    2008-01-01

    SAŽETAK. Cilj. Uopće nema čvrstih podataka o kemoterapijom liječenim leukemijama tijekom trudnoće. Rezultati na temelju kratkih izvješća pokazuju da liječenje tijekom drugog i trećeg tromjesečja može biti uspješno obavljeno. Prikazujemo tri trudnice liječene citostaticima, dvije od njih su bez posljedičnih malformacija primale kompletnu kemoterapiju tijekom cijele trudnoće. Prvi slučaj. Žena od 19 godina koja je spontano zanijela i krivo shvatila znakove trudnoće kao recidiv bolesti. Tijekom ...

  14. Istraživanje utjecaja fizičkih svojstava stijena na promjene propusnosti: analiza slučaja razvoja heterogenosti ležišta

    OpenAIRE

    Benzagouta, Mohammed Said

    2013-01-01

    Različiti čimbenici imaju utjecaj na petrofizičke značajke ležišta i njihov razvoj. Istraživanja su pokazala da su za provjeru značajki ležišta, heterogenosti i najvažnije propusnosti, najvažnija teksturna i fizička svojstva stijena. Varijacije u rasporedu veličine zrna i njihov razmještaj je jedan od čimbenika odgovornih za neusklađenost petrofizičkih značajki i u osnovi propusnosti i heterogenosti. Tako i u ovoj studiji slučaja, procjena kvalitete ležišta može biti podržana različit...

  15. DEJAVNIKI, KI VPLIVAJO NA PLANIRANJE KADROV

    OpenAIRE

    Pšeničnik, Marko

    2011-01-01

    Planiranje kadrov je dejavnost, ki bi morala biti v podjetjih vedno prisotna, s katero bi se morala podjetja vedno ukvarjati, da zagotovijo nemoten potek dela. A žal temu ni tako in ponavadi se menedžerji ter lastniki posvečajo obravnavani temi šele, ko v njihovi pravni entiteti pride do kadrovskih težav. Slednje nato poskušajo »ad hoc« reševati, a praksa kaže, da je to veliko manj učinkovit sistem kot če vseskozi skrbimo za kadre in imamo dober HRM sistem v podjetju. Turistične agencije, ki ...

  16. UTJECAJ GEOLOGIJE NA TIJEK I ISHOD 3. BITKE KOD YPRESA (FLANDRIJA, 1. SVJETSKI RAT)

    OpenAIRE

    Zečević, Marko

    2016-01-01

    Geološka građa terena kao podloga bojnoga polja može biti iznimno važan čimbenik za uspjeh ili neuspjeh vojne operacije. Utjecaj geološke građe bojnoga polja kod belgijskoga grada Ypresa pokazao se kao važan, a možda i presudan čimbenik za neuspjeh ofenzivnih operacija postrojbi sila Antante protiv postrojbi Njemačkoga Carstva 1917. godine. Geološka građa bojišta, odnosno donjoeocenske gline koje se nalaze na površini terena kao podloga bojnoga polja kod Ypresa u interakciji s meteorološkim u...

  17. Fenomen globalizacije: globalizacija i čovjek

    OpenAIRE

    Šola, Ivica

    2003-01-01

    Promatrajući odnos čovjeka i globalizacije kroz povijesnu epohu, možemo se složiti da je čovjek tvorac slika, svjestan da nije samo puka datost i dovršena stvarnost, nego ima potrebu za djelovanjem, koje se očituje stvaranjem slika u kojima želi pronaći svoj vlastiti identitet. U vrijeme kršćanske epohe slika se ne stvara nego otkriva te je naglasak stavljen na «biti na sliku». Vrijeme moderne stvara, međutim, kulturu separacije. Čovjek postaje "slika", on sebe stvara kroz djelovanje te se ra...

  18. Rosmarinic acid in Argusia argentea inhibits snake venom-induced hemorrhage.

    Science.gov (United States)

    Aung, Hnin Thanda; Nikai, Toshiaki; Niwa, Masatake; Takaya, Yoshiaki

    2010-10-01

    A methanolic extract of Argusia (or Messerschmidia or Tournefortia) argentea (Boraginaceae) significantly inhibited hemorrhage induced by crude venom of Trimeresurus flavoviridis. The extract was then separated according to antivenom activity by using silica gel column chromatography and HPLC equipped with an octadecylsilanized silica gel (ODS) column to afford rosmarinic acid (RA) (1) as an active principle. RA (1) significantly inhibited the hemorrhagic effect of crude venoms of T. flavoviridis, Crotalus atrox, Gloydius blomhoffii, Bitis arietans as well as snake venom metalloproteinases, HT-b (C. atrox), bilitoxin 2 (Agkistrodon bilineatus), HF (B. arietans), and Ac1-proteinase (Deinagkistrodon acutus). This is the first report of the antihemorrhage activity of RA (1), and RA (1) greatly contributes to the antihemorrhagic efficiency of A. argentea against crude snake venoms and hemorrhagic toxins. PMID:20512530

  19. İSRAİL/YAFA'DAKİ OSMANLI MİMARİ ESERLERİ ÜZERİNE GÖZLEMLER / OBSERVATIONS ON OTTOMAN ARCHITECTURAL WORKS IN JAFA/ISRAEL

    OpenAIRE

    Bayhan, Ahmet Ali

    2010-01-01

    Bugün İsrail'in eski ve önemli kentlerinden birisi olarak bilinen ve TelAviv'ebağlı bir yerleşim yeri olan Yafa'da, özellikle XIX. yüzyılda inşa edilmişOsmanlı eserleri mevcuttur. Bu makalede Yafa'dan Bahr Camii (Camiu'l-Bahr,Deniz Camii), Mahmudiye Camii (Yafa Ulu Camii), Cebeliye Camii, Sıksık Camii,Acemi Camii, Hasan Bey Camii, Ebu Nabbut Sebili, Mahmudiye Camii'ne BitişikSebil, Süleyman Paşa Sebili, Eski Saray (Eski Hükümet Binası), Yeni Saray (YeniH&uum...

  20. Kronologija od izlaska iz Egipta do babilonskog sužanjstva

    OpenAIRE

    Neuffer, Julia

    1998-01-01

    Kao i svi drugi drevni izvještaji i biblijski sadrže probleme. Prije svega izvještaji su često nepotpuni. Drugo, ne možemo uvijek biti sigurni da poznajemo metodu kojom su ljudi onog vremena vršili računanje. Na primjer, jesu li godinu računali s početkom u proljeće ili u jesen, ili se u frazi kao što je "tri godine" rabilo uključivo računanje. Osim toga, nije uvijek moguće uskladiti biblijsku sa svjetovnom kronologijom. Zbog ovih i drugih razloga koje bismo mogli navesti, nije moguće izr...

  1. Trgovačka društva u energetskom pravu Republike Hrvatske

    OpenAIRE

    Brnabić, Ratko; Ivkošić, Marko

    2013-01-01

    U radu se raspravlja o važnim pitanjima u svezi s pravnim položajem trgovačkih društava koja obavljaju energetske djelatnosti. Tu bi djelatnost mogli obavljati i trgovci- fizičke osobe, ali zbog osobne izloženosti razumljivo je da će glavni nositelji biti društva kapitala, a prvenstveno društvo s ograničenom odgovornošću. Iako je tu još uvijek riječ o pravnim oblicima uređenima Zakonom o trgovačkim društvima, na njih se kao lex specialis primjenjuju odredbe energetskih zakona. Odredbe tih pro...

  2. DIZAJN PROIZVODA S ISTOVREMENO MEĐUNARODNOM I LOKALNOM PERSPEKTIVOM NA OSNOVI YIN-YANG TEORIJE RAVNOTEŽE I SWARA METODE

    OpenAIRE

    Hashemkhani Zolfani, Sarfaraz; Zavadskas, Edmundas Kazimieras; Turskis, Zenonas

    2013-01-01

    Proizvodnja i dizajn proizvoda su ključevi uspjeha te imaju ključnu ulogu u industriji. Proizvođači bi morali biti pažljivi što se tiče njihovih proizvoda, ciljanih tržišta kao i mnogih kriterija koje pri tome moraju uzeti u obzir. Ovo istraživanje predstavlja novi okvir za posebne situacije koristeći teoriju Yin-Yang ravnoteže (YYB) pri proizvodnji i dizajnu proizvoda s novim perspektivama. Ovaj rad proučava opće situacije u proizvodnji proizvoda za međunarodne proizvođače i industrije. Proi...

  3. Novi okvir za procjenu utjecaja riječnog sedimenta u studijama utjecaja na okoliš

    OpenAIRE

    Lawler, D. M.; Wilkes, M. A.

    2016-01-01

    Voda onečišćena finim sedimentom može biti velika opasnost za zdravlje ljudi i okoliš. No u studijama utjecaja na okoliš i stanovništvo komplicirano je i teško procijeniti utjecaje sedimenta, osobito kad je riječ o kratkim razdobljima. U radu se opisuje novi procesni okvir – procjena utjecaja riječnih sedimenata, Fluvial Sediment Impact Assessment (FSIA) – osmišljen za predviđanje i analizu problema onečišćenja riječnim sedimentima koji potječu od građevinskih projekata. Postavljaju se tri op...

  4. Programiranje u AutoCAD-u (C#)

    OpenAIRE

    Glasinovic, Frane

    2011-01-01

    Programski paket AutoCAD ima veliki broj ugrađenih alata pa biste pomislili da u AutoCAD-u postoje funkcije za sve što vam padne na pamet. To je donekle i istina, ali ponekad ćete se naći u situaciji da ugrađeni alati jednostavni nisu ono što tražite. Nekada ćete poželjeti automatizirati ponavljajući proces ili pristupiti rješavanju problema na način koji više odgovara specifičnim okolnostima. U ovakvim slučajevima znanje iz programiranja biti će više nego dobrodošlo. U samo par linija ...

  5. ARTEFAKTNI DERMATITIS – PSIHIJATRIJSKI UZROCI

    OpenAIRE

    Vurnek Živković, Maja; Šitum, Mirna

    2013-01-01

    Artefaktni dermatitis relativno je česta psihodermatološka bolest kod koje bolesnik oštećuje vlastitu kožu. Promjene na koži mogu biti različitog izgleda i oblika, a vrlo često izgledaju poput atipične rane. Bolesnici uglavnom niječu oštećivanje kože, a direktno suočavanje bolesnika s dijagnozom dovodi do njegovog povlačenja i traženja pomoći kod drugog liječnika. Bolest se javlja u 0,2% do 0,5% dermatoloških bolesnika, a češća je u žena nego u muškaraca i to najviše u kasnoj adolescenciji i ...

  6. Cooling rate effects on the electrical properties of TiO2-based varistor

    International Nuclear Information System (INIS)

    The cooling rate effects on the microstructure development and electrical properties of TiO2 ceramics are studied using transmission electron microscopy (TEM), energy dispersion spectrometer (EDS) and X-ray diffractometer (XRD). Barium and bismuth were exsolved during cooling and reacted with rutile to form secondary phases, Ba2Ti9O20 and Bi2Ti4O11. Therefore, the acceptor concentration of Bi+3 (BiTi') in the rutile grain near the grain boundary areas in furnace-cooled samples were lower than that in quenched samples. As the acceptor concentration decreased, the depletion width and barrier height decreased. Consequently, the quenched samples possessed higher nonlinear exponent (α) values than furnace-cooled samples

  7. Politička romantika u hrvatskoj političkoj kulturi

    OpenAIRE

    Rodin, Davor

    1992-01-01

    Knjiga C. Schmitta "Politička romantika" ishodište je autoru o raspravi o romantici i romantičarima u sferi politike i političkog djelovanja. Autor upozorava na oprečnost i nesumjerljivost političkog djelovanja i umjetničkog prikazivanja političkog djelovanja kroz tri uvida: (1) problemi koji se mogu rješavati samo politički ne mogu se rješavati estetski, religijski ili etnički, (2) političko djelovanje ne može biti romantičarski optuživano kao uzrok etničkih, socijalnih i religijskih sukoba ...

  8. Slovo i slovopis španjolskoga i hrvatskoga jezika

    OpenAIRE

    Jelaska, Zrinka; Musulin, Maša

    2011-01-01

    U ovome će se radu usporediti grafijski sustavi španjolskoga i hrvatskoga jezika kako bi se razjasnile neke terminološke i pojmovne poteškoće s višeznačnicom slovo. Usporedbom dvaju jezika pokazat će se različiti pristupi sličnim ili jednakim pojavama koje se različito opisuju na temelju različitih jezikoslovnih tradicija i mogu jednim dijelom uzrokovati teškoće u pisanju i čitanju s kojima se susreću inojezični učenici. Osim kao istoznačnica grafemu, slovo može biti i bliskoznačnica grafemu ...

  9. Sumarexem í hestum: Tjáning á ofnæmisvökum úr smámýi (Culicoides obsoletus) í skordýrafrumum og hreinsun próteina

    OpenAIRE

    Tinna Björg Úlfarsdóttir 1990

    2014-01-01

    Sumarexem er húðofnæmi af gerð I í hrossum með framleiðslu á IgE. Exemið orsakast af biti smámýs (Culicoides tegundir) en í munnvatnskirtlum flugnanna eru prótein sem verða ofnæmisvakar í sumum hestum. Smámýið lifir ekki á Íslandi og þess vegna þekkist sjúkdómurinn ekki hérlendis. Öll hrossakyn geta fengið exemið en það er sérlega algengt í hestum fæddum á Íslandi sem fluttir eru út. Þetta verkefni er hluti af stærra samstarfsverkefni milli Keldna og Háskólans í Bern í Sviss sem hefur það mar...

  10. VPLIV ZADOVOLJSTVA IN USPEŠNOSTI ZAPOSLENEGA NA KAKOVOST DELOVNEGA ŽIVLJENJA

    OpenAIRE

    Holsedl, Monika

    2014-01-01

    Kakovost življenja je pomembna vrsta razsežnosti, ki se spreminja ves čas in ni obravnavana tako, da bi ostala skozi celotno obdobje nespremenjena. Ljudje smo namreč tisti, ki odločamo o kakovosti svojega življenja, zato so naši cilji in odločitve še toliko bolj pomembni. Vsak posameznik s svojim načinom razmišljanja in s svojo sposobnostjo poskrbi, da bo v življenju srečen in zadovoljen, kar vodi h kakovostnemu življenju. Ker ima vsak pravico biti srečen, si vsak sam postavlja cilje in odloč...

  11. Povijesni razvoj i političko-geografska obilježja granice i pograničja Republike Hrvatske s Republikom Slovenijom na Žumberku i Kupsko-čabranskoj dolini

    OpenAIRE

    Bognar, Helena Ilona; Bognar, Andrija

    2010-01-01

    Iako prirodna osnova ne može biti odlučujući kriterij pri povlačenju granica, povijesni i političko-geografski razvoj istraživanog područja ukazuje da su pri razgraničenju Republike Hrvatske i Republike Slovenije u znatnoj mjeri korištene prirodne međe. Taj zaključak vrijedi i za analizirane sektore koji se vežu za Žumberačku goru i doline rijeke Kupe i Čabranke. Uz prirodne pogodnosti, s obzirom na to da je tu međa povučena na vršnim grebenima gorskog masiva (Žumberačka gora / Gorjanci) i na...

  12. Izazvani na kršćansko svjedočenje

    OpenAIRE

    Körner, Felix

    2008-01-01

    Kako kršćanstvo objasniti muslimanima? Pater Körner, koji živi u Turskoj, zastupa ovu tezu: budući da je kršćanstvo istinska i danas postojeća povijest Isusa Krista, mora biti posvjedočeno kao pripadnost Tijelu Kristovu. Svjedočenje se događa po iskustvu i to na trostruki način: (a) u govoru o osobnom doživljavanju vjere, (b) u prihvaćanju vlastite manjkavosti zbog toga što sam slab svjedok i (c) u odvažnosti da se istinu povijesti o Isusu živi kao javno-službenu vjeroispovijest. Polazeći od ...

  13. AcEST: BP912108 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Tektin-2 OS=Bos taurus GN=TEKT2 PE=2 SV=1 30 6.0 sp|P19260|MSA2_PLAFG Merozoite surface antigen 2, allelic f...QRVATEFAFRKRLREMEKLYSELKWQEKNTLE 288 Query: 182 EVA 174 E+A Sbjct: 289 EIA 291 >sp|P19260|MSA2_PLAFG Merozoit...CTN Galactose-binding-like protein OS=Bacteroides thetaiotaomicron GN=BT_1775 PE=4 SV=1 Length = 570 Score = 33.5 bit...is... 43 0.009 tr|B4PGP5|B4PGP5_DROYA GE21359 OS=Drosophila yakuba GN=GE21359 P... 35 ... SEDEAPRRSR+GEGKK+R Sbjct: 273 NSFRND--ESESEDEAPRRSRHGEGKKKR 299 >tr|B4PGP5|B4PGP5_DROYA GE21359 OS=Drosophi

  14. PERCEPCIJA BOLI U UVJETIMA RAZLIČITE RAZINE DISTRAKCIJE

    OpenAIRE

    Ivanec, Dragutin; MILJAK, Tomislav; FABER, Robert

    2010-01-01

    Cilj istraživanja bio je provjeriti neke postavke o ulozi odvraćanja pažnje od bolnoga podraživanja kao mogućega kognitivno-bihevioralnog postupka smanjenja boli. Pošlo se od pretpostavke da će više distrakcije dovesti do većega analgetskog efekta te da će on biti izraženiji kod slabijega podraživanja. U istraživanju je sudjelovalo 30 sudionika, koji su podijeljeni u dvije skupine. Jedna je skupina bila podraživana slabijim električnim podražajima koji su bili na grani...

  15. Petrićevo razumijevanje astrologije u Deset dijaloga o povijesti

    OpenAIRE

    karasman, Ivana Skuhala

    2012-01-01

    U svojem djelu Deset dijaloga o povijesti, koje je objavljeno 1560. godine, Petrić je obradio i neke astrološke teme. U trećem dijalogu, onom koji je naslovio »Il Contarino, overo che, sia l’historia« (»Contarino ili što je povijest«), tako je iznio poznatu tezu da je pomoću astrologije bila predviđena propast svijeta, prvo poplavom, a zatim požarom. Naime, prema astrološkoj tradiciji, Bog je Adamu prenio tajne astrologije te je on promatrajući nebo predvidio da će Zemlja biti uništena vodom ...

  16. Segmentacija potrošača prema razini ekološke odgovornosti

    OpenAIRE

    Ham, Marija

    2009-01-01

    Ne može se više dovesti u pitanje činjenica da postoji ekološki odgovoran segment potrošača na tržištu. Međutim, ulaskom sve većeg broja ponuđača upravo na to zeleno tržište, više nije dovoljno samo biti svjestan te činjenice, nego su potrebne i složene strategije segmentacije, ciljanja i pozicioniranja. U ovom radu nastojalo se pružiti teoretsku podlogu za razumijevanje ključnih pojmova vezanih uz segment zelenih potrošača, a prikupljanjem sekundarnih podataka iz dostupne literature i pretho...

  17. PRIPOVIJEDANJE KAO METODA POUČAVANJA ENGLESKOG KAO STRANOG JEZIKA

    OpenAIRE

    Dujmović, Mauro

    2006-01-01

    Kao jedna od najstarijih ljudskih vještina koja potječe još iz prapovijesti, pripovijedanje je vještina koja se služi pamćenjem a ne čitanjem. To umijeće uključuje dva ključna elementa – odabir i predaju. Veliki je broj nastavnika engleskog jezika zainteresiran za ovu vještinu kao metodu poučavanja stranog jezika. Uspješan pripovjedač odabire prikladne priče i mora biti vješt izvođač jer je izvedba ključna i od pripovjedača zahtijeva i pripremu i probu. Pripovijedanje je originalan način pouč...

  18. Primjena modela izračuna troškova u vrednovanju šuma UŠP Požega

    OpenAIRE

    Posavec, Stjepan; Zelić, Juraj; Fliszar, Ivica; Beljan, Karlo

    2011-01-01

    U neposrednoj suradnji s Razvojnom službom i drugim stručnjacima Hrvatskih šuma d.o.o. Zagreb te Šumarskoga fakulteta Sveučilišta u Zagrebu dogovoreno je istraživanje problema utvrđivanja vrijednosti šumskih sastojina i određivanja cijene drva na panju za glavne vrste drveća. Problemi gospodarenja šumom uključuju mnogo različitih varijabli. One mogu biti biološke kao što su rast i prirast te vrsta tla, ekonomske kao što su cijena drva i trošak rada i socijalne kao što su ekološki zakoni. U ra...

  19. PRIMERJAVA IZRAČUNA SENČENJA SONČNE ELEKTRARNE Z MERITVAMI

    OpenAIRE

    Železnik, Dejan

    2012-01-01

    Izkoriščanje sonca je v zadnjem času vedno bolj pogosto. Sonce, večni jedrski reaktor, je praktično neizčrpen vir obnovljive energije. Čist in donosen vir, ki nam lahko zagotovi pomemben del energije za naše potrebe. Energija, ki jo sonce seva na zemljo, je 15.000 krat večja od energije, kot jo porabi človek. To je energija, ki se obnavlja, ne onesnažuje okolja in je hkrati brezplačna. Zato, mora biti cilj izkoriščati to energijo v največjem možnem obsegu. Da bi sonce lahko čim boljše izkori...

  20. KLASIČNI NAČINI PRERADE RIBE

    OpenAIRE

    Kalember, Đurica; Jelen, Tatjana

    1998-01-01

    Prodaja ribe čini veliku poteskoću u opskrbi ribom današnjega stanovništva, iako je ona vrlo vrijedna prehrambena namirnica. Klasična ponuda svježe ribe sve manje ima utjecaja na ionako malu njezinu potrošnju. Stoga se treba podsjetiti na klasične načine prerade ribe, koji, iako već gotovo zaboravljeni, mogu bitno povećati izbor ribe i mjesta njezine prodaje. Nakon čišćenja i rezanja ribe, koji su primaran postupak u njenoj preradi, na red dolazi soljenje, nakon čega slana riba može biti zavr...

  1. Istraživanje učinka alkalne hidrolize otpada životinjskog porijekla kao predtretmana proizvodnji bioplina

    OpenAIRE

    Kalambura, Sanja; Čikić, Ante; DUNĐER, Marko

    2012-01-01

    Otpad je jedan od ključnih problema moderne civilizacije i predstavlja rezultat našeg načina života. Nakon pojave goveđe spongiformne encefalopatije, te zabrane hranjenja životinja mesnim koštanim brašnom razvijaju se nove tehnologije prerade životinjskog otpada i njegova upotreba u energetske svrhe. Neki dijelovi ovog otpada, kao mozak i leđna moždina, visoko su rizične tvari i mogu biti zaraženi prionima, te je njihovo zbrinjavanje moguće isključivo u strogo kontroliranim uvjetima. Pomoću o...

  2. Improved solar-driven photocatalytic performance of BiOI decorated TiO2 benefiting from the separation properties of photo-induced charge carriers

    Science.gov (United States)

    Li, Jianzhang; Zhong, Junbo; Si, Yujun; Huang, Shengtian; Dou, Lin; Li, Minjiao; Liu, Yinping; Ding, Jie

    2016-02-01

    In this work, BiOI decorated TiO2 photocatalysts were prepared in-situ by a facile hydrothermal method and characterized by X-ray diffraction (XRD), UV/Vis diffuse reflectance spectroscopy, scanning electron microscopy (SEM), high-resolution transmission electron microscopy (HRTEM), X-ray photoelectron spectroscopy (XPS) and surface photovoltage (SPV) spectroscopy. The reactive radicals during the photocatalytic reaction were detected by scavenger experiments. BiOI/TiO2 composites exhibit higher performance than the pure TiO2 towards photocatalytic decolorization of methyl orange (MO) aqueous solution, when the molar ratio of Bi/Ti is 2%, the sample has the highest photocatalytic activity. The enhanced photocatalytic performance of BiOI/TiO2 could be ascribed to the separation properties of photo-induced charge carriers and strong interaction between BiOI and TiO2. Based on the observations, a Z-scheme charge separation mechanism was proposed.

  3. Etike „trećeg lica“ i moralne vrednote

    OpenAIRE

    Tomašević, Luka

    2015-01-01

    Čovjek je biće koje se usmjerava na druge i živi u zajednici. On tako stvara moral i moralne odnose. Kad se ti odnosi normiraju, kad se u njih unose pravila ponašanja, onda je riječ o etici. Stoga je etika i shvaćena kao normativna znanost o ljudskim činima, tj. znanost koja ljudima omogućuje spoznaju prijelaza od onoga što jesu na ono što mogu biti. Etika se od svojih početaka (Aristotel) zasnivala na telosu (usmjerenost) i poštovanju nepisanih te urođenih zakona. Krš...

  4. KONGENITALNA CISTIČNA ADENOMATOIDNA MALFORMACIJA

    OpenAIRE

    VLADAREANU, Radu; Pelinescu-Onciul, Dimitrie; Zvânca, Mona; Mihalescu, Doina

    2007-01-01

    Cistična adenomatoidna malformacija pluća (CACM) je rijetka bolest s pojavnošću od 1/25 000 do 1/35 000 trudnoća, razvojna pogrješka koja nastaje preraštanjem terminalnih respiratornih mjehurića. Prenatalna dijagnoza se zasniva na ultrazvučnom prikazu hiperehogenog tumora pluća, koji može biti mikrocističan i makrocističan. Pri bolesti može nastati pomak medijastinuma, fetalni hidrops ili polihidramnios. Ishod je loš u bilateralnim slučajevima, u onima s hipolazijom pluća i fetalnim hidropsom...

  5. Tribološka svojstva pamučnih pređa: faktor površinskog trenja

    OpenAIRE

    Salopek Čubrić, Ivana; Skenderi, Zenun

    2012-01-01

    Trenje koje nastaje prolazom pređe kroz različite metalne elemente tijekom proizvodnje plošnih proizvoda, ovisno je o nizu parametara koji mogu biti vezani uz karakteristike, kao što su dlakavost pređe, broj uvoja, oblik poprečnog presjeka, posebnosti u strukturi pređe i površinska obrada pređe. U radu je ispitano površinsko trenje parafiniranih pamučnih pređa ispredenih od turskog, sudanskog i egipatskog pamuka. Pređe su izrađene u četiri finoće (14, 17, 20 i 25 tex) te s četiri različita po...

  6. ANTE GLAVIČIĆ, ČUVAR I PROMICATELJ SENJSKE POVIJESNE I KULTURNE BAŠTINE – DRAGI SENJANIN I PRIJATELJ

    OpenAIRE

    BEKAVAC LOKMER, FILA; LOKMER, JURAJ

    2013-01-01

    U nizu velikana senjske povijesti i čuvara hrvatske baštine ističe se osebujni lik Senjanina Ante Glavičića, kustosa i dugogodišnjega ravnatelja Gradskoga muzeja Senj. Živeći i radeći u sredini iz koje je ponikao i u kojoj je teško biti "prorok u svome zavičaju" učinio je više nego mnogi na razini Hrvatske, koji su imali puno bolje uvjete, političke podrške i sve druge okolnosti. Posvetivši svoj cjelokupni privatni i javni život senjskoj kulturno-povijesnoj, a time i hrvatskoj baštini djelova...

  7. Key Determinants Influencing the Health Literacy of Pregnant Women in the Czech Republic / Ključne Determinante, Ki Vplivajo na Zdravstveno Pismenost Nosečnic na Češkem

    Directory of Open Access Journals (Sweden)

    Wilhelmova Radka

    2015-03-01

    Full Text Available Uvod. Zdravstvena pismenost je ključna determinanta zdravja žensk in otrok, ki ima ogromne posledice tudi na zdravje družbe. Dokazi iz epidemioloških, kliničnih in eksperimentalnih študij kažejo, da nezdravi življenjski slogi ter tvegano vedenje staršev pred zanositvijo in med nosečnostjo vplivajo na etiologijo različnih zdravstvenih okvar. Zmanjševanje dejavnikov tveganja, skrb za fizično dobro počutje, spremljanje fizioloških markerjev ter priprava na porod, dojenje in nego novorojenčka bi morali biti glavna odgovornost staršev v predporodnem obdobju.

  8. Raspodjela ekoloških niša između sedam simpatričkih lacertidnih gušterica u Peloponeškom gorju

    OpenAIRE

    Mayer, Werner; Beyerlein, Petra

    1999-01-01

    Svih sedam lacertidnih vrsta zabilježenih za Peloponez mogu se naći na vrlo malom području u Arkadijskom gorju na poluotoku Peloponezu. Dosad je na području Sredozemlja poznat samo jedan primjer takve jedinstvene raznolikosti na tako malom prostoru. Takva gustoća zahtijeva zauzeće različitih ograničenih ekoloških i etoloških niša sa strane svih sedam vrsta i zbog toga staništa moraju biti raznolika. U radu se raspravlja o toj podijeljenosti niša, kao i o ekološkim zahtjevima i etološkim r...

  9. Plants diversity and its potential in Buton Utara Game Reserve, South-East Sulawesi

    Directory of Open Access Journals (Sweden)

    TAHAN UJI

    2005-07-01

    Full Text Available Study on richness diversity and potential species of plant in two locations in the Buton Utara Game Reserve had been conducted. One hundred and seventy nine species of plant are collected from this area, and 137 species of them are reported as the potential of species. The largest group is timber (76 species and the other is medicinal plants (41 species. Other data can be gathered as follows 23 species of fruits, 22 species of ornamental plants, 12 species of vegetable, 7 species of fibre plants and 5 species of poisonous plants. The results of study indicated that biti/owala (Vitex coffasus, upi (Intsia palembanica, gufi (Intsia bijuga, nato (Palaquium bataanense, kuru (Elmerillia ovalis, keu uti (Drypetes sibuyanensis, rumbai (Pterospermum celebicum, kondongia (Cinnamomum parthenoxylon, and dongi (Dillenia serrata were very important as commercial timbers.

  10. STOHASTIČKI MODEL PROGNOZE POTRAŽNJE REZERVNIH DELOVA

    OpenAIRE

    Milojević S. Ivan; Guberinić V. Rade

    2012-01-01

    U ovom radu dat je stohastički model prognoze potražnje rezervnih delova. Model koji je dat izabran je po sledećim kriterijumima: da može biti primenjen, prema nameni prognoze potražnje rezervnih delova i da se ne nalazi u osnovnoj udžbeničkoj literaturi. Da bi se mogli izdvojiti, doraditi i razviti, novi modeli i metode prognoze potražnje rezervnih delova, nužno je sagledati sve ono što na neki način utiče na potražnju. Izdvojeni su uticajni faktori na potražnju rezervnih d...

  11. Proces eliminacije zraka i čvrstih čestica u hidrauličkom rezervoaru

    OpenAIRE

    Tič, Vito; Lovrec, Darko

    2013-01-01

    Kontaminacija hidrauličke tekućine široko se definira kao bilo koja supstanca koja utiče na pravilno funkcioniranje hidrauličkog sistema. Hidraulička tekućina može biti kontaminirana zrakom, čvrstim česticama, vodom, i stranim tekućinama. Kontaminacija može uzrokovati brojne probleme uključujući oštećenje komponente, neprihvatljivu buku, lošu dinamiku komponenti i tešku degradaciju tekućine. Rad je usredotočen na dva glavna kontaminanta koja bi trebalo uzeti u obzir prilikom dizajniranja hidr...

  12. RODNE RAZLIKE I PREDIKTORI PARTNERSKOG NASILJA U MLADENAČKIM VEZAMA

    OpenAIRE

    AJDUKOVIĆ, Dean; Löw, Ajana; Sušac, Nika

    2011-01-01

    U cilju utvrđivanja raširenosti i čestine nasilja u romantičnim vezama adolescenata i mogućnosti njegovog predviđanja pomoću varijabli koje teoretski mogu biti povezane s nasilnim ponašanjima, ispitano je 623 učenika trećih razreda iz 14 srednjih škola u različitim dijelovima Hrvatske. U uzorku prosječne dobi 16,8 godina zastupljeno je 55,7% mladića. Instrument sadrži pitanja o sociodemografskim podacima i iskustvu veze u posljednjih 6 mjeseci te sedam upitnika: Skalu pogrešnih uvjerenja o kv...

  13. MOŽE LI BIOMASA POKRENUTI ENERGIJSKU TRANZICIJU U HRVATSKOJ I JUGOISTOČNOJ EUROPI?

    OpenAIRE

    Domac, Julije; Risović, Stjepan; Šegon, Velimir; Pentek, Tibor; Šafran, Branimir; Papa, Ivica

    2015-01-01

    Šumska biomasa predstavlja važan izvor energije, čijem bi se korištenju u budućnosti trebalo posvetiti znatno više pozornosti. Biomasa u svojim tradicionalnim oblicima je i dalje vrlo važan izvor energije u većini zemalje Jugoistočne Europe, te će u doglednoj budućnosti i dalje biti tako. Međutim, sve se više koristi ne samo za proizvodnju toplinske energije, već za proizvodnju električne i rashladne energije, i to se smatra kao važan dio energijske tranzicije koja je obećavajući model ...

  14. Izvršenje presuda u sporovima o zakonitosti ; proučavanje praktičnog slučaja

    Directory of Open Access Journals (Sweden)

    Jean-Michel Lemoyne de Forges

    2015-04-01

    Full Text Available Premda je to jedna od temeljnih značajka pravne države, stvarno i potpuno izvršenje upravnih presuda, kojima se poništava pojedine upravne akte, nije uvijek bilo zajamčeno u Francuskoj. Francuski je zakonodavac zbog toga bio primoran izraditi više sustava koje je stavio na raspolaganje strankama (tužiteljima za postizanje tog izvršenja i prisiliti javnu upravu da izvrši te presude, štoviše da sankcionira fizičke osobe koje sprječavaju to izvršenje. Ovi će sustavi biti predmetom ispitivanja kroz dva konkretna slučaja iz francuske upravnosudske prakse, tj. kroz jednu presudu upravnog suda i kroz jednu odluku žalbenog upravnog suda.

  15. MOŽEMO LI SPRIJEČITI ČEDOMORSTVO?

    OpenAIRE

    Katalinić, Sanja; Frković, Aleksandra

    2006-01-01

    Čedomorstvo (aktivno i pasivno) se definira kao ubojstvo novorođenčeta od strane majke, unutar 24 sata od rođenja. Dokazano je da je čedomorstvo nastalo kao rezultat međusobne interakcije socijalnih, kulturoloških i individualnih karakteristika majki. Radi se obično o adoelscenticama i mladim ženama, ali čedomorke mogu biti i žene u srednjim godinama života. Negiranje trudnoće je važan čimbenik rizika čedomorstva. Može li se čedomorstvo spriječiti? U potpunosti ne, no s obzirom da su adolesce...

  16. Samoprocjena i procjena ponašanja učenika s teškoćama u redovnoj osnovnoj školi

    OpenAIRE

    Igrić, Ljiljana; Wagner Jakab, Ana; Cvitković, Daniela

    2012-01-01

    Položaj djece s teškoćama u Hrvatskoj još uvijek je nepovoljan. Iako imaju pravo na individualiziran pristup, često nemaju prilike to i ostvariti. U skladu sa Bronfenbrenerovom teorijom i suvremenim pristupom prema teškoćama čini se da u cilju poboljšanja dobrobiti ove djece naglasak treba biti na sagledavanju čimbenika okoline, škole, vršnjaka, obitelji, koji utječu na učenika, a ne toliko na samoj teškoći koju dijete ima. Ovim se istraživanjem htjelo utvrditi ima li činjenica da dijete ima ...

  17. Učinkovitost metode brain gym u radu s djecom sa specifičnim teškoćama u učenju

    OpenAIRE

    Zrilić, Smiljana; Marasović, Deniza; Perović, Anamarija

    2009-01-01

    U radu je predstavljena metoda Brain Gym te učinkovitost njezine primjene u radu s djecom sa specifi čnim teškoćama u učenju. Premda se učenici sa specifi čnim teškoćama u učenju često tretiraju kao neuspješni, praksa je pokazala da oni u pravilu nisu neuspješni u izvršavanju svih zadataka, u snalaženju u svim situacijama, da nisu neuspješni uvijek i sa svim ljudima. Okolina mora biti motivirajuća, na što najviše mogu utjecati učitelji, primjenjivanjem specifi čnih nastavnih metoda sa svrhom ...

  18. Vjeronauk u školi. Predmet koji odgaja i obrazuje

    OpenAIRE

    Paloš, Rudi

    2011-01-01

    Članak sadrži razmišljanja u povodu dvadesete obljetnice ponovnog uvođenja vjeronauka u hrvatske škole, s posebnim osvrtom na srednjoškolski vjeronauk. U prvom je dijelu nekoliko misli nastalih prigodom osme obljetnice, a u drugome je riječ o razmišljanjima nakon dva desetljeća. Riječi o počecima ujedno su i prisjećanje na sve što je trebalo učiniti: odrediti kakav će to biti predmet, tko će ga predavati, kako će se pripremiti vjeroučitelji. Ujedno je valjalo pripremiti i nove planove, progra...

  19. Površina ili površnost?

    OpenAIRE

    Marasović, Špiro

    2004-01-01

    Budući da se u posljednje vrijeme vodila velika rasprava o ispuštanju izričitoga spominjanja Božjega imena, odnosno kršćanstva u preambuli Ustava EU-a, autor u ovom članku istražuje o kojem i kakvom je to kršćanstvu riječ kad se govori o njemu kao jednom od konstitutivnih dijelova europske kulture i civilizacije, odnosno, pita se kakvo bi kršćanstvo trebalo biti da bi i bilo autentično i unaprijed društveno relevantno. Da bi došao do zadovoljavajućega odgovora, on članak dijeli u tri dijela. ...

  20. Križevačka tvrđava i utvrde Križevačke kapetanije

    OpenAIRE

    Kruhek, Milan

    2001-01-01

    Zadaća je ovog rada odrediti i povijesno značenje i graditeljsku vrijednost križevačkih utvrda i utvrda Križevačke kapetanije. U tom traganju za povijesnom slikom i obrambenim značenjem križevačkih utvrda od najveće će nam koristi biti crteži i opisi krajiških vojnih inženjera i stratega, tim više što su sačuvani graditeljski ostaci i onih najvećih utvrda toliko neznatni, da bi samo na temelju takvih ostataka bilo nemoguće rekonstruirati pravu predodžbu njihova povijesnog izgleda, procijen...

  1. Stečajni plan kao treći model za športske klubove

    OpenAIRE

    Vuković, Ante

    2011-01-01

    Stečaj ne mora značiti i likvidaciju športskog kluba, nego može biti novi početak putem stečajnog plana (sanacijski plan). Stečajni zakon ne postavlja ograničenja kako će se stečajni dužnik i stečajni vjerovnici dogovoriti o nastavku obavljanja djelatnosti. Zloupotreba prava je zabranjena. Korisno je navesti i da zastupnici po zakonu dužnika (do otvaranja stečaja) mogu trgovačkom sudu zajedno s prijedlogom za stečaj podnijeti i stečajni plan. Otvaranjem stečaja pravo na podnošenje plana im...

  2. Što novi crkveni pokreti očekuju od duhovnog vođe

    OpenAIRE

    Stojić, Miljenko

    1997-01-01

    Novi crkveni pokreti danas su znak djelovanja Duha Svetoga u svojoj Crkvi. Budući da ih čine grešni ljudi u opasnosti su poći krivim pravcima. Zbog toga imaju potrebu za dobrim duhovnim vođama. Glavna svojstva jednoga takvoga duhovnog vođe trebala bi biti: veliko iskustvo vjere, vjera svjedočena životom, molitva, otvore­ nost proročkim nadahnućima. On poučava, tješi i prosuđuje. Uči druge kako živjeti u poslušnosti Božjoj riječi i kako u isto vrijeme živjeti u potpu...

  3. The diagnosis and management of snakebite in dogs - a southern African perspective : review article

    Directory of Open Access Journals (Sweden)

    A.L. Leisewitz

    2004-06-01

    Full Text Available Cases of snakebite envenomation are frequently presented to veterinary practitioners in southernAfrica. Despite this, no published guidelines exist onhowthis medical emergency should be managed. Southern African snake venoms can be classified into 3 main types based on the main mechanism of venom action and clinical presentation. A polyvalent antivenom is manufactured in South Africa and contains antibodies against the most important southern African snake venoms. The cytotoxic venoms are represented mainly by the puff-adder (Bitis arietans, Mozambique spitting cobra (Naja mossabica, black-necked spitting cobra (Naja nigricollis (in the Western Cape and Namibia and the stiletto snake (Atractaspis bibronii. These venoms may cause dramatic local swelling, high morbidity and low mortality and infrequently require the use of antivenom for survival (the only cytotoxic venoms used to prepare the antivenom are the puff-adder and Mozambique spitting cobra. The neurotoxic venoms (represented chiefly by the non-spitting cobras and mambas cause high mortality due to rapid onset of paresis and require antivenom and mechanical ventilatory support which is life-saving. The boomslang (Dispholidus typus and the vine snake (coagulopathic venom rarely bite humans but dogs may be bitten more frequently. These venoms cause a consumption coagulopathy and successful treatment of boomslang bites requires the use of snake species-specific monovalent antivenom. There is no antivenom available for treating vine snake (Thelotornis capensis, berg adder (Bitis atropos, night adder (Causus spp., stiletto snake and other lesser adder bites. There are some important differences between the way snakebites are managed in humans and dogs.

  4. Species-specific responses of Late Quaternary megafauna to climate and humans

    DEFF Research Database (Denmark)

    Lorenzen, Eline D; Nogués-Bravo, David; Orlando, Ludovic;

    2011-01-01

    Despite decades of research, the roles of climate and humans in driving the dramatic extinctions of large-bodied mammals during the Late Quaternary period remain contentious. Here we use ancient DNA, species distribution models and the human fossil record to elucidate how climate and humans shaped...... human encroachment. Although climate change alone can explain the extinction of some species, such as Eurasian musk ox and woolly rhinoceros, a combination of climatic and anthropogenic effects appears to be responsible for the extinction of others, including Eurasian steppe bison and wild horse. We...... find no genetic signature or any distinctive range dynamics distinguishing extinct from surviving species, emphasizing the challenges associated with predicting future responses of extant mammals to climate and human-mediated habitat change....

  5. 3D numerical simulation analysis of passive drag near free surface in swimming

    Science.gov (United States)

    Zhan, Jie-min; Li, Tian-zeng; Chen, Xue-bin; Li, Yok-sheung; Wai, Wing-hong Onyx

    2015-04-01

    The aim of this work is to build a 3D numerical model to study the characteristics of passive drag on competitive swimmers taking into account the impact of the free surface. This model solves the 3D incompressible Navier-Stokes equations using RNG k- ɛ turbulence closure. The volume of fluid (VOF) method is used to locate the free surface. The 3D virtual model is created by Computer Aided Industrial Design (CAID) software, Rhinoceros. Firstly, a specific posture of swimming is studied. The simulation results are in good agreement with the data from mannequin towing experiments. The effects of a swimmer's arms and legs positions on swimming performance are then studied. Finally, it is demonstrated that the present method is capable of simulating gliding near the free surface.

  6. Hydrodynamic body shape analysis and their impact on swimming performance.

    Science.gov (United States)

    Li, Tian-Zeng; Zhan, Jie-Min

    2015-01-01

    This study presents the hydrodynamic characteristics of different adult male swimmer's body shape using computational fluid dynamics method. This simulation strategy is carried out by CFD fluent code with solving the 3D incompressible Navier-Stokes equations using the RNG k-ε turbulence closure. The water free surface is captured by the volume of fluid (VOF) method. A set of full body models, which is based on the anthropometrical characteristics of the most common male swimmers, is created by Computer Aided Industrial Design (CAID) software, Rhinoceros. The analysis of CFD results revealed that swimmer's body shape has a noticeable effect on the hydrodynamics performances. This explains why male swimmer with an inverted triangle body shape has good hydrodynamic characteristics for competitive swimming. PMID:26898107

  7. Design of parametric software tools

    DEFF Research Database (Denmark)

    Sabra, Jakob Borrits; Mullins, Michael

    2011-01-01

    The studies investigate the field of evidence-based design used in architectural design practice and propose a method using 2D/3D CAD applications to: 1) enhance integration of evidence-based design knowledge in architectural design phases with a focus on lighting and interior design and 2) assess...... fulfilment of evidence-based design criterion regarding light distribution and location in relation to patient safety in architectural health care design proposals. The study uses 2D/3D CAD modelling software Rhinoceros 3D with plug-in Grasshopper to create parametric tool prototypes to exemplify the...... operations and functions of the design method. To evaluate the prototype potentials, surveys with architectural and healthcare design companies are conducted. Evaluation is done by the administration of questionnaires being part of the development of the tools. The results show that architects, designers and...

  8. Investigations of astrophysically interesting nuclear reactions by the use of gas target techniques

    International Nuclear Information System (INIS)

    A brief review of the common properties of windowless and recirculating gas targets is presented. As example the Stuttgart gas target facility Rhinoceros in the extended and in the supersonic jet mode with its properties and techniques is explained, also with respect to gas purification techniques. Furthermore several typical experiments from the field of nuclear astrophysics with characteristic results are described (D(α,γ)6Li, 15N(α,γ)19F, 16O(p,γ)17F, 16O(α,γ)20Ne, 20Ne(α,γ)24Mg, 21Ne(α,n)24Mg, 18O(α,n)21Ne, 17O(α,n)20Ne). In several cases the experimental sensitivity could be raised by up to a factor of 106. (orig.)

  9. Nudivirus Genomics: Diversity and Classification

    Institute of Scientific and Technical Information of China (English)

    Yong-jie Wang; John P. Burand; Johannes A. Jehle

    2007-01-01

    Nudiviruses represent a diverse group of arthropod specific, rod-shaped and dsDNA viruses. Due to similarities in pathology and morphology to members of the family Baculoviridae, they have been previously classified as the so-called "non-occluded" baculoviruses. However, presently they are taxonomically orphaned and are not assigned to any virus family because of the lack of genetic relatedness to Baculoviridae,. Here, we report on recent progress in the genomic analysis of Heliothis zea nudivirus 1 (HzNV-1), Oryctes rhinoceros nudivirus (OrNV), Gryllus bimaculatus nudivirus (GbNV) and Heliotis zea nudivirus 2 (HzNV-2). Gene content comparison and phylogenetic analyses indicated that the viruses share 15 core genes with baculoviruses and form a monophyletic sister group to them. Consequences of the genetic relationship are discussed for the classification of nudiviruses.

  10. Woolly rhino discovery in the lower Kolyma River

    Science.gov (United States)

    Boeskorov, Gennady G.; Lazarev, Peter A.; Sher, Andrei V.; Davydov, Sergei P.; Bakulina, Nadezhda T.; Shchelchkova, Marina V.; Binladen, Jonas; Willerslev, Eske; Buigues, Bernard; Tikhonov, Alexey N.

    2011-08-01

    A nearly complete frozen mummy of a woolly rhinoceros ( Coelodonta antiquitatis Blum., 1799) was discovered in a gold mine on the lower reaches of the Kolyma River, north-eastern Siberia. This is the first find of the whole body of woolly rhino in permafrost. A large part of the mummified body was preserved, including the left part of the body, covered by skin, including skin of the head and ear, fore and hind legs. The skull with 2 horns and the lower jaw were also preserved. Most of the internal organs were lost, except the intestines, stomach, and their contents. A rib fragment from this individual was dated by AMS-radiocarbon method to 39,140 ± 390 years BP (OxA-18755). Spore and pollen analyses of the stomach contents indicate that grasses and sagebrushes formed the main part of the diet of C. antiquitatis in this region of Arctic Siberia.

  11. Piroplasm parasites of white rhinoceroses (Ceratotherium simum in the Kruger National Park, and their relation to anaemia

    Directory of Open Access Journals (Sweden)

    D. Govender

    2011-04-01

    Full Text Available As part of a larger survey to map the geographical distribution of Babesia and Theileria parasites in the southern African rhinoceros population, white rhinoceroses were sampled during routine immobilisations in the Kruger National Park. Polymerase chain reaction (PCR and reverse line blot (RLB hybridisation assays were used to screen for the presence of piroplasms and complete blood counts were used to assess associated changes in clinical parameters. Of the 195 rhinoceroses sampled, 71 (36.4 % tested positive for the presence of Theileria bicornis, with no significant change in the haematological parameters measured, while 18 (9.2 % tested positive for Theileria equi. None of the rhinoceroses sampled tested positive for Babesia bicornis, a parasite associated with mortalities in black rhinoceroses.

  12. Investigations of astrophysically interesting nuclear reactions by the use of gas target techniques

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, J.W. [Inst. fuer Strahlenphysik, Univ. Stuttgart, Stuttgart (Germany)

    1998-06-01

    A brief review of the common properties of windowless and recirculating gas targets is presented. As example the Stuttgart gas target facility Rhinoceros in the extended and in the supersonic jet mode with its properties and techniques is explained, also with respect to gas purification techniques. Furthermore several typical experiments from the field of nuclear astrophysics with characteristic results are described (D({alpha},{gamma}){sup 6}Li, {sup 15}N({alpha},{gamma}){sup 19}F, {sup 16}O(p,{gamma}){sup 17}F, {sup 16}O({alpha},{gamma}){sup 20}Ne, {sup 20}Ne({alpha},{gamma}){sup 24}Mg, {sup 21}Ne({alpha},n){sup 24}Mg, {sup 18}O({alpha},n){sup 21}Ne, {sup 17}O({alpha},n){sup 20}Ne). In several cases the experimental sensitivity could be raised by up to a factor of 10{sup 6}. (orig.)

  13. A simple framework for integrated design of complex architectural forms

    CERN Document Server

    Svoboda, Ladislav; Zeman, Jan; Kurilla, Lukáš

    2012-01-01

    This paper presents preliminary results of a newly developed methodology and a software tool for parametric design of complex architectural objects, so called digital or algorithmic forms. In order to provide a maximally flexible solution, the proposed design philosophy yields two open source utilities Donkey and MIDAS written in Grashopper algorithm editor and C++, respectively, that are to be linked with a scripting-based architectural modellers Rhinoceros(C), AutoCAD(C) and the open source Finite Element solver OOFEM. The emphasis is on the mechanical response of designed objects in order to provide architects with a consistent learning framework and wise insight into structural behaviour of their artworks. As demonstrated on several case studies, the combination of the utilities may handle objects of considerable structural complexity and boosts the algorithmic architectural design in terms of accelerating the process of finding procedural design parameters from orders of weeks to days or hours.

  14. Dicty_cDB: Contig-U13341-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wlesi strain H chro... 112 6e-28 AE014296_2729( AE014296 |pid:none) Drosophila melanogaster chromos...K1) RecName: Full=mRNA-decapping enzyme subunit 2; ... 117 2e-25 AE014296_2730( AE014296 |pid:none) Drosophila melanogaster chromos...e) Oryctes rhinoceros virus isolate ... 68 1e-10 FN357300_1( FN357300 |pid:none) Schistosoma mansoni geno....2 CP000910_1119( CP000910 |pid:none) Renibacterium salmoninarum ATCC... 35 1.2 CP001091_1984( CP001091 |pid:none) Actino... EC=3.6... 35 1.2 CP000687_1884( CP000687 |pid:none) Actinobacillus pleuropneumoniae... 35 1.2 CP001147_219( CP001147 |pid:non

  15. The Sarmatian vertebrates from Draxeni (Moldavian Platform

    Directory of Open Access Journals (Sweden)

    Vlad Codrea

    2007-10-01

    Full Text Available Middle Miocene (Sarmatian vertebrates had been unearthed at Draxeni (Vaslui district. The site is located in the northern area of the Moldavian Platform. There, the sand belonging to Şcheia Formation (Bessarabian is mined in a restricted open pit. This sand is related to a littoral environment (shoreface and foreshore. Some of its levels are rich in mollusc debris. Vertebrate remains, carried into the Bessarabian brackish basin are present too, but in smaller amounts. Mastodon, rhinoceros, hipparionine, tortoise remains had been collected there over several years. All teeth and bones are isolated and bear the marks of intensive rolling by waves and currents. This assemblage is typical for the top of Bessarabian in Moldavia, i.e. soon after the first hipparionine invasion in this part of the Europe. This assemblage can be related to the base of MN 9 unit.

  16. Relationship of polychlorinated dibenzo-p-dioxin and polychlorinated dibenzofuran levels to stable-nitrogen isotope abundance in marine birds and mammals in coastal California

    Energy Technology Data Exchange (ETDEWEB)

    Jarman, W.M. [Univ. of California, Santa Cruz, CA (United States). Inst. of Marine Sciences; Sydeman, W.J. [International Biological Research, Stinson Beach, CA (United States). Point Reyes Bird Observatory; Hobson, K.A. [Canadian Wildlife Service, Saskatoon, Saskatchewan (Canada). Prairie and Northern Wildlife Research Centre; Bergqvist, P.A. [Univ. of Umeaa (Sweden). Inst. of Environmental Chemistry

    1997-05-01

    Levels of polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) were determined in common murre (Uria aalge), Brandt`s cormorant (Phalacrocorax penicillatus), rhinoceros auklet (Cerorhinca monocerata), and pigeon guillemot (Cepphus columba) eggs, and Steller sea lion (Eumetopias jubatus) blubber collected from the Gulf of the Farallones National Marine Sanctuary in 1993. In addition, the samples were analyzed for stable-nitrogen isotopes ({delta}{sup 15}N). Of the PCDDs and PCDFs, the 2,3,7,8-TCDD (TCDD) and 2,3,7,8-TCDF (TCDF) congeners were the most prominent in the birds. The levels of TCDD in the eggs ranged from 0.2 to 6.6 ng/wet kg in the pigeon guillemot and Brandt`s cormorant, respectively. The TCDF ranged from 0.30 to 2.25 ng/kg in the pigeon guillemot and Brandt`s cormorant eggs, respectively. Other prominent PCDD and PCDF congeners detected in all bird species were 1,2,3,6,7,8-HxCDD, 2,3,4,7,8-PeCDF, 1,2,3,7,8-PeCDD and 1,2,3,4,6,7,8-HpCDD. In the Steller sea lion the most prominent congeners were 1,2,3,7,8-PeCDD at 3.2 ng/kg, 2,3,7,8-TCDD at 2.9 ng/kg, OCDF at 2.2 ng/kg, 1,2,3,6,7,8-HxCDD at 1.92 ng/kg, and 1,2,3,4,7,8-HxCDF at 1.3 ng/kg. Stable-nitrogen values ranged from 16.9% in the pigeon guillemot and rhinoceros auklet to 19.8% in the Steller sea lion.

  17. Status Identification and Prediction of Kaziranga-Karbi Anglong Wildlife Corridor of Assam, India, Using Geospatial Technology

    Directory of Open Access Journals (Sweden)

    Sharma Bhavna

    2014-11-01

    Full Text Available In the present study, an attempt has been made to discover the impacts of various developmental activities on the Kaziranga-Karbi Anglong wildlife corridor of Assam, India, using geospatial technology; as well as to predict the future status of the wildlife corridor by using the Cellular Automata Markov Model. Due to various anthropogenic activities the condition of the natural corridor has deteriorated, and in recent years many wild animals have been killed by road traffic accidents; in particular, greater one-horned (Indian rhinoceros (Rhinoceros unicornis are killed indiscriminately by the poachers, having been deviated from their regular routes. Changes were evident during the two decades between 1990 and 2010, when a large number of dense forest areas were converted to open forest, combined with losses of areas of scrub and marshy land. The area under agriculture and plantation crop increased along with the grassland during the decades. It has been found that the forests in Kaziranga-Karbi Anglong corridor are fragmented, and the area within the corridor is shrinking. There is considerable increase in patchiness, proportion of edge, and a perforated reduction of core areas within the corridor. The predicted land use/cover map of Kaziranga-Karbi Anglong corridor shows expansion of agricultural land, as well as plantation areas. It is estimated that only 25.66 percent of the present dense forest and 20.72 percent of open forest will remain by 2030, while areas under agriculture and plantation will increase by 33.91 and 5.33 percent, respectively.

  18. The larger mammal fauna from the Lower Paleolithic Schöningen Spear site and its contribution to hominin subsistence.

    Science.gov (United States)

    Van Kolfschoten, Thijs; Buhrs, Elfi; Verheijen, Ivo

    2015-12-01

    The locality Schöningen (Germany) is an important source of knowledge about Lower Paleolithic hominin subsistence. The locality includes a series of sites dated to the late Middle Pleistocene with a Holsteinian (MIS 11) and Reinsdorf Interglacial (MIS 9) age. One of the youngest sites is Schöningen 13 II-4, the Spear Horizon site also known as the Horse Butchery site. The organic remains excavated here are exceptionally well-preserved as they were embedded in anaerobic, waterlogged sediments in an area where the groundwater is rich in calcium carbonate. The fossil assemblage is ideal for the study of patterns in hominin interference with the mammalian species encountered at the site. The vertebrate record is extensive and very diverse. The fossil larger carnivore guild of the Spear Horizon faunal assemblage includes saber-toothed cat, fox, and wolf. Herbivores are represented by an elephant species, two equid species, two rhinoceros species, two cervid species, and two large bovid species. Evidence of hominin interference presents itself as either marks on skeletal remains related to the use of bones as knapping tools or hammers, or as marks that indicate butchering activities such as skinning, dismembering, defleshing, filleting, and marrow extraction. The humerus of the saber-toothed cat clearly shows that the bone has been used as a knapping tool. The fossil remains of the other larger carnivores do not show any signs of hominin interference or exploitation. This also applies to the limited number of elephant and rhinoceros remains found at the site. The large horse Equus mosbachensis dominates the larger mammal record and played a major role in hominin subsistence. Marks on the horse bones indicate that a large number of carcasses have been butchered. Traces on the fossil remains of both red deer (Cervus elaphus) and the large bovids also indicate exploitation by Lower Paleolithic hominins. PMID:26607346

  19. İŞGÖREN SEÇİM SÜRECİNDEKİ KRİTİK FAALİYETLERİN ANALİTİK HİYERARŞİ SÜRECİ İLE DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Nurcan TEMİZ

    2015-10-01

    Full Text Available ÖZ: Proje, zaman, kaynak ve para gibi kısıtları olan, belirli bir amacı başarmak için başlangıç ve bitiş sürelerine sahip ve öncelik ilişkileri olan bir takım faaliyetlerden oluşan bir süreçtir. İşgören seçimi her işletme için hayati bir öneme sahiptir. Bu süreç, işletmenin ihtiyaçlarına uygun işgücünü bulma ve işletmeye dahil etme faaliyetlerinden oluşan bir proje gibi düşünülebilir. Bu çalışmada bir fast food işletmesinin müdür adayı işe alım süreci incelenmiştir. İşgören seçim sürecinde işletme tarafından uygulanan faaliyetlerin öncelik ilişkileri kullanılarak proje planlama tekniklerinden Kritik Yol Yöntemi (CPM ile projenin şebekesi çizilmiş, tüm faaliyetler için en erken başlama, en erken bitiş, en geç başlama, en geç bitiş süreleri, toplam boşluklar ve serbest boşluklar hesaplanmış, kritik faaliyetler bulunmuştur. Daha sonra kritik faaliyetlerden bazılarının önceliklerini (göreli önemlerini bulmak için Analitik Hiyerarşi Süreci (AHS kullanılmıştır. ABSTRACT: Project is a process, which has restrictions such as time, resource and money, consisting of a set of activities that have starting and finishing time and precedency relations in order to achieve a specific purpose. Personnel selection has a vital importance for every business. This process can be considered as a project that consists of activities such as finding correct labour force and incorporating them to the organization. In this study personnel selection process of fast food organization was examined. By using precedence relationships of activities, pursued by organization in the personnel selection process, network of project is drawn via Critical Path Method (CPM, which is one of the project planning techniques, earliest start and earliest finish times, latest start and latest finish times, total and free float of all activities were calculated and critical activities were found. Then

  20. Passives in South Asian Languages

    Directory of Open Access Journals (Sweden)

    Pritha CHANDRA

    2013-06-01

    Full Text Available Haspelmath (2010 debates whether universal (descriptive categories of the types that generativists (cf. Newmeyer, 2007 envisage are real and needed for cross-linguistic studies. Instead every language has its own unique set of categories. We raise doubt on this “categorial particularism” position by drawing on underlying similarities of passive constructions of three South Asian languages - Oriya (Indo-Aryan, Malayalam (Dravidian and Kharia (Austro-Asiatic. Unlike English-type passives, they retain subject properties for their logical subjects and object properties for their logical objects, suggesting commonalities that a “categorial particularism” approach would not allow us to posit. Our further contention is that like English passives, they too satisfy Shibatani’s (1985 minimal condition for passives – the underscoring or the optionality of agents. Passive voice must therefore be a universal found in all languages primarily resulting in the optionality of agents. We also show how adopting this approach helps us re-analyse Meitei and Ao (Tibeto-Burman as languages involving passives. ----- Haspelmath (2010 se v svoji razpravi sprašuje, ali so univerzalne kategorije, ki jih obravnavajo generativisti (prim. Newmeyer, 2007, resnične in potrebne za medjezikovne raziskave. Namesto tega naj bi imel vsak jezik svoje lastne kategorije. Članek se ne strinja s konceptom “specifičnih kategorij”, kar prikaže na primeru podobnih pasivnih konstukcij v treh jezikih Južne Azije: v indoarijskem jeziku orija, dravidskem jeziku malajalam in avstroazijskem jeziku karija. Z razliko od pasivov, ki so značilni za angleščino, pasivi v teh jezikih ohranjajo značilnosti osebka za logične osebke in značilnosti predmeta za logične predmete. V okviru koncepta “specifičnih kategorij” to ne bi smelo biti mogoče. Sledi utemeljitev, da enako kot v angleščini tudi tu omenjene oblike pasiva ustrezajo mininalnim pogojem za pasiv, kot jih

  1. Contribution of stable isotopes (C,N,S) in collagen of late Pleistocene large mammal trophic ecology and landscape use: a case study in Goyet and Scladina cave (30-40,000 years BP)

    Science.gov (United States)

    Bocherens, Hervé; Germonpré, Mietje

    2010-05-01

    Two Belgian caves yielded very rich large mammal associations dating around 30 to 40,000 years ago: Goyet and Scladina cave (layer 1A). These sites are only 5 km apart but the cave entrances open on different valleys, in a quite diverse landscape ranging between open, unprotected uplands, steep cliffs and sheltered sun-exposed gorges, with the larger Meuse valley nearby. This mosaic scenery permitted during the Last Glacial a rich diversity of fossil flora and fauna. The faunal association includes a large diversity of taxa including Aurochs Bos primigenius, steppe bison Bison priscus, reindeer Rangifer tarandus, giant deer Megaloceros giganteus, horse Equus ferus, woolly rhinoceros Coelodonta antiquitatis, woolly mammoth Mammuthus primigenius, cave bear Ursus spelaeus, brown bear Ursus arctos, wolf Canis lupus, cave lion Panthera leo spelaea, and cave hyaena Crocuta crocuta spelaea. All the 90 studied bones and teeth yielded collagen with excellent collagen preservation, allowing reliable investigations of carbon, nitrogen and sulfur isotopic biogeochemistry. The combination of three different isotopic tracers allows to deciphering the effects of food selection and landscape use by different herbivorous and carnivorous taxa. This is the first study to include sulfur isotopic signatures in the study of late Quaternary large mammal palaeobiology. This new tracer yields evidence on mobility and differences in pasture areas, as different geological bedrock may exhibit various sulfur isotopic signatures that will pass on the herbivores and further on their predators. Using this feature in addition to the trophic information provided by carbon and nitrogen isotopic signatures, it appears that for some species present in both sites, such as horse and woolly rhinoceros, the individuals found in each site probably did not use the same pasture areas. This seems to also the case for the overwhelmingly vegetarian cave bears. In addition, individuals from the same species

  2. Kvalitet u funkciji maksimizacije borbene gotovosti / Quality in the function of combat readiness maximization

    Directory of Open Access Journals (Sweden)

    Nenko Brkljač

    2006-07-01

    Full Text Available U sistemu opremanja Vojske sredstvima NVO sistemu menadžmenta kvalitetom mora biti podređena čitava organizacija, kao i opredeljenje najvišeg rukovodstva i zaposlenih. Neophodni preduslovi za uspostavljanje efikasnog (racionalnog sistema sadržani su u primeni suvremenih pristupa obezbeđenju kvaliteta, koji isključuju eklektički pristup pitanju "dokumentovanosti", koja je samo jedan u nizu velikog broja elemenata (složenih procesa za obezbeđenje kvaliteta, koje treba oživotvoriti da bi se kreirala, kao krajnji rezultat, maksimalna borbena gotovost. / In order to achieve top combat readiness, it is necessary that military system provision top management recognize need for quality management system establishment based on 'process approach'. Whole organization and orientation of top management and employee must be subjected to quality management system. For efficient (rational quality management system consolidation it is necessary to assure contemporary approach quality assurance, excluding eclectic approach to 'documentation'. 'Documentation' is only one condition among many difficult elements (process for quality assurance which is necessary to create top combat readiness, as a final result.

  3. In Situ Fabrication of Bi2Ti2O7/TiO2 Heterostructure Submicron Fibers for Enhanced Photocatalytic Activity.

    Science.gov (United States)

    Zhou, Di; Yang, Hu; Tu, Yafang; Tian, Yu; Cai, Yaxuan; Hu, Zhenglong; Zhu, Xiaolong

    2016-12-01

    A facile two-step synthesis route combining electrospinning and hydrothermal techniques has been performed to obtain Bi2Ti2O7/TiO2 heterostructured submicron fibers. Bi2Ti2O7 nanosheets were grown on the surface of TiO2 submicron fibers. The density of the nanosheets increased with higher precursor concentration of the Bi/Ti reaction raw materials. UV-visible (UV-vis) diffuse reflectance spectroscopy indicated that the absorption spectrum of the Bi2Ti2O7/TiO2 composite extended into the visible-light region. Photocatalytic tests showed that the Bi2Ti2O7/TiO2 heterostructures possess a much higher degradation rate of rhodamine B than the unmodified TiO2 submicron fibers under visible light. The enhanced photocatalytic activity can be attributed to the synergistic effect between improved visible-light absorption and the internal electric field created by the heterojunctions. The effective separation of photogenerated carriers driven by the photoinduced potential was demonstrated by the photoelectrochemical analysis. PMID:27071680

  4. Međunarodna organizacija kao korisnik strane vojne baze

    Directory of Open Access Journals (Sweden)

    Ivica Kinder

    2013-10-01

    Full Text Available Strana vojna baza podrazumijeva točno određeni dio državnog područja neke države na kojemu su, na temelju njezina pristanka, strane vojne snage relativno trajno stacionirane radi provedbe vojnih aktivnosti, pri čemu država korisnik, odnosno njezine vojne snage, imaju isključivi nadzor nad područjem baze. Mada se u ulozi domaćina i korisnika strane vojne baze tradicionalno pojavljuju države kao subjekti međunarodnoga prava, korisnik strane vojne baze može biti i međunarodna organizacija. U dosadašnjoj praksi kao korisnik strane vojne baze, u ograničenoj mjeri, pojavljuje se UN, dok strane vojne baze uspostavljene pod okriljem NATO-a, mada znatno raširenije, redovito pripadaju državama članicama, a ne NATO-u kao međunarodnoj organizaciji.

  5. Artvin-Saçinka yöresindeki orman ve otlak arazilerinde bazı toprak özelliklerinin yükselti ve derinlik kademelerine göre değişiminin irdelenmesi

    OpenAIRE

    Erdoğan Yüksel, Esin

    2009-01-01

    Araştırma alanı, Türkiye'nin Doğu Karadeniz Bölgesi'nde Artvin'e yaklaşık 32 km. mesafede bulunan Saçinka Yöresi'ndeki Godrahav Deresi Havzasının sınırları içerisinde bulunmaktadır. Bu çalışmada, Artvin-Saçinka yöresi, Godrahav Deresi Yağış Havzası sınırları içerisinde bulunan orman ve hemen bitişiğindeki ormandan dönüştürülen otlak alanlarında toprakların bazı fiziksel, hidro-fiziksel ve kimyasal özellikleri ile aşınım eğilimlerinin arazi kullanım şekline, yükselti kademelerine ve derinlik k...

  6. Zaštita računarskih mreža Ministarstva odbrane i Vojske Srbije primenom virtuelnog honeyneta / Security of computer network of the Ministry of Defence and the Serbian Armed Forces using virtual honeynets

    Directory of Open Access Journals (Sweden)

    Zoran Bobar

    2009-07-01

    Full Text Available U ovom radu obrađena je zaštita računarskih mreža u Ministarstvu odbrane i Vojsci Srbije primenom virtuelnog honeyneta. Zaštita je obrađena sa aspekta arhitekture računarskih mreža koje imaju pristup internetu. Predloženi koncept primene virtuelnog honeyneta uzima u obzir dostignuća nauke u ovoj oblasti u svetu, ostale primenjene metode i tehnike zaštite, mogućnosti i potrebe korisnika i elemente delova računarskog sistema Ministarstva odbrane i Vojske koji bi mogli biti meta napada sa udaljenih mesta globalne (internet mreže. / This paper covers the proposed solution for security of computer network in the Ministry of Defence and the Serbian Armed Forces using virtual honeynets. The security is covered from the aspect of the architecture of computer networks with Internet access. The proposed usage of virtual honeynets for protection takes into account the accomplishments of science in this field as well as security methods and techniques, users' needs and opportunities along with the computer network components of the MoD and the SAF that can be targets for attack.

  7. İŞGÖREN SEÇİM SÜRECİNDEKİ KRİTİK FAALİYETLERİN ANALİTİK HİYERARŞİ SÜRECİ İLE DEĞERLENDİRİLMESİ

    OpenAIRE

    Nurcan TEMİZ; Kısmet CİNGÖZ

    2015-01-01

    ÖZ: Proje, zaman, kaynak ve para gibi kısıtları olan, belirli bir amacı başarmak için başlangıç ve bitiş sürelerine sahip ve öncelik ilişkileri olan bir takım faaliyetlerden oluşan bir süreçtir. İşgören seçimi her işletme için hayati bir öneme sahiptir. Bu süreç, işletmenin ihtiyaçlarına uygun işgücünü bulma ve işletmeye dahil etme faaliyetlerinden oluşan bir proje gibi düşünülebilir. Bu çalışmada bir fast food işletmesinin müdür adayı işe alım süreci incelenmiştir. İşgören seçim sürecinde i...

  8. [Mortality from snake bites, wild and domestic animal bites and arthropod stings in the savannah zone of eastern Senegal].

    Science.gov (United States)

    Trape, J F; Pison, G; Guyavarch, E; Mane, Y

    2002-08-01

    From 1976 to 1999, we conducted a prospective study of overall and cause-specific mortality among the population of 42 villages of south-eastern Senegal. Of 4,228 deaths registered during this period, 26 were brought on by snakebites, 4 by invertebrate stings and 8 by other wild or domestic animals. The average annual mortality rate from snakebite was 14 deaths per 100,000 population. Among persons aged 1 year or more, 0.9% (26/2,880) of deaths were caused by snakebite and this cause represented 28% (26/94) of the total number of deaths by accident. We also investigated the snake fauna of the area. Of 1,280 snakes belonging to 34 species that were collected, one-third were dangerous and the proportion of Viperidae, Elapidae and Atractaspididae was 23%, 11% and 0.6%, respectively. The saw-scaled viper Echis ocellatus was the most abundant species (13.6%). Other venomous species were Causus maculatus (6.5%), Naja katiensis (5.5%), Bitis arietans (2.7%), Elapsoidea trapei (2.4%), Naja nigricollis (1.2%), Naja melanoleuca (1.1%), Atractaspis aterrima (0.4%), Dendroaspis polylepis (0.3%) and Naja haje (0.1%). PMID:12404858

  9. High mortality from snakebite in south-eastern Senegal.

    Science.gov (United States)

    Trape, J F; Pison, G; Guyavarch, E; Mane, Y

    2001-01-01

    Over 24 years, from 1976 to 1999, we conducted a prospective study of overall and cause-specific mortality among the population of 42 villages of south-eastern Senegal. Of 4228 deaths registered during this period, 26 were caused by snakebite, 4 by invertebrate stings and 8 by other wild or domestic animals. The average annual mortality rate from snakebite was 14 deaths per 100,000 population. Among persons aged > or = 1 year, 0.9% (26/2880) of deaths were caused by snakebite and this cause represented 28% (26/94) of total deaths by accidents. We also investigated the snake fauna of the area. Of 1280 snakes belonging to 34 species that were collected, one-third were dangerous and the proportion of Viperidae, Elapidae and Atractaspidae was 23%, 11% and 0.6%, respectively. The saw-scaled viper Echis ocellatus was the most abundant species (13.6%). Other venomous species were Causus maculatus (6.5%), Naja katiensis (5.5%), Bitis arietans (2.7%), Elapsoidea trapei (2.4%), Naja nigricollis (1.2%), Naja melanoleuca (1.1%), Atractaspis aterrima (0.4%), Dendroaspis polylepis (0.3%) and Naja haje (0.1%). PMID:11579888

  10. Public health aspects of snakebite care in West Africa: perspectives from Nigeria.

    Science.gov (United States)

    Habib, Abdulrazaq G

    2013-01-01

    Snakebite envenoming is a major public health problem among rural communities of the Nigerian savanna. The saw-scaled or carpet viper (Echis ocellatus) and, to a lesser extent, the African cobras (Naja spp.) and puff adders (Bitis arietans) have proved to be the most important cause of mortality and morbidity. The main clinical features of E. ocellatus envenoming are systemic hemorrhage, incoagulable blood, shock, local swelling, bleeding and, occasionally, necrosis. Bites may be complicated by amputation, blindness, disability, disfigurement, mutilation, tissue destruction and psychological consequences. Antivenom remains the hallmark and mainstay of envenoming management while studies in Nigeria confirm its protection of over 80% against mortality from carpet-viper bites. However, the availability, distribution and utilization of antivenom remain challenging although two new antivenoms (monospecific EchiTab G and trispecific EchiTab ICP-Plus) derived from Nigerian snake venoms have proven very effective and safe in clinical trials. A hub-and-spoke strategy is suggested for broadening antivenom access to endemic rural areas together with instituting quality assurance, standardization and manpower training. With the advent of antivenomics, national health authorities must be aided in selecting and purchasing antivenoms appropriate to their national needs while manufacturers should be helped in practical ways to improve the safety, efficacy and potential coverage against snake venoms and pricing of their products. PMID:24134780

  11. Identification of cDNAs encoding viper venom hyaluronidases: cross-generic sequence conservation of full-length and unusually short variant transcripts.

    Science.gov (United States)

    Harrison, Robert A; Ibison, Frances; Wilbraham, Davina; Wagstaff, Simon C

    2007-05-01

    The immobilisation of prey by snakes is most efficiently achieved by the rapid dissemination of venom from its site of injection into the blood stream. Hyaluronidase is a common component of snake venoms and has been termed the "venom spreading factor". In the absence of nucleotide or protein sequence data to confirm the functional identity of this venom component, we interrogated a venom gland EST database for the saw-scaled viper, Echis ocellatus (Nigeria), using the gene ontology (GO) term "carbohydrate metabolism". A single hyalurononglucosaminadase-activity matching sequence (EOC00242) was found and used to design PCR primers to acquire the full-length cDNA sequence. Although very different from the bee venom and mammalian hyaluronidase sequences, the E. ocellatus sequence retained all the catalytic, positional and structural residues that characterise this class of carbohydrate metabolising hydrolases. An extraordinarily high level of sequence identity (>95%) was observed in analogous venom gland cDNA sequences isolated (by PCR) from another saw-scaled viper species, E. pyramidum leakeyi (Kenya), and from the sahara horned viper, Cerastes cerastes cerastes (Egypt) and the puff adder, Bitis arietans (Nigeria). Smaller amplicons, lacking hyaluronidase catalytic residues because of 768 bp or 855 bp central deletions, appear to encode either truncated peptides without hyaluronidase activity, or are non-translated transcripts because they lack consensus translation initiating motifs. PMID:17210232

  12. A generalized fecal glucocorticoid assay for use in a diverse array of nondomestic mammalian and avian species.

    Science.gov (United States)

    Wasser, S K; Hunt, K E; Brown, J L; Cooper, K; Crockett, C M; Bechert, U; Millspaugh, J J; Larson, S; Monfort, S L

    2000-12-01

    Noninvasive fecal glucocorticoid analysis has tremendous potential as a means of assessing stress associated with environmental disturbance in wildlife. However, interspecific variation in excreted glucocorticoid metabolites requires careful selection of the antibody used in their quantification. We compared four antibodies for detecting the major fecal cortisol metabolites in yellow baboons following (3)H cortisol administration, ACTH challenge, and HPLC separation of fecal glucocorticoid metabolites. The most effective antibody (ICN corticosterone RIA; Cat. No. 07-120102) demonstrated relatively high cross-reactivities to the major cortisol metabolites present in feces during peak excretion, following both radiolabel infusion and ACTH challenge. This same antibody also detected increased fecal glucocorticoid metabolites after ACTH administration in the African elephant, black rhinoceros, Roosevelt elk, gerenuk, scimitar-horned oryx, Alaskan sea otter, Malayan sun bear, cheetah, clouded leopard, longtailed macaque, and northern spotted owl. Results suggest that (1) fecal glucocorticoid assays reliably detect endogenous changes in adrenal activity of a diverse array of species and (2) where comparisons were made, the ICN corticosterone antibody generally was superior to other antibodies for measuring glucocorticoid metabolites in feces. PMID:11121291

  13. Daylight Design of Office Buildings: Optimisation of External Solar Shadings by Using Combined Simulation Methods

    Directory of Open Access Journals (Sweden)

    Javier González

    2015-05-01

    Full Text Available Integrating daylight and energy performance with optimization into the design process has always been a challenge for designers. Most of the building environmental performance simulation tools require a considerable amount of time and iterations for achieving accurate results. Moreover the combination of daylight and energy performances has always been an issue, as different software packages are needed to perform detailed calculations. A simplified method to overcome both issues using recent advances in software integration is explored here. As a case study; the optimization of external shadings in a typical office space in Australia is presented. Results are compared against common solutions adopted as industry standard practices. Visual comfort and energy efficiency are analysed in an integrated approach. The DIVA (Design, Iterate, Validate and Adapt plug-in for Rhinoceros/Grasshopper software is used as the main tool, given its ability to effectively calculate daylight metrics (using the Radiance/Daysim engine and energy consumption (using the EnergyPlus engine. The optimization process is carried out parametrically controlling the shadings’ geometries. Genetic Algorithms (GA embedded in the evolutionary solver Galapagos are adopted in order to achieve close to optimum results by controlling iteration parameters. The optimized result, in comparison with conventional design techniques, reveals significant enhancement of comfort levels and energy efficiency. Benefits and drawbacks of the proposed strategy are then discussed.

  14. Development of a Titanium Plate for Mandibular Angle Fractures with a Bone Defect in the Lower Border: Finite Element Analysis and Mechanical Test

    Directory of Open Access Journals (Sweden)

    Douglas Rangel Goulart

    2015-09-01

    Full Text Available Objectives: The aim of the present study was to develop a plate to treat mandibular angle fractures using the finite element method and mechanical testing. Material and Methods: A three-dimensional model of a fractured mandible was generated using Rhinoceros 4.0 software. The models were exported to ANSYS®, in which a static application of displacement (3 mm was performed in the first molar region. Three groups were assessed according to the method of internal fixation (2 mm system: two non-locking plates; two locking plates and a new design locking plate. The computational model was transferred to an in vitro experiment with polyurethane mandibles. Each group contained five samples and was subjected to a linear loading test in a universal testing machine. Results: A balanced distribution of stress was associated with the new plate design. This plate modified the mechanical behavior of the fractured region, with less displacement between the fractured segments. In the mechanical test, the group with two locking plates exhibited greater resistance to the 3 mm displacement, with a statistically significant difference when compared with the new plate group (ANOVA, P = 0.016. Conclusions: The new plate exhibited a more balanced distribution of stress. However, the group with two locking plates exhibited greater mechanical resistance.

  15. Comprehensive Serology Based on a Peptide ELISA to Assess the Prevalence of Closely Related Equine Herpesviruses in Zoo and Wild Animals.

    Directory of Open Access Journals (Sweden)

    Azza Abdelgawad

    Full Text Available Equine herpesvirus type 1 (EHV-1 causes respiratory disorders and abortion in equids while EHV-1 regularly causes equine herpesvirus myeloencephalopathy (EHM, a stroke-like syndrome following endothelial cell infection in horses. Both EHV-1 and EHV-9 infections of non-definitive hosts often result in neuronal infection and high case fatality rates. Hence, EHV-1 and EHV-9 are somewhat unusual herpesviruses and lack strict host specificity, and the true extent of their host ranges have remained unclear. In order to determine the seroprevalence of EHV-1 and EHV-9, a sensitive and specific peptide-based ELISA was developed and applied to 428 sera from captive and wild animals representing 30 species in 12 families and five orders. Members of the Equidae, Rhinocerotidae and Bovidae were serologically positive for EHV-1 and EHV-9. The prevalence of EHV-1 in the sampled wild zebra populations was significantly higher than in zoos suggesting captivity may reduce exposure to EHV-1. Furthermore, the seroprevalence for EHV-1 was significantly higher than for EHV-9 in zebras. In contrast, EHV-9 antibody prevalence was high in captive and wild African rhinoceros species suggesting that they may serve as a reservoir or natural host for EHV-9. Thus, EHV-1 and EHV-9 have a broad host range favoring African herbivores and may have acquired novel natural hosts in ecosystems where wild equids are common and are in close contact with other perissodactyls.

  16. Protein sequence evidence for monophyly of the carnivore families Procyonidae and Mustelidae.

    Science.gov (United States)

    de Jong, W W

    1986-05-01

    The amino acid sequence of the eye lens protein alpha-crystallin A of the ring-tailed cat, Bassariscus astutus, has been determined. The sequence of the Bassariscus alpha A chain, which is 173 residues long, was compared with the previously determined set of 41 mammalian alpha A sequences. Among the investigated carnivores (dog, cat, sloth bear, American mink, gray seal, and California sea lion) the Bassariscus alpha A sequence exclusively shares two amino acid replacements with the alpha A chain of the mink, Mustela vison: 7 His----Gln and 61 Ile----Val. The Mustela and Bassariscus alpha A sequences differ at only three positions and have no replacements in common with any of the other investigated carnivore alpha A chains. Furthermore, the replacement 7 His----Gln has only been found in three-toed sloth, whereas 61 Ile----Val occurs scattered in three other taxa: pig, rhinoceros, and prosimians. It thus is most parsimonious to join Bassariscus and Mustela--and consequently their respective families, Procyonidae and Mustelidae--as sister groups in the phylogenetic tree of mammalian alpha A sequences. PMID:3444403

  17. Herds overhead: Nimbadon lavarackorum (Diprotodontidae, heavyweight marsupial herbivores in the Miocene forests of Australia.

    Directory of Open Access Journals (Sweden)

    Karen H Black

    Full Text Available The marsupial family Diprotodontidae (Diprotodontia, Vombatiformes is a group of extinct large-bodied (60-2500 kg wombat-like herbivores that were common and geographically widespread in Cenozoic fossil deposits of Australia and New Guinea. Typically they are regarded to be gregarious, terrestrial quadrupeds and have been likened in body form among placental groups to sheep, rhinoceros and hippopotami. Arguably, one of the best represented species is the zygomaturine diprotodontid Nimbadon lavarackorum which is known from exceptionally well-preserved cranial and postcranial material from the middle Miocene cave deposit AL90, in the Riversleigh World Heritage Area, northwestern Queensland. Here we describe and functionally analyse the appendicular skeleton of Nimbadon lavarackorum and reveal a far more unique lifestyle for this plesiomorphic and smallest of diprotodontids. Striking similarities are evident between the skeleton of Nimbadon and that of the extant arboreal koala Phascolarctos cinereus, including the powerfully built forelimbs, highly mobile shoulder and elbow joints, proportionately large manus and pes (both with a semi-opposable digit I and exceedingly large, recurved and laterally compressed claws. Combined with the unique (among australidelphians proportionately shortened hindlimbs of Nimbadon, these features suggest adept climbing ability, probable suspensory behaviour, and an arboreal lifestyle. At approximately 70 kg, Nimbadon is the largest herbivorous mammal to have occupied the forest canopies of Australia - an ecological niche that is no longer occupied in any Australian ecosystem and one that further expands the already significant niche diversity displayed by marsupials during the Cenozoic.

  18. Ciliate protozoa

    International Nuclear Information System (INIS)

    Gruby and Delafond discovered the rumen protozoa in 1843 and suggested that their digestive activity was the primary means by which ruminants could survive on an all-plant diet. However, subsequent studies have clearly shown that bacteria actually play a prominent role in the fermentation of plant materials, and fungi are also involved. The rumen ciliates range in size from 18 to 500 μm and can be enumerated and identified microscopically at relatively low magnifications. On the basis of cell morphology, they have been classified into at least five families containing 24 different genera. Although new species are still being reported yearly, the last summary was compiled in 1992 by Williams and Coleman and listed 257 separate species. Ciliate protozoa belonging to different families are found in most other herbivorous mammals. This includes those animals in which fermentation occurs in the hindgut, such as the horse, elephant, rhinoceros and capybara, as well as in the non-ruminant foregut fomenters, i.e. camelids, hippopotamus and kangaroo. These ciliates can be enumerated and identified using the methods and techniques presented in this chapter, presuming appropriate procedures are used for obtaining representative samples from the animal

  19. A recombinant nucleocapsid-based indirect ELISA for serodiagnosis of Rift Valley fever in African wildlife

    International Nuclear Information System (INIS)

    An indirect ELISA (I-ELISA) based on the recombinant nucleocapsid protein (rNp) of Rift Valley fever virus (RVFV) was evaluated for the detection of specific serum IgG antibody in African wildlife. Data sets derived from field-collected sera (n = 918) in Africa (antelopes = 570, black rhinoceros = 43, common zebra = 24, elephant = 73, giraffe = 81, grevy zebra = 78, warthog = 49) were categorised according to the results of a virus neutralisation test (VNT). At cut-offs optimised by the two-graph receiver operating characteristics analysis, the diagnostic sensitivity of the I-ELISA was 100% and diagnostic specificity ranged from 99.8% to 100% while estimates for the Youden's index (J) and efficiency (Ef) ranged from 0.99 to 1 and from 99.7% to 100%, respectively. The rNp-based I-ELISA is highly accurate, safe, and offers a single assay format for rapid detection of IgG antibody to RVFV in sera of different wildlife species. (author)

  20. Possibilities of Preoperative Medical Models Made by 3D Printing or Additive Manufacturing

    Science.gov (United States)

    2016-01-01

    Most of the 3D printing applications of preoperative models have been focused on dental and craniomaxillofacial area. The purpose of this paper is to demonstrate the possibilities in other application areas and give examples of the current possibilities. The approach was to communicate with the surgeons with different fields about their needs related preoperative models and try to produce preoperative models that satisfy those needs. Ten different kinds of examples of possibilities were selected to be shown in this paper and aspects related imaging, 3D model reconstruction, 3D modeling, and 3D printing were presented. Examples were heart, ankle, backbone, knee, and pelvis with different processes and materials. Software types required were Osirix, 3Data Expert, and Rhinoceros. Different 3D printing processes were binder jetting and material extrusion. This paper presents a wide range of possibilities related to 3D printing of preoperative models. Surgeons should be aware of the new possibilities and in most cases help from mechanical engineering side is needed. PMID:27433470

  1. Serum and Plasma Cholinesterase Activity in the Cape Griffon Vulture (Gyps coprotheres).

    Science.gov (United States)

    Naidoo, Vinny; Wolter, Kerri

    2016-04-28

    Vulture (Accipitridae) poisonings are a concern in South Africa, with hundreds of birds dying annually. Although some of these poisonings are accidental, there has been an increase in the number of intentional baiting of poached rhinoceros (Rhinocerotidae) and elephant (Elephantidae) carcasses to kill vultures that alert officials to poaching sites by circling overhead. The primary chemicals implicated are the organophosphorous and carbamate compounds. Although most poisoning events can be identified by dead vultures surrounding the scavenged carcass, weak birds are occasionally found and brought to rehabilitation centers for treatment. The treating veterinarian needs to make an informed decision on the cause of illness or poisoning prior to treatment. We established the reference interval for serum and plasma cholinesterase activity in the Cape Griffon Vulture ( Gyps coprotheres ) as 591.58-1,528.26 U/L, providing a clinical assay for determining potential exposure to cholinesterase-depressing pesticides. Both manual and automated samplers were used with the butyrylthiocholine method. Species reference intervals for both serum and plasma cholinesterase showed good correlation and manual and automated measurements yielded similar results. PMID:26981685

  2. VEGETATION AND WILDLIFE OF LAOKHOWA WILDLIFE SANCTUARY IN ASSAM, INDIA

    Directory of Open Access Journals (Sweden)

    Sanjeeb Kumar Nath

    2012-12-01

    Full Text Available The protective areas like National Parks, Wildlife Sanctuaries and reserve forests have attracted worldwide attention to study vegetation, floral diversity and other wild lives for its conservation, sustainable use and also for proper management of bioresources. Laokhowa Wildlife Sanctuary has most ideal habitat for Indian one horned rhinoceros and is one of its representative area in Brahmaputra flood plain. The sanctuary is one of the rich and ecological habitat for the wild variety of animals and plants species .The natural vegetation of the area is mainly contributed by forests of tall trees, grassland and wetland vegetation. The woodland provides food and shelter to a variety of animals and the grassland is the haven for a variety of herbivores. Besides these the wetlands and aquatic bodies provides food and shelter to avifauna, fish fauna and other wildlife. The present paper deals with the vegetation present in the sanctuary. The vegetation comprises (a Low alluvial savannah woodland (Salmaria – Albizzia(b Western Wet alluvial grasslands (c Riparian Fringing Forests (d Barringtonia Swamp forests (e Wetlands (f Plantation areas (g Degraded Forests. About 40 sq km areas is grassland; 6 sq km area is occupied by alluvial grassland in the Sanctuary.

  3. Evolutionary Conservation in Genes Underlying Human Psychiatric Disorders

    Directory of Open Access Journals (Sweden)

    Lisa Michelle Ogawa

    2014-05-01

    Full Text Available Many psychiatric diseases observed in humans have tenuous or absent analogs in other species. Most notable among these are schizophrenia and autism. One hypothesis has posited that these diseases have arisen as a consequence of human brain evolution, for example, that the same processes that led to advances in cognition, language, and executive function also resulted in novel diseases in humans when dysfunctional. Here, the molecular evolution of genes associated with these and other psychiatric disorders are compared among species. Genes associated with psychiatric disorders are drawn from the literature and orthologous sequences are collected from eleven primate species (human, chimpanzee, bonobo, gorilla, orangutan, gibbon, macaque, baboon, marmoset, squirrel monkey, and galago and thirty one non-primate mammalian species. Evolutionary parameters, including dN/dS, are calculated for each gene and compared between disease classes and among species, focusing on humans and primates compared to other mammals and on large-brained taxa (cetaceans, rhinoceros, walrus, bear, and elephant compared to their small-brained sister species. Evidence of differential selection in primates supports the hypothesis that schizophrenia and autism are a cost of higher brain function. Through this work a better understanding of the molecular evolution of the human brain, the pathophysiology of disease, and the genetic basis of human psychiatric disease is gained.

  4. Digital surveillance: a novel approach to monitoring the illegal wildlife trade.

    Science.gov (United States)

    Sonricker Hansen, Amy L; Li, Annie; Joly, Damien; Mekaru, Sumiko; Brownstein, John S

    2012-01-01

    A dearth of information obscures the true scale of the global illegal trade in wildlife. Herein, we introduce an automated web crawling surveillance system developed to monitor reports on illegally traded wildlife. A resource for enforcement officials as well as the general public, the freely available website, http://www.healthmap.org/wildlifetrade, provides a customizable visualization of worldwide reports on interceptions of illegally traded wildlife and wildlife products. From August 1, 2010 to July 31, 2011, publicly available English language illegal wildlife trade reports from official and unofficial sources were collected and categorized by location and species involved. During this interval, 858 illegal wildlife trade reports were collected from 89 countries. Countries with the highest number of reports included India (n = 146, 15.6%), the United States (n = 143, 15.3%), South Africa (n = 75, 8.0%), China (n = 41, 4.4%), and Vietnam (n = 37, 4.0%). Species reported as traded or poached included elephants (n = 107, 12.5%), rhinoceros (n = 103, 12.0%), tigers (n = 68, 7.9%), leopards (n = 54, 6.3%), and pangolins (n = 45, 5.2%). The use of unofficial data sources, such as online news sites and social networks, to collect information on international wildlife trade augments traditional approaches drawing on official reporting and presents a novel source of intelligence with which to monitor and collect news in support of enforcement against this threat to wildlife conservation worldwide. PMID:23236444

  5. Digital surveillance: a novel approach to monitoring the illegal wildlife trade.

    Directory of Open Access Journals (Sweden)

    Amy L Sonricker Hansen

    Full Text Available A dearth of information obscures the true scale of the global illegal trade in wildlife. Herein, we introduce an automated web crawling surveillance system developed to monitor reports on illegally traded wildlife. A resource for enforcement officials as well as the general public, the freely available website, http://www.healthmap.org/wildlifetrade, provides a customizable visualization of worldwide reports on interceptions of illegally traded wildlife and wildlife products. From August 1, 2010 to July 31, 2011, publicly available English language illegal wildlife trade reports from official and unofficial sources were collected and categorized by location and species involved. During this interval, 858 illegal wildlife trade reports were collected from 89 countries. Countries with the highest number of reports included India (n = 146, 15.6%, the United States (n = 143, 15.3%, South Africa (n = 75, 8.0%, China (n = 41, 4.4%, and Vietnam (n = 37, 4.0%. Species reported as traded or poached included elephants (n = 107, 12.5%, rhinoceros (n = 103, 12.0%, tigers (n = 68, 7.9%, leopards (n = 54, 6.3%, and pangolins (n = 45, 5.2%. The use of unofficial data sources, such as online news sites and social networks, to collect information on international wildlife trade augments traditional approaches drawing on official reporting and presents a novel source of intelligence with which to monitor and collect news in support of enforcement against this threat to wildlife conservation worldwide.

  6. Collection of radiocarbon dates on the mammoths ( Mammuthus primigenius) and other genera of Wrangel Island, northeast Siberia, Russia

    Science.gov (United States)

    Vartanyan, Sergey L.; Arslanov, Khikmat A.; Karhu, Juha A.; Possnert, Göran; Sulerzhitsky, Leopold D.

    2008-07-01

    We present and discuss a full list of radiocarbon dates for woolly mammoth and other species of the Mammoth fauna available from Wrangel Island, northeast Siberia, Russia. Most of the radiocarbon dates are published here for the first time. Of the124 radiocarbon dates on mammoth bone, 106 fall between 3700 and 9000 yr ago. We believe these dates bracket the period of mammoth isolation on Wrangel Island and their ultimate extinction, which we attribute to natural causes. The absence of dates between 9-12 ka probably indicates a period when mammoths were absent from Wrangel Island. Long bone dimensions of Holocene mammoths from Wrangel Island indicate that these animals were comparable in size to those on the mainland; although they were not large animals, neither can they be classified as dwarfs. Occurrence of mammoth Holocene refugia on the mainland is suggested. Based on other species of the Mammoth fauna that have also been radiocarbon on Wrangel Island, including horse, bison, musk ox and woolly rhinoceros, it appears that the mammoth was the only species of that fauna that inhabited Wrangel Island in the mid-Holocene.

  7. Possibilities of Preoperative Medical Models Made by 3D Printing or Additive Manufacturing

    Directory of Open Access Journals (Sweden)

    Mika Salmi

    2016-01-01

    Full Text Available Most of the 3D printing applications of preoperative models have been focused on dental and craniomaxillofacial area. The purpose of this paper is to demonstrate the possibilities in other application areas and give examples of the current possibilities. The approach was to communicate with the surgeons with different fields about their needs related preoperative models and try to produce preoperative models that satisfy those needs. Ten different kinds of examples of possibilities were selected to be shown in this paper and aspects related imaging, 3D model reconstruction, 3D modeling, and 3D printing were presented. Examples were heart, ankle, backbone, knee, and pelvis with different processes and materials. Software types required were Osirix, 3Data Expert, and Rhinoceros. Different 3D printing processes were binder jetting and material extrusion. This paper presents a wide range of possibilities related to 3D printing of preoperative models. Surgeons should be aware of the new possibilities and in most cases help from mechanical engineering side is needed.

  8. Possibilities of Preoperative Medical Models Made by 3D Printing or Additive Manufacturing.

    Science.gov (United States)

    Salmi, Mika

    2016-01-01

    Most of the 3D printing applications of preoperative models have been focused on dental and craniomaxillofacial area. The purpose of this paper is to demonstrate the possibilities in other application areas and give examples of the current possibilities. The approach was to communicate with the surgeons with different fields about their needs related preoperative models and try to produce preoperative models that satisfy those needs. Ten different kinds of examples of possibilities were selected to be shown in this paper and aspects related imaging, 3D model reconstruction, 3D modeling, and 3D printing were presented. Examples were heart, ankle, backbone, knee, and pelvis with different processes and materials. Software types required were Osirix, 3Data Expert, and Rhinoceros. Different 3D printing processes were binder jetting and material extrusion. This paper presents a wide range of possibilities related to 3D printing of preoperative models. Surgeons should be aware of the new possibilities and in most cases help from mechanical engineering side is needed. PMID:27433470

  9. Mechanisms regulating nutrition-dependent developmental plasticity through organ-specific effects in insects

    Directory of Open Access Journals (Sweden)

    ChristenKerryMirth

    2013-09-01

    Full Text Available Nutrition, via the insulin/insulin-like growth factor (IIS/Target of Rapamycin (TOR signaling pathway, can provide a strong molding force for determining animal size and shape. For instance, nutrition induces a disproportionate increase in the size of male horns in dung and rhinoceros beetles, or mandibles in staghorn or horned flour beetles, relative to body size. In these species, well-fed male larvae produce adults with greatly enlarged horns or mandibles, whereas males that are starved or poorly fed as larvae bear much more modest appendages. Changes in IIS/TOR signaling plays a key role in appendage development by regulating growth in the horn and mandible primordia. In contrast, changes the IIS/TOR pathway produces minimal effects on the size of other adult structures, such as the male genitalia in fruit flies and dung beetles. The horn, mandible and genitalia illustrate that although all tissues are exposed to the same hormonal environment within the larval body, the extent to which insulin can induce growth is organ specific. In addition, the IIS/TOR pathway affects body size and shape by controlling production of metamorphic hormones important for regulating developmental timing, like the steroid molting hormone ecdysone and sesquiterpenoid hormone juvenile hormone. In this review, we discuss recent results from Drosophila and other insects that highlight mechanisms allowing tissues to differ in their sensitivity to IIS/TOR and the potential consequences of these differences on body size and shape.

  10. On the discovery of a cave lion from the Malyi Anyui River (Chukotka, Russia)

    Science.gov (United States)

    Kirillova, I. V.; Tiunov, A. V.; Levchenko, V. A.; Chernova, O. F.; Yudin, V. G.; Bertuch, F.; Shidlovskiy, F. K.

    2015-06-01

    An incomplete postcranial skeleton (67 elements) of a cave lion, a lower jaw and a bundle of fine yellowish hair were found by a local resident in 2008 and 2009 washed out from the perennially frozen Pleistocene sediments in the lower reaches of the Malyi Anyui River (western Chukotka). This is the first skeleton of a cave lion (Panthera spelaea Goldfuss) to be found in Russia. The bone sizes are similar to finds of cave lion bones known from N-E Russia, but larger than East Beringian and smaller than West European ones. The remains have been studied using a variety of methods, including morphology, morphometry, SEM-examination, AMS-dating, and isotopic study, which included examination of over 100 samples of various members of the mammoth faunal assemblage (mammoth, wooly rhinoceros, bison, horse, bear, etc.). The results showed that the northeastern Asian cave lion hunted mainly bison and horses, but not reindeer, unlike its Western Europe counterpart. Bone and claw sheath dating showed an unexpectedly old geochronological age of over 61,000 years (OZQ290, OZQ291), while the hair was dated 28,690 ± 130 (OZQ292), which makes its affinity with the same individual as the skeleton questionable. Further studies to investigate possible unremoved contamination and obtain more reliable date are planned.

  11. The UF Family of hybrid phantoms of the pregnant female for computational radiation dosimetry

    International Nuclear Information System (INIS)

    Efforts to assess in utero radiation doses and related quantities to the developing fetus should account for the presence of the surrounding maternal tissues. Maternal tissues can provide varying levels of protection to the fetus by shielding externally-emitted radiation or, alternatively, can become sources of internally-emitted radiation following the biokinetic uptake of medically-administered radiopharmaceuticals or radionuclides located in the surrounding environment—as in the case of the European Union’s SOLO project (Epidemiological Studies of Exposed Southern Urals Populations). The University of Florida had previously addressed limitations in available computational phantom representation of the developing fetus by constructing a series of hybrid computational fetal phantoms at eight different ages and three weight percentiles. Using CT image sets of pregnant patients contoured using 3D-DOCTORTM, the eight 50th percentile fetal phantoms from that study were systematically combined in RhinocerosTM with the UF adult non-pregnant female to yield a series of reference pregnant female phantoms at fetal ages 8, 10, 15, 20, 25, 30, 35 and 38 weeks post-conception. Deformable, non-uniform rational B-spline surfaces were utilized to alter contoured maternal anatomy in order to (1) accurately position and orient each fetus and surrounding maternal tissues and (2) match target masses of maternal soft tissue organs to reference data reported in the literature. (paper)

  12. Effects of private-land use, livestock management, and human tolerance on diversity, distribution, and abundance of large african mammals.

    Science.gov (United States)

    Kinnaird, Margaret F; O'brien, Timothy G

    2012-12-01

    Successful conservation of large terrestrial mammals (wildlife) on private lands requires that landowners be empowered to manage wildlife so that benefits outweigh the costs. Laikipia County, Kenya, is predominantly unfenced, and the land uses in the area allow wide-ranging wildlife to move freely between different management systems on private land. We used camera traps to sample large mammals associated with 4 different management systems (rhinoceros sanctuaries, no livestock; conservancies, intermediate stocking level; fenced ranches, high stocking level; and group ranches, high stocking level, no fencing, pastoralist clan ownership) to examine whether management and stocking levels affect wildlife. We deployed cameras at 522 locations across 8 properties from January 2008 through October 2010 and used the photographs taken during this period to estimate richness, occupancy, and relative abundance of species. Species richness was highest in conservancies and sanctuaries and lowest on fenced and group ranches. Occupancy estimates were, on average, 2 and 5 times higher in sanctuaries and conservancies as on fenced and group ranches, respectively. Nineteen species on fenced ranches and 25 species on group ranches were considered uncommon (occupancy ecotourism benefits, forging agreements to maintain wildlife habitat and corridors, resolving land-ownership conflicts, restoring degraded rangelands, expanding opportunities for grazing leases, and allowing direct benefits to landowners through wildlife harvesting. . PMID:23082891

  13. Deformation of the reference Korean voxel model and its effect on dose calculation

    International Nuclear Information System (INIS)

    Recently a high-quality voxel model of a Korean adult male was constructed at Hanyang University by using very high resolution serially-sectioned anatomical images of a cadaver, which was provided by the Korean Institute of Science and Technology Information (KISTI). Most existing voxel phantoms are developed based on an individual in the supine posture. This study converted the HDRK-Man voxel model into surface model and adjusted the flattened back of the HDRK-Man to a normal shape in the upright posture using 3D graphic software such as 3D-DOCTORTM, Rapidform 2006, Rhinoceros 4.0, MAYA 8.5. The effective doses of adjusted model were compared with those of unadjusted model for some standard irradiation geometries (i.e., AP, PA, LLAT, RLAT). In general, the differences were not very large and, among those, the largest difference was found for the PA radiation geometry, as expected. These methodologies can be used for the development of various deformed posture models of HDRK-Man in the later stage of this project

  14. Serum concentrations of insulin-like growth factor-I and insulin-like growth factor binding protein-2 and -3 in eight hoofstock species.

    Science.gov (United States)

    Govoni, Kristen E; Goodman, Danielle; Maclure, Rebecca M; Penfold, Linda M; Zinn, Steven A

    2011-01-01

    The somatotropic axis, which includes growth hormone, insulin-like growth factor (IGF)-I, and IGF binding proteins (IGFBP), is involved in the regulation of growth and metabolism. Measures of the somatotropic axis can be predictive of nutritional status and growth rate that can be utilized to identify nutritional status of individual animals. Before the somatotropic axis can be a predictive tool, concentrations of hormones of the somatotropic axis need to be established in healthy individuals. To begin to establish these data, we quantified IGF-I, IGFBP-2, and IGFBP-3 in males and females of eight threatened hoofstock species at various ages. Opportunistic blood samples were collected from Bos javanicus (Java banteng), Tragelaphus eurycerus isaaci (bongo), Gazella dama ruficollis (addra gazelle), Taurotragus derbianus gigas (giant eland), Kobus megaceros (Nile lechwe), Hippotragus equines cottoni (roan antelope), Ceratotherium simum simum (white rhinoceros), and Elephas maximus (Asian elephant). Serum IGF-I and IGFBPs were determined by radioimmunoassay and ligand blot, respectively. Generally, IGF-I and IGFBP-3 were greater in males, and IGFBP-2 was greater in females. In banteng (P = 0.08) and male Nile lechwe (P elephants (P < 0.05) and antelope (P = 0.08), IGFBP-2 were greater in females. Determination of concentrations of hormones in the somatotropic axis in healthy animals makes it possible to develop models that can identify the nutritional status of these threatened hoofstock species. PMID:20853408

  15. One sententional model with the prepositional accusativ AS proleptic subject

    Directory of Open Access Journals (Sweden)

    Antonić Ivana

    2010-01-01

    copulative-adjectival structure biti siguran (be certain, biti ubeđen (be assured and the verbs verovati (believe, misliti (think; then the verb of fictitious cognition uobražavati (imagine; the verbs of speaking pričati (talk and, used in that meaning, the verbs čuti (hear, čitati (read, then kazati (say, šuškati ‘speak quietly’ (whisper, sumnjati (doubt, nagađati (suspect; and at the end the verbs of fear: brinuti se ‘fear’ (worry, bojati se (fear, pribojavati se (have fears, plašiti se (fear, strepeti (fear for, strahovati (be apprehensive. Since with these verbs the complement proposition acquires various features when it comes to factivity, this sentential model is analyzed from that perspective, too. Finally, the paper also discusses the frequency of negative / positive characterization of the referent of the proleptic subject.

  16. »Kommunikation und Kybernetik in Einzeldarstellungen”. Herausgegeben von H. Wolter und W. D. Keidel. Band 2: Structural Linguistics and Human Communication. An Introduction into the Mechanism of Language and the Methodology of Linguistics By Bertil Malmbe

    Directory of Open Access Journals (Sweden)

    Žarko Muljačić

    2016-02-01

    Full Text Available Za razliku od priručnika istog pisca New Trends in Linguistics. An Orientation, Stockholm-Lund 1964 (koji predstavlja dotjerani i ažurirani prijevod švedskog originala iz 1959. god. i o kome v. recenziju koju smo objavili u »ZFLMS« X, Novi Sad 1967, str. 181-188, ova je odlična monografija namijenjena uzem krugu čitalaca koji već imaju dovoljnih znanja iz lingvistike i fonetike ili iz društvenih i prirodnih nauka, kojima su od koristi tekovine i metode suvremene lingvistike (psihologija, fonijatrija, logoterapija, metodika učenja stranih jezika, nauka o komunikacijama i sl.. Autor, ugledni romanist i profesor fonetike na sveučilištu u Lundu, a od nedavna i na Sorbonni, svijestan je opasnosti da će lingvistika, prikazana prvenstveno kao znanost koja studira jezično komuniciranje ljudi, nužno morati da se pozabavi i vrlo širokim krugom problema pa će tako neka poglavlja ispasti za jedne čitaoce prekomplicirapa a za druge preelementarna. Drugačije međutim nije moglo biti ako se željelo na relativno malenom prostoru prikazati tako različite pojmove kao sto su fonemi i značenje, decibeli i jezicna promjena, knjizevni stil i govorne smetnje. Metodski pristup gradi i kompozicija sasvim su drugačiji nego u New Trends in Linguistics. Dok su tamo poglavlja posvečena pojedinim lingvističkim školama i pravcima (a samo indirektno i nekim skupinama problema ukoliko se neka škola uglavnom njiina bavila, ova je monografija obrađena problemski.

  17. Socijalni dijalog u profesionalnom sportu – nogomet kao model za druge kolektivne profesionalne sportove

    Directory of Open Access Journals (Sweden)

    Vanja Smokvina

    2012-12-01

    Full Text Available U radu autor analizira izvore europskog prava na temu socijalnog dijaloga u sportu s posebnim osvrtom na izvore tzv. „mekog prava“. Poštujući načelo autonomije sportskih udruženja i temeljnih gospodarskih sloboda unutarnjeg tržišta Europske unije (dalje: EU, europski socijalni dijalog snažno poduprt od strane institucija EU postaje sve važnijim čimbenikom u reguliranju odnosa, pa tako i radnopravnih odnosa, u profesionalnom sportu.Naglasak će biti i na autonomnim aktima sportskih udruženja (FIFA, UEFA i dr., sportskih liga, odnosno udruženja klubova (kao predstavnika poslodavaca i sindikata sportaša (nacionalnih sindikata, te udruženja FIFPro, kao predstavnika radnika, u prvom redu odgovarajućih sporazuma, odnosno kolektivnih ugovora u profesionalnom sportu, kako bi se pokazala primjena navedenog instituta na regionalnoj i nacionalnoj razini. Komparativno-pravno autor će napraviti analizu kolektivnog radnog prava u profesionalnom nogometu s posebnim osvrtom na Republiku Hrvatsku i prijedlozima de lege ferenda.Nogomet je uzet kao model ne zbog svoje popularnosti, već isključivo iz razloga što je u navedenom sportu socijalni dijalog dostigao najvišu razinu i putem njega možemo slobodno reći danas postepeno idemo ka stvaranju pravnog okvira za socijalni dijalog na razini čitavog sporta na području Europske unije.

  18. Prometni koridorji in poselitev v regiji. Navezovanje poselitve na javni promet

    Directory of Open Access Journals (Sweden)

    Mojca Sašek Divjak

    2004-01-01

    Full Text Available Navezovanje poselitve na javni promet na regionalni in mestni ravni je osnovna vsebina tega prispevka. Kot je značilno za zahodno Evropo, se tudi v Sloveniji v širših zaledjih večjih mest pojavljajo izraziti poselitveni pritiski in problemi, ki so vezani na razvoj suburbanizacije. V območjih regionalnih središč, kjer so močni prometni tokovi s pogostimi zastoji motornega prometa, bi moral biti javni promet osnova prometnega sistema. Pomemben je tudi pri konsolidaciji večjih gravitacijskih območij, zlasti somestij. Vendar pa ugotavljamo, da vzporedno s povečano rabo osebnega avtomobila upada uporaba javnih transportnih sredstev. Zato sedanje stanje zahteva sanacijo transportnih sistemov in primerno zgostitev poselitve, vezano predvsem na razvoj javnega prometa. To pa lahko dosežemo le s sinergetskim povezovanjem razvoja javnega potniškega prometa in prostorskega načrtovanja v trajnostno usmerjen poselitveni sistem. Na območju ljubljanske funkcijske regije smo še posebej obdelali povezovanje poselitve z regionalnim sistemom javnega prometa, predvsem s predvideno regionalno lahko železnico oziroma tramvajskim sistemom na ožjem mestnem območju. Predstavljen je model decentralizirane zgostitve poselitve. Na osnovi študije o konceptu razvoja naselij v koridorjih tirnega prometa je bil narejen predlog za potencialne možnosti zgostitve poselitve v ožjih območjih postaj primestne železnice v severnem delu regije od Črnuč do Kamnika.

  19. Fluorometric assay using naphthylamide substrates for assessing novel venom peptidase activities.

    Science.gov (United States)

    Gasparello-Clemente, Elaine; Silveira, Paulo Flávio

    2002-11-01

    In the present study we examined the feasibility of using the fluorometry of naphthylamine derivatives for revealing peptidase activities in venoms of the snakes Bothrops jararaca, Bothrops alternatus, Bothrops atrox, Bothrops moojeni, Bothrops insularis, Crotalus durissus terrificus and Bitis arietans, of the scorpions Tityus serrulatus and Tityus bahiensis, and of the spiders Phoneutria nigriventer and Loxosceles intermedia. Neutral aminopeptidase (APN) and prolyl-dipeptidyl aminopeptidase IV (DPP IV) activities were presented in all snake venoms, with the highest levels in B. alternatus. Although all examined peptidase activities showed relatively low levels in arthropod venoms, basic aminopeptidase (APB) activity from P. nigriventer venom was the exception. Compared to the other peptidase activities, relatively high levels of acid aminopeptidase (APA) activity were restricted to B. arietans venom. B. arietans also exhibited a prominent content of APB activity which was lower in other venoms. Relatively low prolyl endopeptidase and proline iminopeptidase activities were, respectively, detectable only in T. bahiensis and B. insularis. Pyroglutamate aminopeptidase activity was undetectable in all venoms. All examined peptidase activities were undetectable in T. serrulatus venom. In this study, the specificities of a diverse array of peptidase activities from representative venoms were demonstrated for the first time, with a description of their distribution which may contribute to guiding further investigations. The expressive difference between snake and arthropod venoms was indicated by APN and DPP IV activities while APA and APB activities distinguished the venom of B. arietans from those of Brazilian snakes. The data reflected the relatively uniform qualitative distribution of the peptidase activities investigated, together with their unequal quantitative distribution, indicating the evolutionary divergence in the processing of peptides in these different

  20. Evidence for improved cardiac performance after beta-blockade in patients with coronary artery disease.

    Science.gov (United States)

    Reale, A; Nigri, A; Gioffrè, P A

    1976-01-01

    The study was undertaken to investigate the acute haemodynamic effects of bunitrolol (0-2-hydroxy-3-(tert.butylamino)-propoxy)-bity. Right and left heart catheterization was performed in eleven patients with documented coronary artery disease. After bunitrolol (10 mg i.v.), there was a statistically significant decrease in left ventricular and aortic systolic pressures left ventricular end-diastolic pressure, aortic diastolic and mean pressures, pressure-rate product and compliance index (delta P/delta V). Left ventricular dp/dt, left ventricular dp/dt over isovolumic pressure, systemic resistance and heart rate tended to decrease, stroke volume and left ventricular stroke work index tended to increase, without statistical significance. Cardiac index showed individual variations, the mean values for the group being unchanged. Correlation of left ventricular end-diastolic pressure and left ventricular stroke work index showed a shift toward improved ventricular function curve in most cases, deterioration in no instance. Supine exercise was performed in ten patients. Angina occurred in nine patients; in five only before and in four before and after beta-blockade. Post-drug exercise heart rate, pressure-rate product and left ventricular end-diastolic pressure were significantly lower, the latter also in the four patients who still presented exercise angina. It is concluded that certain beta-blockers can improve cardiac performance at rest and during exercise in patients with coronary artery disease. This is explainable on the basis of a more favourable balance between oxygen supply and demand, together with a less marked negative inotropic effect due to the partial agonist activity of the agent used in the study. PMID:18374